--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Nov 24 15:40:59 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/330/Ntmt-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1973.42         -1982.21
2      -1973.09         -1982.06
--------------------------------------
TOTAL    -1973.24         -1982.14
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.374933    0.003232    0.264564    0.480435    0.369938   1276.97   1325.07    1.000
r(A<->C){all}   0.101069    0.000793    0.047157    0.154629    0.098986    848.41    900.31    1.000
r(A<->G){all}   0.292450    0.002609    0.200343    0.396583    0.289384    598.36    766.17    1.001
r(A<->T){all}   0.086027    0.001031    0.027853    0.150188    0.082416    903.47    989.88    1.000
r(C<->G){all}   0.067165    0.000459    0.029942    0.111177    0.065063    890.47    936.09    1.000
r(C<->T){all}   0.385461    0.003123    0.275084    0.490260    0.384191    746.75    794.05    1.001
r(G<->T){all}   0.067828    0.000633    0.022102    0.116987    0.065419    909.67    913.00    1.000
pi(A){all}      0.249291    0.000197    0.221695    0.276218    0.249129   1048.21   1210.93    1.000
pi(C){all}      0.264683    0.000198    0.237316    0.292641    0.265031   1167.30   1207.20    1.001
pi(G){all}      0.287151    0.000221    0.260110    0.317594    0.286916   1093.32   1131.89    1.000
pi(T){all}      0.198875    0.000175    0.173127    0.224392    0.198856    820.01    959.30    1.001
alpha{1,2}      0.055882    0.001615    0.000112    0.127943    0.049388   1183.21   1312.78    1.000
alpha{3}        2.208823    0.672129    0.884970    3.891913    2.080196   1468.81   1484.90    1.000
pinvar{all}     0.289528    0.009824    0.087826    0.475587    0.298077   1212.05   1275.86    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1878.084473
Model 2: PositiveSelection	-1878.084473
Model 0: one-ratio	-1882.665176
Model 3: discrete	-1876.899906
Model 7: beta	-1877.119905
Model 8: beta&w>1	-1877.119945


Model 0 vs 1	9.16140600000017

Model 2 vs 1	0.0

Model 8 vs 7	7.999999979801942E-5
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=276 

C1              MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
C2              MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
C3              MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
C4              MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
C5              MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
                * **** :*********: **:**   : :::********  **:.**.*

C1              SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
C2              SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
C3              SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
C4              SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
C5              STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
                *::*. *** ************:***********************.***

C1              EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
C2              EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
C3              EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
C4              EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
C5              EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
                **************************************.***:*******

C1              SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
C2              SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
C3              SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
C4              SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
C5              SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
                *:: ******::**********:*******:*******************

C1              KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
C2              KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
C3              KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
C4              KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
C5              KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
                *******.*:*:*******:*:***::*****************:*****

C1              RKVKQQNFPKGLFPVYMIACKPVSKE
C2              RKVKQQNFPKGLFPVYMIACKPVSKE
C3              RKVKQQNFPKGLFPVYMIACKPVSKE
C4              RKVKQQNFPKGLFPVYMIACKPVSKE
C5              RKVKQQNFPKGLFPVYMIACKPVSKE
                **************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  276 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  276 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5520]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [5520]--->[5520]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.288 Mb, Max= 30.580 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE

FORMAT of file /tmp/tmp487571641168774826aln Not Supported[FATAL:T-COFFEE]
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:276 S:100 BS:276
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 94.93 C1	 C2	 94.93
TOP	    1    0	 94.93 C2	 C1	 94.93
BOT	    0    2	 93.84 C1	 C3	 93.84
TOP	    2    0	 93.84 C3	 C1	 93.84
BOT	    0    3	 91.67 C1	 C4	 91.67
TOP	    3    0	 91.67 C4	 C1	 91.67
BOT	    0    4	 90.22 C1	 C5	 90.22
TOP	    4    0	 90.22 C5	 C1	 90.22
BOT	    1    2	 98.19 C2	 C3	 98.19
TOP	    2    1	 98.19 C3	 C2	 98.19
BOT	    1    3	 90.94 C2	 C4	 90.94
TOP	    3    1	 90.94 C4	 C2	 90.94
BOT	    1    4	 89.86 C2	 C5	 89.86
TOP	    4    1	 89.86 C5	 C2	 89.86
BOT	    2    3	 89.86 C3	 C4	 89.86
TOP	    3    2	 89.86 C4	 C3	 89.86
BOT	    2    4	 88.41 C3	 C5	 88.41
TOP	    4    2	 88.41 C5	 C3	 88.41
BOT	    3    4	 92.39 C4	 C5	 92.39
TOP	    4    3	 92.39 C5	 C4	 92.39
AVG	 0	 C1	  *	 92.66
AVG	 1	 C2	  *	 93.48
AVG	 2	 C3	  *	 92.57
AVG	 3	 C4	  *	 91.21
AVG	 4	 C5	  *	 90.22
TOT	 TOT	  *	 92.03
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
C2              ATGAGGACTACATTAGAAGAGCAGCTTTCAGACAAACTGCAGATGATGGA
C3              ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
C4              ATGACGACTACATTAGAAGCCGAGCTTTCAGACAAGTTACAGATGATGGA
C5              ATGCCGACTACATTAGAAGCCCAGCTTTCAGACAAGCTACAGATGATGGA
                ***. **************.  *************. *.***********

C1              CGAGACCACGGATAAGGTCCAGGGGTCGTCGAAGCAGAAGGATGATAGCA
C2              CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCAGAAGGAAGATAGCA
C3              CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCTGAAGGAAGATAGCA
C4              CGAGACCACAGACAACGTCCAGGAGCTGGTGAAGCAGGAGGAAGACAGCA
C5              CGAGATCACAGATAACGTCCAAGAGCCGGCGGAGCAGAAGGAAGAAAGCA
                *** * ***.** ** **.**.*.*  *  *.***:*.****:** ****

C1              GTATAGCCGCAAGTTCAGATGCCAAGACAGCGTCCCCTTCTTCGAGCGAT
C2              GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
C3              GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
C4              GTATAGCCGCAAGCTCCGATGCCCAGACAGCAACCCCTTCTTCCAGCGAT
C5              GTATAGCCGCCAGTTCCGATATTAAGACAGCGTCCACTTCTTCCAGCGAT
                **********.** **.***.  ..******.:**.******* *.*** 

C1              AGTTCGACCAAAGTCGCCGCACCGGAGTCCGAATTTTACAATAAGGCACA
C2              AGTGCGACCAAAGTCGCCGCACCTGAGATCGAATTTTACAACAAGGCTCA
C3              AGTGCGACCAAAGTCGCCGCACCGGAGATCGAATTTTACAACAAGGCTCA
C4              AGTGCTTCCAAAGTTGCAGCACCGGAGCCCGAGTTTTACAATAAAGCTCA
C5              AGTACGACCAAAACTGACGCACCGGAGCCCGAATTTTACAATAAGGCCCA
                *** * :*****.  *..***** ***  ***.******** **.** **

C1              AAAATATTGGTCTGAGGTACCGGCGACTGTTAACGGGATGCTCGGCGGCC
C2              GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
C3              GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
C4              GAAGTACTGGTCGGAGATTCCGGCTACTGTCAACGGGATGCTTGGCGGCC
C5              GAAGTACTGGTCGGAGATTCCGGCCACTGTCAACGGGATGCTCGGCGGCC
                .**.** ***** ***.*:***** ***** ** ******** *******

C1              TGGGCTACATTAGTGCCATAGATATACAGGGATCGAATGTGTTCCTGCGC
C2              TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
C3              TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
C4              TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCTTGCGC
C5              TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCCTGCGC
                ********** ** *****.*****:************. **** *****

C1              GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C2              GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C3              GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C4              GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C5              GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
                **************************************************

C1              TGGTCGGGTGACTCGGAATCTCCTGATCCCCCGCTTCAGCTGCGTGGATC
C2              CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
C3              CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
C4              CGGTCGGGTGACTCGGAATCTCCTGATCCCACGTTTCAGCTGCGTGGATC
C5              CGGTCGGGTGACTCGCAATCTCCTGATACCCCGCTTCAGCTGCGTAGATC
                 ************** *********** **.** ***********.****

C1              TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACT
C2              TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
C3              TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
C4              TCGTCGAGCAGGATCCTGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
C5              TCGTCGAGCAGGATGCCGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
                * ************ * ** ******** ******************** 

C1              TCGGAAGACGGAAGCCGTGGAAAGGTGGGACAGATCTATAACGTGGGATT
C2              TCGGAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
C3              TCGAAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
C4              TCGGAAGACGTGAGCCGTGGAAAGGTGGGCCACATCTACAACGTCGGATT
C5              TCGGAAGAAGTGAGCCGTGGAAAGGTGGGCCAGATCTACAACGTCGGATT
                ***.*.**.* .*****************.** .**** ***** *****

C1              GCAGAAGTTTACGCCTACGCAACAGTACGACCTCGTTTGGACCCAGTGGG
C2              GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
C3              GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
C4              GCAAAAGTTCACGCCTTCGCAGCAGTATGACCTCGTTTGGAGCCAATGGG
C5              GCAAAAGTTCACGCCTTCGCAGCAGTACGACCTCGTTTGGAGCCAATGGG
                ***.***** ******:****.***** ************* ***.****

C1              TCCTGGGCCATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGACGCATA
C2              TGCTGGGACATCTCACAGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
C3              TGCTGGGACATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
C4              TGCTGGGTCATCTCACAGACCGCGACCTGGTCTCGTTCTTTCGTCGCATC
C5              TGCTAGGCCATCTCACGGATCGCGATCTGGTCTCGTTCTTTCGTCGGATC
                * **.** ********.** ***** ***************** ** **.

C1              AAGCAGGGACTGGCGCCCGGCGCCTTCTTGTGTCTGAAGGAGAACGTGAG
C2              AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
C3              AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
C4              AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTCTGAAGGAAAACGTGAG
C5              AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTATGAAGGAGAACGTGAG
                ********************.* ****** ***.*******.********

C1              CAGCTCGAAGAAGACAGTGGAAGATAGGAACGACTCGTCGGTAACGAGGC
C2              CAGCTCGAAGAAGACAGTGGAGGATAAGAATGACTCGTCAGTTACGAGGC
C3              CAGCTCGAGGAAGACAGTGGAGGATAAGAATGACTCGTCGGTTACGAGGC
C4              CAGCTCGAAGAAGGCGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
C5              CAGCTCCAAAAAGACGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
                ****** *..***.*.*****.** *.*.* ***** ** **:** ****

C1              CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
C2              CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
C3              CTCTGGACAGCTATGAACACTTCCTAAAAGAAACCGGATTTCGCATTGTA
C4              CTCTGGATAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTG
C5              CCCTTGACAGTTATGAGCACTTTCTAAAGGAGGCTGGATTTCGCATTGTG
                * ** ** ** *****.***** *****.**..* **************.

C1              CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTCTTTCCAGTGTACAT
C2              CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
C3              CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
C4              CGCAAGGTCAAACAACAAAACTTTCCCAAGGGACTTTTTCCAGTGTACAT
C5              CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTTTTTCCAGTATACAT
                ***********.*********************** ********.*****

C1              GATAGCCTGCAAACCCGTCTCCAAGGAA
C2              GATCGCCTGCAAACCCGTCTCCAAGGAA
C3              GATCGCCTGCAAACCCGTCTCCAAGGAA
C4              GATCGCCTGCAAACCTGTCTCTAAGGAA
C5              GATCGCCTGCAAACCCGTCTCTAAGGAA
                ***.*********** ***** ******



>C1
ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
CGAGACCACGGATAAGGTCCAGGGGTCGTCGAAGCAGAAGGATGATAGCA
GTATAGCCGCAAGTTCAGATGCCAAGACAGCGTCCCCTTCTTCGAGCGAT
AGTTCGACCAAAGTCGCCGCACCGGAGTCCGAATTTTACAATAAGGCACA
AAAATATTGGTCTGAGGTACCGGCGACTGTTAACGGGATGCTCGGCGGCC
TGGGCTACATTAGTGCCATAGATATACAGGGATCGAATGTGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
TGGTCGGGTGACTCGGAATCTCCTGATCCCCCGCTTCAGCTGCGTGGATC
TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACT
TCGGAAGACGGAAGCCGTGGAAAGGTGGGACAGATCTATAACGTGGGATT
GCAGAAGTTTACGCCTACGCAACAGTACGACCTCGTTTGGACCCAGTGGG
TCCTGGGCCATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGACGCATA
AAGCAGGGACTGGCGCCCGGCGCCTTCTTGTGTCTGAAGGAGAACGTGAG
CAGCTCGAAGAAGACAGTGGAAGATAGGAACGACTCGTCGGTAACGAGGC
CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTCTTTCCAGTGTACAT
GATAGCCTGCAAACCCGTCTCCAAGGAA
>C2
ATGAGGACTACATTAGAAGAGCAGCTTTCAGACAAACTGCAGATGATGGA
CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCAGAAGGAAGATAGCA
GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
AGTGCGACCAAAGTCGCCGCACCTGAGATCGAATTTTACAACAAGGCTCA
GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
TCGGAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
TGCTGGGACATCTCACAGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
CAGCTCGAAGAAGACAGTGGAGGATAAGAATGACTCGTCAGTTACGAGGC
CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
GATCGCCTGCAAACCCGTCTCCAAGGAA
>C3
ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCTGAAGGAAGATAGCA
GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
AGTGCGACCAAAGTCGCCGCACCGGAGATCGAATTTTACAACAAGGCTCA
GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
TCGAAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
TGCTGGGACATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
CAGCTCGAGGAAGACAGTGGAGGATAAGAATGACTCGTCGGTTACGAGGC
CTCTGGACAGCTATGAACACTTCCTAAAAGAAACCGGATTTCGCATTGTA
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
GATCGCCTGCAAACCCGTCTCCAAGGAA
>C4
ATGACGACTACATTAGAAGCCGAGCTTTCAGACAAGTTACAGATGATGGA
CGAGACCACAGACAACGTCCAGGAGCTGGTGAAGCAGGAGGAAGACAGCA
GTATAGCCGCAAGCTCCGATGCCCAGACAGCAACCCCTTCTTCCAGCGAT
AGTGCTTCCAAAGTTGCAGCACCGGAGCCCGAGTTTTACAATAAAGCTCA
GAAGTACTGGTCGGAGATTCCGGCTACTGTCAACGGGATGCTTGGCGGCC
TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCTTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGGAATCTCCTGATCCCACGTTTCAGCTGCGTGGATC
TCGTCGAGCAGGATCCTGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
TCGGAAGACGTGAGCCGTGGAAAGGTGGGCCACATCTACAACGTCGGATT
GCAAAAGTTCACGCCTTCGCAGCAGTATGACCTCGTTTGGAGCCAATGGG
TGCTGGGTCATCTCACAGACCGCGACCTGGTCTCGTTCTTTCGTCGCATC
AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTCTGAAGGAAAACGTGAG
CAGCTCGAAGAAGGCGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
CTCTGGATAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTG
CGCAAGGTCAAACAACAAAACTTTCCCAAGGGACTTTTTCCAGTGTACAT
GATCGCCTGCAAACCTGTCTCTAAGGAA
>C5
ATGCCGACTACATTAGAAGCCCAGCTTTCAGACAAGCTACAGATGATGGA
CGAGATCACAGATAACGTCCAAGAGCCGGCGGAGCAGAAGGAAGAAAGCA
GTATAGCCGCCAGTTCCGATATTAAGACAGCGTCCACTTCTTCCAGCGAT
AGTACGACCAAAACTGACGCACCGGAGCCCGAATTTTACAATAAGGCCCA
GAAGTACTGGTCGGAGATTCCGGCCACTGTCAACGGGATGCTCGGCGGCC
TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGCAATCTCCTGATACCCCGCTTCAGCTGCGTAGATC
TCGTCGAGCAGGATGCCGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
TCGGAAGAAGTGAGCCGTGGAAAGGTGGGCCAGATCTACAACGTCGGATT
GCAAAAGTTCACGCCTTCGCAGCAGTACGACCTCGTTTGGAGCCAATGGG
TGCTAGGCCATCTCACGGATCGCGATCTGGTCTCGTTCTTTCGTCGGATC
AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTATGAAGGAGAACGTGAG
CAGCTCCAAAAAGACGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
CCCTTGACAGTTATGAGCACTTTCTAAAGGAGGCTGGATTTCGCATTGTG
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTTTTTCCAGTATACAT
GATCGCCTGCAAACCCGTCTCTAAGGAA
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 828 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480001790
      Setting output file names to "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 642927972
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0932072150
      Seed = 2123701979
      Swapseed = 1480001790
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 26 unique site patterns
      Division 2 has 21 unique site patterns
      Division 3 has 58 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2233.857759 -- -25.624409
         Chain 2 -- -2415.725506 -- -25.624409
         Chain 3 -- -2401.309176 -- -25.624409
         Chain 4 -- -2401.309176 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2328.173420 -- -25.624409
         Chain 2 -- -2398.861297 -- -25.624409
         Chain 3 -- -2401.414162 -- -25.624409
         Chain 4 -- -2395.378409 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2233.858] (-2415.726) (-2401.309) (-2401.309) * [-2328.173] (-2398.861) (-2401.414) (-2395.378) 
        500 -- (-2016.898) (-2014.266) (-2016.801) [-2007.418] * (-2023.532) (-2003.155) (-2015.889) [-2000.336] -- 0:00:00
       1000 -- (-2015.603) (-2003.631) [-2010.540] (-1999.406) * (-2008.499) (-2001.347) (-2012.440) [-1991.860] -- 0:00:00
       1500 -- (-2006.889) (-1998.559) (-2010.316) [-1990.750] * (-2008.355) (-1993.617) (-2004.631) [-1991.443] -- 0:11:05
       2000 -- (-2009.848) (-1996.411) (-2007.560) [-1986.422] * (-2001.242) (-1991.584) [-1994.817] (-1988.417) -- 0:08:19
       2500 -- (-1990.323) [-1985.413] (-1989.841) (-1991.495) * (-2010.531) (-1983.318) (-1989.849) [-1978.468] -- 0:06:39
       3000 -- [-1984.139] (-1987.708) (-1982.429) (-1988.165) * (-1995.159) (-1980.142) (-1987.305) [-1977.741] -- 0:05:32
       3500 -- (-1979.092) (-1986.753) [-1983.388] (-1982.093) * (-1980.613) (-1982.046) (-1976.651) [-1979.341] -- 0:04:44
       4000 -- (-1977.429) (-1983.760) [-1979.892] (-1974.930) * (-1984.848) (-1981.476) [-1975.280] (-1975.912) -- 0:04:09
       4500 -- [-1973.281] (-1980.271) (-1976.513) (-1977.759) * (-1993.605) (-1975.702) (-1972.766) [-1971.049] -- 0:03:41
       5000 -- [-1974.705] (-1980.605) (-1985.931) (-1973.244) * (-1983.699) (-1978.863) (-1975.176) [-1976.068] -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-1977.308) (-1978.880) (-1976.632) [-1975.835] * (-1976.837) (-1984.705) [-1973.929] (-1971.473) -- 0:03:00
       6000 -- (-1977.834) [-1972.290] (-1974.796) (-1979.020) * (-1976.572) (-1978.697) (-1974.306) [-1973.888] -- 0:05:31
       6500 -- (-1978.628) (-1976.580) (-1979.153) [-1974.273] * (-1982.618) (-1972.565) [-1974.069] (-1977.620) -- 0:05:05
       7000 -- [-1983.058] (-1979.512) (-1977.878) (-1980.486) * (-1980.027) [-1975.688] (-1973.252) (-1980.666) -- 0:04:43
       7500 -- [-1980.388] (-1981.353) (-1973.646) (-1978.969) * (-1973.640) (-1976.724) [-1971.628] (-1981.001) -- 0:04:24
       8000 -- (-1977.496) (-1979.127) (-1972.541) [-1970.910] * (-1975.013) [-1981.468] (-1978.410) (-1974.417) -- 0:04:08
       8500 -- [-1981.177] (-1985.196) (-1972.000) (-1980.649) * (-1988.152) (-1975.187) (-1976.255) [-1976.462] -- 0:03:53
       9000 -- (-1973.920) [-1986.646] (-1977.695) (-1979.250) * (-1977.931) (-1976.796) (-1980.547) [-1976.161] -- 0:03:40
       9500 -- (-1977.048) (-1984.465) (-1977.517) [-1974.808] * (-1975.707) [-1981.176] (-1977.628) (-1971.293) -- 0:03:28
      10000 -- (-1978.950) (-1982.272) [-1972.735] (-1976.942) * [-1977.016] (-1975.567) (-1984.479) (-1973.341) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-1976.406] (-1983.633) (-1976.362) (-1974.529) * (-1972.819) (-1978.064) (-1985.605) [-1976.990] -- 0:03:08
      11000 -- (-1980.793) (-1980.840) (-1980.554) [-1975.117] * [-1971.500] (-1972.959) (-1985.752) (-1974.696) -- 0:04:29
      11500 -- [-1979.820] (-1981.210) (-1976.832) (-1980.075) * (-1974.589) (-1972.590) [-1977.470] (-1972.023) -- 0:04:17
      12000 -- (-1978.506) (-1973.318) (-1975.156) [-1979.649] * (-1974.071) (-1977.085) (-1975.635) [-1976.053] -- 0:04:07
      12500 -- (-1981.957) (-1976.755) [-1973.803] (-1975.278) * (-1974.923) [-1976.044] (-1975.592) (-1973.557) -- 0:03:57
      13000 -- (-1975.638) (-1975.013) [-1976.547] (-1975.237) * (-1973.498) (-1974.410) (-1976.489) [-1978.990] -- 0:03:47
      13500 -- (-1987.381) [-1975.269] (-1975.667) (-1980.327) * (-1983.234) (-1974.149) (-1983.027) [-1979.564] -- 0:03:39
      14000 -- (-1981.163) [-1973.666] (-1974.811) (-1978.449) * (-1977.291) (-1973.338) (-1982.663) [-1972.829] -- 0:03:31
      14500 -- (-1973.652) [-1974.807] (-1973.276) (-1980.607) * [-1975.561] (-1977.159) (-1979.185) (-1984.729) -- 0:03:23
      15000 -- [-1974.143] (-1972.804) (-1975.641) (-1975.615) * (-1975.545) (-1981.210) [-1980.532] (-1975.132) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-1975.307) (-1975.845) (-1980.657) [-1974.053] * (-1978.588) [-1974.081] (-1985.818) (-1977.782) -- 0:04:14
      16000 -- (-1979.651) [-1979.488] (-1978.603) (-1975.798) * (-1976.199) (-1974.711) (-1980.428) [-1975.646] -- 0:04:06
      16500 -- (-1978.424) [-1979.070] (-1978.657) (-1975.696) * [-1977.209] (-1970.084) (-1979.924) (-1974.210) -- 0:03:58
      17000 -- (-1980.455) [-1973.346] (-1975.385) (-1976.156) * (-1982.003) (-1980.224) [-1979.302] (-1978.076) -- 0:03:51
      17500 -- (-1980.462) (-1978.807) [-1972.562] (-1973.378) * (-1980.069) [-1986.658] (-1982.291) (-1973.767) -- 0:03:44
      18000 -- (-1977.314) (-1976.294) [-1975.759] (-1973.868) * (-1978.109) (-1972.911) (-1975.102) [-1974.562] -- 0:03:38
      18500 -- (-1976.239) (-1985.895) [-1977.853] (-1976.733) * [-1979.302] (-1980.006) (-1977.540) (-1980.864) -- 0:03:32
      19000 -- (-1979.829) (-1977.271) (-1973.900) [-1974.831] * [-1979.077] (-1985.401) (-1982.255) (-1980.360) -- 0:03:26
      19500 -- (-1979.712) (-1979.931) [-1980.127] (-1978.235) * (-1975.454) (-1976.875) [-1978.002] (-1983.136) -- 0:03:21
      20000 -- [-1980.790] (-1982.438) (-1986.001) (-1978.767) * (-1973.915) (-1974.440) (-1974.093) [-1977.006] -- 0:03:16

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-1975.217) [-1973.842] (-1977.937) (-1977.519) * (-1979.108) [-1975.837] (-1975.057) (-1976.186) -- 0:03:58
      21000 -- (-1982.982) (-1975.717) [-1977.377] (-1975.060) * (-1979.513) [-1977.590] (-1980.247) (-1983.060) -- 0:03:53
      21500 -- (-1977.429) [-1973.595] (-1977.441) (-1977.025) * (-1979.713) (-1971.827) [-1974.446] (-1983.897) -- 0:03:47
      22000 -- (-1978.699) (-1980.758) [-1974.969] (-1978.711) * (-1975.621) (-1982.911) (-1975.656) [-1974.439] -- 0:03:42
      22500 -- [-1972.707] (-1980.044) (-1978.328) (-1973.558) * (-1977.901) [-1980.465] (-1977.369) (-1980.597) -- 0:03:37
      23000 -- [-1978.958] (-1977.371) (-1974.805) (-1977.340) * [-1974.582] (-1977.219) (-1979.444) (-1980.228) -- 0:03:32
      23500 -- (-1981.341) (-1975.851) (-1977.301) [-1978.412] * (-1976.254) (-1986.386) [-1980.131] (-1978.194) -- 0:03:27
      24000 -- (-1977.748) [-1974.572] (-1974.670) (-1983.036) * [-1975.415] (-1983.659) (-1976.809) (-1982.764) -- 0:03:23
      24500 -- (-1978.619) (-1979.874) [-1971.108] (-1981.767) * (-1974.939) [-1975.758] (-1980.176) (-1975.299) -- 0:03:19
      25000 -- [-1972.559] (-1980.997) (-1976.472) (-1975.065) * (-1974.830) (-1979.457) (-1982.093) [-1979.850] -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      25500 -- (-1977.548) [-1975.222] (-1975.080) (-1972.707) * (-1972.354) (-1975.757) [-1977.038] (-1978.880) -- 0:03:49
      26000 -- (-1974.002) [-1974.386] (-1976.150) (-1972.284) * [-1970.924] (-1978.581) (-1973.039) (-1983.756) -- 0:03:44
      26500 -- (-1975.326) [-1971.158] (-1982.563) (-1975.254) * (-1975.513) [-1977.574] (-1973.084) (-1980.376) -- 0:03:40
      27000 -- [-1972.016] (-1973.797) (-1982.874) (-1973.578) * (-1974.057) (-1983.342) (-1985.654) [-1976.134] -- 0:03:36
      27500 -- (-1975.130) [-1983.341] (-1983.905) (-1977.154) * (-1973.629) [-1980.039] (-1975.255) (-1978.000) -- 0:03:32
      28000 -- (-1972.866) [-1977.883] (-1978.368) (-1976.399) * (-1977.606) (-1975.092) [-1974.570] (-1975.704) -- 0:03:28
      28500 -- [-1974.926] (-1977.823) (-1979.379) (-1978.337) * (-1978.922) (-1974.593) (-1979.063) [-1971.521] -- 0:03:24
      29000 -- [-1977.761] (-1973.503) (-1978.197) (-1979.129) * (-1971.873) [-1977.744] (-1981.640) (-1975.528) -- 0:03:20
      29500 -- (-1977.379) (-1983.051) [-1975.594] (-1976.408) * (-1977.791) [-1974.816] (-1981.418) (-1973.632) -- 0:03:17
      30000 -- [-1980.363] (-1982.038) (-1978.843) (-1976.518) * [-1979.855] (-1983.461) (-1982.297) (-1974.994) -- 0:03:46

      Average standard deviation of split frequencies: 0.000000

      30500 -- (-1979.807) (-1978.965) [-1978.041] (-1979.308) * [-1977.662] (-1978.138) (-1975.973) (-1974.764) -- 0:03:42
      31000 -- (-1973.304) (-1977.836) [-1976.453] (-1978.144) * [-1973.320] (-1981.528) (-1977.828) (-1978.498) -- 0:03:38
      31500 -- (-1972.782) (-1982.716) (-1976.643) [-1976.247] * (-1972.945) (-1979.849) [-1980.738] (-1985.666) -- 0:03:35
      32000 -- [-1975.447] (-1983.036) (-1977.111) (-1978.607) * [-1972.756] (-1979.372) (-1975.403) (-1984.525) -- 0:03:31
      32500 -- (-1978.927) [-1980.623] (-1974.007) (-1974.956) * (-1979.757) (-1981.390) (-1977.314) [-1976.844] -- 0:03:28
      33000 -- (-1983.157) [-1979.734] (-1973.006) (-1975.754) * (-1978.169) (-1981.984) (-1979.159) [-1975.121] -- 0:03:25
      33500 -- (-1978.455) (-1975.898) (-1981.778) [-1975.301] * [-1976.648] (-1984.504) (-1974.020) (-1977.929) -- 0:03:21
      34000 -- (-1976.240) (-1978.882) [-1975.428] (-1980.263) * (-1981.085) (-1985.630) [-1975.949] (-1976.312) -- 0:03:18
      34500 -- [-1976.985] (-1978.525) (-1978.847) (-1973.765) * [-1980.615] (-1978.828) (-1974.362) (-1975.037) -- 0:03:15
      35000 -- (-1974.215) (-1977.594) [-1973.738] (-1971.764) * (-1980.922) (-1985.735) [-1974.272] (-1973.924) -- 0:03:40

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-1974.647) (-1975.495) [-1974.599] (-1972.742) * (-1983.685) (-1974.120) (-1974.633) [-1972.427] -- 0:03:37
      36000 -- (-1976.416) [-1972.658] (-1972.679) (-1975.531) * (-1983.569) (-1979.507) [-1976.879] (-1978.494) -- 0:03:34
      36500 -- (-1982.827) [-1976.521] (-1976.025) (-1974.363) * (-1977.462) (-1982.053) [-1975.693] (-1979.741) -- 0:03:31
      37000 -- (-1982.427) (-1984.663) [-1975.610] (-1974.462) * (-1977.473) (-1976.978) [-1981.429] (-1978.795) -- 0:03:28
      37500 -- [-1976.585] (-1977.943) (-1977.841) (-1974.829) * (-1987.409) [-1974.536] (-1980.393) (-1977.295) -- 0:03:25
      38000 -- (-1977.297) (-1974.839) (-1979.401) [-1972.795] * [-1985.414] (-1976.304) (-1983.551) (-1978.444) -- 0:03:22
      38500 -- [-1973.865] (-1979.252) (-1977.446) (-1973.507) * [-1977.717] (-1976.358) (-1981.410) (-1974.240) -- 0:03:19
      39000 -- (-1975.686) [-1981.662] (-1977.626) (-1977.012) * (-1971.965) (-1975.413) [-1976.472] (-1975.820) -- 0:03:17
      39500 -- (-1975.618) (-1976.866) [-1977.751] (-1974.703) * (-1977.941) (-1979.517) [-1977.869] (-1976.256) -- 0:03:38
      40000 -- [-1972.697] (-1980.423) (-1977.421) (-1974.486) * (-1976.471) [-1980.552] (-1971.018) (-1975.593) -- 0:03:36

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-1977.254) [-1973.789] (-1974.799) (-1976.145) * (-1974.821) (-1977.571) [-1976.048] (-1977.998) -- 0:03:33
      41000 -- (-1977.490) [-1975.593] (-1982.944) (-1976.387) * (-1971.715) (-1975.535) (-1973.232) [-1977.310] -- 0:03:30
      41500 -- [-1974.900] (-1981.060) (-1973.839) (-1977.988) * (-1980.109) [-1977.411] (-1973.780) (-1975.499) -- 0:03:27
      42000 -- (-1976.501) (-1992.699) [-1977.918] (-1973.373) * (-1986.844) [-1973.439] (-1975.586) (-1981.535) -- 0:03:25
      42500 -- (-1976.132) [-1982.219] (-1976.869) (-1988.546) * (-1977.642) [-1976.136] (-1973.874) (-1980.589) -- 0:03:22
      43000 -- (-1980.418) (-1975.207) [-1973.945] (-1990.250) * (-1980.828) [-1973.041] (-1976.517) (-1973.396) -- 0:03:20
      43500 -- (-1979.732) (-1972.937) [-1973.424] (-1977.151) * (-1975.824) [-1978.389] (-1977.023) (-1975.714) -- 0:03:17
      44000 -- (-1980.316) (-1975.737) [-1973.632] (-1972.613) * [-1976.299] (-1980.621) (-1973.054) (-1976.854) -- 0:03:15
      44500 -- [-1974.344] (-1977.191) (-1985.377) (-1980.320) * (-1976.284) (-1974.464) (-1974.847) [-1977.041] -- 0:03:34
      45000 -- (-1975.234) [-1978.546] (-1980.768) (-1980.012) * (-1976.202) (-1971.001) (-1976.291) [-1972.118] -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      45500 -- (-1984.006) [-1975.784] (-1976.350) (-1977.424) * (-1975.279) [-1977.314] (-1975.435) (-1979.970) -- 0:03:29
      46000 -- (-1975.774) (-1976.850) (-1975.542) [-1980.394] * (-1973.263) (-1974.960) [-1976.946] (-1977.317) -- 0:03:27
      46500 -- [-1978.104] (-1975.701) (-1979.885) (-1982.382) * (-1975.678) (-1982.004) (-1979.813) [-1983.056] -- 0:03:25
      47000 -- (-1983.229) (-1976.070) (-1973.998) [-1980.175] * (-1975.357) (-1974.345) (-1977.829) [-1979.665] -- 0:03:22
      47500 -- (-1975.201) (-1982.331) [-1979.942] (-1978.195) * (-1979.802) [-1977.944] (-1977.469) (-1974.871) -- 0:03:20
      48000 -- (-1976.611) [-1974.460] (-1973.693) (-1976.780) * (-1974.659) (-1978.904) (-1978.633) [-1976.160] -- 0:03:18
      48500 -- (-1972.978) [-1976.265] (-1978.100) (-1979.378) * (-1975.114) [-1981.021] (-1981.399) (-1977.626) -- 0:03:16
      49000 -- [-1976.726] (-1980.574) (-1975.570) (-1978.729) * [-1976.499] (-1984.625) (-1978.265) (-1972.372) -- 0:03:14
      49500 -- (-1980.339) (-1983.565) (-1974.045) [-1976.600] * [-1977.794] (-1974.316) (-1980.754) (-1975.710) -- 0:03:31
      50000 -- (-1976.769) (-1979.503) [-1976.743] (-1982.348) * [-1975.179] (-1978.751) (-1981.600) (-1976.255) -- 0:03:29

      Average standard deviation of split frequencies: 0.000000

      50500 -- [-1981.153] (-1985.698) (-1975.461) (-1981.095) * (-1980.074) [-1977.430] (-1973.915) (-1975.269) -- 0:03:26
      51000 -- [-1977.697] (-1982.919) (-1982.759) (-1977.922) * (-1979.379) (-1982.970) [-1972.357] (-1976.552) -- 0:03:24
      51500 -- [-1973.784] (-1981.044) (-1976.366) (-1983.693) * (-1975.904) (-1986.619) [-1974.476] (-1976.360) -- 0:03:22
      52000 -- [-1975.818] (-1976.761) (-1982.716) (-1976.044) * [-1980.780] (-1990.008) (-1977.711) (-1977.374) -- 0:03:20
      52500 -- (-1973.748) (-1982.226) (-1982.491) [-1973.093] * (-1977.029) (-1979.710) (-1973.652) [-1976.938] -- 0:03:18
      53000 -- (-1977.676) [-1981.114] (-1978.527) (-1980.705) * [-1975.880] (-1980.016) (-1975.119) (-1984.573) -- 0:03:16
      53500 -- [-1973.009] (-1982.407) (-1981.001) (-1977.410) * (-1979.397) (-1978.604) (-1983.034) [-1979.916] -- 0:03:14
      54000 -- (-1973.379) (-1975.156) [-1976.916] (-1974.878) * [-1975.398] (-1979.367) (-1977.553) (-1983.099) -- 0:03:30
      54500 -- (-1977.978) (-1976.487) (-1978.926) [-1972.754] * (-1974.990) [-1980.919] (-1974.657) (-1983.118) -- 0:03:28
      55000 -- (-1978.509) [-1977.634] (-1977.942) (-1975.475) * [-1971.882] (-1980.882) (-1976.751) (-1983.087) -- 0:03:26

      Average standard deviation of split frequencies: 0.000000

      55500 -- [-1977.006] (-1973.426) (-1979.755) (-1972.117) * (-1972.691) (-1974.134) [-1976.064] (-1985.766) -- 0:03:24
      56000 -- (-1977.106) (-1978.774) (-1976.012) [-1979.376] * (-1976.391) (-1976.466) (-1980.670) [-1985.633] -- 0:03:22
      56500 -- (-1975.526) (-1973.162) (-1972.621) [-1976.189] * [-1974.823] (-1980.086) (-1989.537) (-1981.032) -- 0:03:20
      57000 -- (-1976.787) (-1979.424) [-1974.658] (-1982.439) * (-1973.843) (-1976.178) [-1979.588] (-1979.574) -- 0:03:18
      57500 -- (-1978.565) (-1972.158) (-1977.816) [-1981.423] * (-1974.520) (-1972.709) (-1978.293) [-1978.330] -- 0:03:16
      58000 -- [-1983.747] (-1977.714) (-1974.664) (-1974.768) * [-1973.494] (-1974.994) (-1976.472) (-1982.744) -- 0:03:14
      58500 -- (-1976.904) (-1975.625) [-1984.160] (-1977.920) * (-1979.498) (-1976.377) (-1979.466) [-1974.611] -- 0:03:13
      59000 -- (-1981.269) (-1977.936) [-1975.298] (-1974.913) * (-1975.293) [-1975.631] (-1980.008) (-1977.497) -- 0:03:27
      59500 -- (-1975.836) (-1974.255) [-1973.265] (-1974.546) * [-1977.234] (-1978.856) (-1982.988) (-1977.300) -- 0:03:25
      60000 -- (-1972.476) (-1978.769) [-1972.649] (-1973.029) * (-1975.120) [-1974.523] (-1977.381) (-1977.636) -- 0:03:23

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-1974.274) (-1979.988) [-1975.329] (-1979.225) * (-1978.223) [-1984.301] (-1976.019) (-1976.416) -- 0:03:21
      61000 -- (-1970.270) (-1973.999) [-1977.102] (-1982.600) * (-1972.729) [-1976.288] (-1973.809) (-1984.131) -- 0:03:20
      61500 -- (-1977.246) (-1973.972) (-1978.715) [-1977.441] * (-1971.208) [-1975.467] (-1981.200) (-1975.864) -- 0:03:18
      62000 -- [-1979.514] (-1975.640) (-1974.018) (-1979.279) * (-1973.652) (-1976.777) [-1979.429] (-1973.328) -- 0:03:16
      62500 -- (-1983.007) (-1976.979) [-1970.259] (-1977.049) * (-1976.572) [-1974.303] (-1977.685) (-1982.819) -- 0:03:15
      63000 -- (-1982.893) (-1974.207) (-1972.672) [-1971.946] * (-1974.340) [-1977.458] (-1976.525) (-1981.135) -- 0:03:13
      63500 -- (-1977.842) (-1975.429) (-1975.067) [-1976.882] * (-1979.192) [-1978.849] (-1978.397) (-1983.791) -- 0:03:26
      64000 -- (-1980.339) (-1974.233) [-1975.564] (-1978.393) * [-1969.977] (-1980.706) (-1980.174) (-1976.754) -- 0:03:24
      64500 -- (-1978.116) (-1979.663) (-1980.925) [-1975.547] * [-1972.301] (-1976.314) (-1975.132) (-1974.777) -- 0:03:23
      65000 -- (-1979.835) (-1974.845) [-1977.041] (-1973.864) * (-1976.774) (-1975.987) [-1977.659] (-1981.228) -- 0:03:21

      Average standard deviation of split frequencies: 0.000000

      65500 -- [-1975.755] (-1981.554) (-1980.017) (-1973.857) * (-1977.357) (-1978.990) (-1979.355) [-1976.586] -- 0:03:19
      66000 -- (-1978.604) (-1978.224) [-1976.451] (-1981.287) * (-1974.759) (-1977.470) (-1977.368) [-1987.575] -- 0:03:18
      66500 -- [-1973.011] (-1979.970) (-1983.689) (-1983.612) * (-1976.481) [-1971.940] (-1980.439) (-1978.424) -- 0:03:16
      67000 -- [-1974.612] (-1970.119) (-1981.057) (-1986.041) * (-1975.066) [-1973.932] (-1979.114) (-1984.959) -- 0:03:14
      67500 -- (-1973.700) [-1973.521] (-1986.850) (-1978.684) * (-1970.516) (-1976.419) [-1974.014] (-1980.739) -- 0:03:13
      68000 -- (-1986.939) (-1974.305) (-1982.275) [-1977.244] * (-1970.923) (-1976.154) [-1973.096] (-1978.317) -- 0:03:25
      68500 -- (-1980.233) (-1976.271) (-1980.503) [-1982.451] * (-1977.654) (-1972.597) [-1977.977] (-1973.119) -- 0:03:23
      69000 -- (-1974.715) (-1977.250) [-1976.317] (-1980.104) * [-1979.736] (-1974.719) (-1975.540) (-1976.369) -- 0:03:22
      69500 -- (-1977.095) (-1975.279) (-1975.355) [-1977.955] * [-1981.291] (-1980.750) (-1974.669) (-1974.392) -- 0:03:20
      70000 -- [-1974.083] (-1974.615) (-1971.027) (-1984.986) * (-1973.335) [-1977.035] (-1976.822) (-1976.423) -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

      70500 -- [-1970.869] (-1979.803) (-1974.845) (-1980.562) * (-1972.531) (-1971.265) [-1974.385] (-1973.120) -- 0:03:17
      71000 -- (-1974.155) [-1978.893] (-1976.263) (-1984.284) * (-1976.646) (-1977.146) [-1975.004] (-1983.020) -- 0:03:16
      71500 -- [-1972.162] (-1971.971) (-1975.316) (-1984.274) * [-1974.756] (-1973.940) (-1978.677) (-1975.707) -- 0:03:14
      72000 -- (-1971.277) (-1975.708) (-1978.932) [-1978.501] * (-1985.357) (-1975.985) (-1980.368) [-1979.466] -- 0:03:13
      72500 -- [-1973.047] (-1980.501) (-1973.080) (-1978.339) * (-1979.594) (-1979.412) (-1977.418) [-1978.820] -- 0:03:11
      73000 -- [-1973.514] (-1977.512) (-1977.824) (-1976.444) * (-1974.786) [-1978.027] (-1977.056) (-1977.264) -- 0:03:23
      73500 -- [-1973.983] (-1973.661) (-1975.387) (-1976.700) * (-1980.791) [-1974.353] (-1977.615) (-1976.162) -- 0:03:21
      74000 -- (-1986.364) (-1977.003) (-1976.911) [-1972.794] * (-1975.211) [-1978.630] (-1980.329) (-1985.877) -- 0:03:20
      74500 -- [-1975.049] (-1976.799) (-1977.615) (-1976.287) * (-1982.685) [-1974.859] (-1982.515) (-1990.656) -- 0:03:18
      75000 -- (-1979.164) [-1974.365] (-1977.174) (-1979.110) * (-1987.503) (-1980.016) [-1978.141] (-1989.574) -- 0:03:17

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-1976.074) (-1975.565) (-1974.534) [-1974.858] * (-1976.904) [-1975.553] (-1977.220) (-1983.456) -- 0:03:15
      76000 -- (-1975.342) (-1973.823) [-1974.963] (-1979.814) * (-1979.941) (-1978.824) (-1975.822) [-1974.332] -- 0:03:14
      76500 -- (-1985.224) [-1976.518] (-1974.547) (-1976.810) * (-1983.983) (-1973.288) (-1973.282) [-1974.948] -- 0:03:13
      77000 -- (-1976.281) (-1980.422) [-1977.016] (-1982.721) * (-1982.589) (-1982.509) [-1976.686] (-1971.145) -- 0:03:11
      77500 -- [-1975.484] (-1979.608) (-1972.102) (-1982.337) * (-1977.396) [-1975.087] (-1979.128) (-1979.501) -- 0:03:22
      78000 -- (-1975.622) (-1977.226) (-1975.647) [-1973.312] * (-1980.148) (-1976.366) [-1981.209] (-1980.479) -- 0:03:20
      78500 -- (-1978.799) (-1976.465) [-1972.844] (-1977.596) * (-1979.902) (-1978.395) [-1975.406] (-1985.621) -- 0:03:19
      79000 -- (-1970.965) (-1973.269) [-1979.180] (-1978.030) * (-1976.812) [-1984.530] (-1976.218) (-1985.528) -- 0:03:18
      79500 -- (-1977.005) (-1973.004) (-1977.754) [-1976.653] * (-1978.171) (-1986.972) [-1978.613] (-1973.484) -- 0:03:16
      80000 -- (-1976.933) (-1976.253) [-1976.425] (-1974.797) * [-1976.570] (-1988.482) (-1985.587) (-1974.745) -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      80500 -- [-1979.827] (-1975.201) (-1977.513) (-1973.269) * (-1978.413) (-1985.040) [-1975.649] (-1981.065) -- 0:03:14
      81000 -- (-1983.180) (-1974.090) (-1972.247) [-1971.945] * (-1982.031) (-1985.277) (-1974.171) [-1977.036] -- 0:03:12
      81500 -- [-1978.104] (-1971.875) (-1977.578) (-1975.934) * (-1975.358) (-1984.758) [-1975.644] (-1981.688) -- 0:03:22
      82000 -- (-1980.109) (-1978.088) (-1979.651) [-1975.419] * (-1973.766) (-1981.724) (-1978.905) [-1975.971] -- 0:03:21
      82500 -- [-1980.936] (-1977.936) (-1987.824) (-1977.296) * [-1976.861] (-1982.656) (-1977.952) (-1976.354) -- 0:03:20
      83000 -- (-1978.366) (-1977.333) (-1981.549) [-1976.838] * (-1976.659) [-1977.196] (-1983.753) (-1981.652) -- 0:03:18
      83500 -- [-1978.899] (-1978.400) (-1981.989) (-1970.672) * (-1980.770) (-1986.199) [-1977.388] (-1982.125) -- 0:03:17
      84000 -- [-1975.836] (-1980.609) (-1981.243) (-1976.568) * (-1978.552) [-1979.052] (-1979.256) (-1977.945) -- 0:03:16
      84500 -- [-1975.310] (-1980.975) (-1975.971) (-1982.663) * (-1980.114) (-1977.876) (-1973.657) [-1974.142] -- 0:03:15
      85000 -- (-1973.727) (-1981.307) [-1972.301] (-1976.916) * (-1985.018) (-1979.829) [-1978.620] (-1976.716) -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-1978.128) (-1977.145) [-1972.867] (-1977.561) * [-1975.609] (-1980.858) (-1976.043) (-1974.170) -- 0:03:12
      86000 -- (-1973.768) (-1974.876) [-1977.935] (-1978.357) * [-1975.605] (-1976.289) (-1976.092) (-1979.474) -- 0:03:11
      86500 -- (-1980.065) (-1984.960) (-1976.186) [-1975.884] * (-1975.488) (-1975.566) [-1972.452] (-1978.431) -- 0:03:20
      87000 -- (-1978.546) (-1980.736) (-1974.802) [-1973.727] * (-1986.135) [-1981.616] (-1977.128) (-1980.734) -- 0:03:19
      87500 -- (-1979.925) (-1974.505) [-1973.967] (-1973.470) * [-1972.330] (-1976.190) (-1978.227) (-1985.575) -- 0:03:18
      88000 -- [-1978.073] (-1976.820) (-1977.967) (-1974.434) * [-1972.862] (-1980.775) (-1978.481) (-1976.685) -- 0:03:16
      88500 -- (-1977.078) (-1981.374) (-1978.485) [-1973.639] * [-1974.251] (-1973.862) (-1980.765) (-1978.400) -- 0:03:15
      89000 -- (-1977.729) (-1974.954) (-1978.409) [-1968.743] * [-1978.234] (-1975.936) (-1980.074) (-1979.859) -- 0:03:14
      89500 -- (-1984.037) [-1977.057] (-1995.768) (-1971.404) * (-1976.458) [-1974.368] (-1982.733) (-1973.965) -- 0:03:13
      90000 -- [-1976.060] (-1981.257) (-1979.232) (-1976.433) * (-1981.073) [-1974.236] (-1975.103) (-1979.329) -- 0:03:12

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-1973.736) [-1975.912] (-1982.364) (-1988.286) * [-1979.245] (-1978.775) (-1976.355) (-1979.327) -- 0:03:10
      91000 -- (-1973.307) (-1977.232) (-1982.324) [-1979.268] * (-1977.319) [-1978.972] (-1981.669) (-1976.094) -- 0:03:09
      91500 -- (-1977.702) (-1974.737) (-1980.413) [-1977.829] * (-1981.962) (-1974.289) [-1977.422] (-1971.893) -- 0:03:18
      92000 -- (-1976.701) (-1977.712) (-1979.009) [-1976.357] * (-1980.023) (-1983.438) (-1974.935) [-1973.028] -- 0:03:17
      92500 -- (-1984.003) (-1978.547) (-1989.220) [-1977.352] * [-1973.074] (-1979.089) (-1978.674) (-1978.240) -- 0:03:16
      93000 -- [-1978.600] (-1973.087) (-1983.923) (-1973.357) * (-1975.667) [-1978.243] (-1982.094) (-1980.313) -- 0:03:15
      93500 -- (-1977.972) (-1979.180) [-1975.506] (-1978.582) * (-1974.356) (-1977.258) (-1978.268) [-1974.294] -- 0:03:13
      94000 -- (-1980.749) (-1976.096) [-1978.844] (-1977.803) * (-1975.813) (-1974.974) (-1977.126) [-1971.387] -- 0:03:12
      94500 -- [-1977.228] (-1971.204) (-1981.073) (-1978.269) * [-1981.938] (-1974.323) (-1980.369) (-1977.432) -- 0:03:11
      95000 -- [-1981.209] (-1978.709) (-1978.119) (-1973.849) * [-1980.509] (-1976.612) (-1984.656) (-1977.305) -- 0:03:10

      Average standard deviation of split frequencies: 0.000000

      95500 -- [-1975.254] (-1970.674) (-1979.455) (-1990.866) * (-1981.248) (-1975.605) [-1978.253] (-1977.988) -- 0:03:09
      96000 -- (-1971.420) (-1977.156) (-1984.069) [-1982.701] * (-1979.438) (-1973.540) [-1976.039] (-1978.048) -- 0:03:17
      96500 -- [-1976.212] (-1972.218) (-1987.379) (-1974.339) * [-1975.759] (-1978.614) (-1980.857) (-1974.795) -- 0:03:16
      97000 -- (-1974.448) (-1977.546) [-1978.173] (-1980.817) * (-1979.643) (-1975.690) (-1974.932) [-1980.104] -- 0:03:15
      97500 -- (-1976.043) [-1974.942] (-1986.475) (-1975.587) * (-1981.555) [-1972.835] (-1976.894) (-1977.215) -- 0:03:14
      98000 -- (-1984.479) (-1980.340) [-1976.070] (-1981.748) * (-1977.188) [-1975.274] (-1975.552) (-1974.289) -- 0:03:13
      98500 -- (-1972.749) [-1979.879] (-1976.420) (-1981.232) * (-1976.623) (-1974.524) [-1970.253] (-1969.356) -- 0:03:12
      99000 -- (-1975.002) (-1980.392) [-1972.047] (-1979.232) * (-1979.321) [-1974.952] (-1972.480) (-1972.074) -- 0:03:11
      99500 -- [-1972.099] (-1986.276) (-1973.671) (-1980.434) * (-1973.201) (-1978.812) [-1973.517] (-1974.669) -- 0:03:10
      100000 -- (-1975.314) (-1981.421) [-1974.387] (-1981.687) * [-1976.431] (-1975.662) (-1974.768) (-1977.249) -- 0:03:09

      Average standard deviation of split frequencies: 0.000000

      100500 -- [-1984.021] (-1976.996) (-1974.381) (-1975.248) * (-1976.562) (-1978.501) [-1977.765] (-1978.143) -- 0:03:07
      101000 -- (-1975.796) (-1982.177) (-1975.333) [-1972.968] * [-1972.894] (-1974.947) (-1977.544) (-1984.227) -- 0:03:15
      101500 -- (-1974.075) (-1979.248) [-1977.351] (-1978.704) * (-1975.786) [-1978.331] (-1980.112) (-1982.240) -- 0:03:14
      102000 -- [-1973.623] (-1978.706) (-1971.475) (-1977.517) * (-1975.978) (-1980.220) [-1974.902] (-1979.843) -- 0:03:13
      102500 -- [-1976.891] (-1981.953) (-1980.914) (-1974.348) * (-1972.661) [-1971.737] (-1981.824) (-1977.437) -- 0:03:12
      103000 -- (-1981.265) (-1991.623) (-1979.972) [-1972.504] * (-1985.447) (-1975.501) [-1973.811] (-1986.665) -- 0:03:11
      103500 -- (-1979.281) (-1979.324) [-1978.584] (-1976.596) * (-1979.335) (-1978.232) [-1971.704] (-1978.317) -- 0:03:10
      104000 -- (-1972.304) (-1980.047) [-1979.601] (-1971.748) * [-1973.652] (-1979.720) (-1977.160) (-1979.049) -- 0:03:09
      104500 -- (-1975.482) (-1975.931) (-1975.308) [-1974.946] * (-1979.819) [-1976.436] (-1978.962) (-1974.409) -- 0:03:08
      105000 -- (-1977.949) [-1976.859] (-1972.430) (-1973.314) * [-1976.414] (-1982.893) (-1975.378) (-1980.671) -- 0:03:07

      Average standard deviation of split frequencies: 0.000000

      105500 -- (-1973.874) (-1976.150) [-1977.357] (-1976.275) * (-1979.656) [-1973.212] (-1975.256) (-1976.265) -- 0:03:15
      106000 -- [-1974.870] (-1971.956) (-1979.070) (-1975.991) * [-1978.686] (-1975.866) (-1981.041) (-1976.005) -- 0:03:13
      106500 -- (-1982.679) (-1971.488) [-1977.316] (-1982.732) * (-1980.687) [-1971.690] (-1978.094) (-1973.719) -- 0:03:12
      107000 -- (-1986.510) [-1972.227] (-1973.264) (-1978.012) * (-1985.248) [-1975.062] (-1976.018) (-1977.176) -- 0:03:11
      107500 -- (-1983.684) (-1981.295) [-1973.531] (-1983.040) * (-1985.144) [-1976.873] (-1974.666) (-1979.511) -- 0:03:10
      108000 -- (-1982.752) [-1979.519] (-1978.208) (-1978.143) * (-1981.124) [-1975.408] (-1971.912) (-1973.471) -- 0:03:09
      108500 -- (-1981.455) (-1973.595) [-1976.633] (-1984.661) * (-1982.567) (-1975.140) (-1977.487) [-1975.687] -- 0:03:08
      109000 -- [-1976.332] (-1974.147) (-1974.993) (-1973.819) * (-1982.125) [-1977.618] (-1974.149) (-1975.701) -- 0:03:08
      109500 -- (-1975.852) (-1973.611) [-1974.402] (-1975.834) * [-1974.063] (-1977.710) (-1984.169) (-1979.695) -- 0:03:07
      110000 -- (-1979.209) [-1976.642] (-1978.895) (-1977.307) * (-1976.956) (-1984.116) (-1978.469) [-1976.651] -- 0:03:06

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-1976.882) (-1978.297) (-1972.373) [-1977.853] * [-1978.834] (-1983.236) (-1983.875) (-1981.747) -- 0:03:13
      111000 -- [-1976.076] (-1973.836) (-1979.582) (-1973.418) * [-1975.551] (-1975.582) (-1981.491) (-1977.517) -- 0:03:12
      111500 -- [-1979.606] (-1976.134) (-1977.347) (-1981.799) * (-1978.238) [-1978.480] (-1975.870) (-1982.307) -- 0:03:11
      112000 -- (-1986.213) (-1972.321) [-1978.098] (-1974.308) * (-1982.472) (-1983.046) [-1976.460] (-1978.375) -- 0:03:10
      112500 -- (-1976.572) [-1981.285] (-1979.075) (-1982.134) * [-1975.451] (-1982.788) (-1975.566) (-1970.993) -- 0:03:09
      113000 -- (-1976.199) (-1977.419) (-1975.431) [-1987.004] * (-1976.812) (-1972.693) (-1980.605) [-1975.797] -- 0:03:08
      113500 -- (-1976.153) [-1982.839] (-1979.195) (-1976.250) * (-1975.759) [-1977.622] (-1977.173) (-1974.369) -- 0:03:07
      114000 -- (-1976.517) [-1973.995] (-1990.909) (-1983.402) * (-1973.310) (-1981.775) (-1981.511) [-1973.573] -- 0:03:06
      114500 -- [-1980.092] (-1974.682) (-1976.400) (-1986.256) * [-1973.833] (-1978.767) (-1974.526) (-1983.759) -- 0:03:05
      115000 -- (-1978.472) [-1974.999] (-1983.075) (-1976.504) * (-1975.748) [-1973.523] (-1981.160) (-1975.848) -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-1979.670) (-1974.871) [-1973.479] (-1974.730) * (-1978.546) (-1976.329) (-1979.887) [-1977.912] -- 0:03:11
      116000 -- (-1978.670) [-1980.881] (-1979.882) (-1973.330) * (-1974.993) (-1975.292) (-1976.403) [-1982.197] -- 0:03:10
      116500 -- (-1980.397) [-1980.348] (-1982.051) (-1972.563) * [-1977.408] (-1981.353) (-1985.718) (-1982.534) -- 0:03:09
      117000 -- [-1978.395] (-1977.729) (-1990.618) (-1986.116) * (-1980.970) [-1976.571] (-1978.391) (-1975.543) -- 0:03:08
      117500 -- (-1977.634) (-1971.907) [-1973.348] (-1980.585) * [-1976.521] (-1975.687) (-1975.574) (-1978.549) -- 0:03:07
      118000 -- (-1977.339) (-1975.719) [-1979.619] (-1977.835) * (-1976.252) (-1982.186) [-1976.684] (-1983.967) -- 0:03:06
      118500 -- (-1977.860) (-1972.519) [-1973.701] (-1978.178) * (-1976.360) (-1982.968) [-1975.005] (-1977.398) -- 0:03:05
      119000 -- (-1984.218) (-1976.432) (-1976.078) [-1975.055] * (-1971.808) (-1982.755) [-1976.756] (-1980.654) -- 0:03:05
      119500 -- (-1978.650) [-1978.490] (-1978.869) (-1976.168) * [-1981.194] (-1975.036) (-1980.388) (-1982.773) -- 0:03:04
      120000 -- (-1974.969) [-1976.069] (-1977.125) (-1978.318) * (-1973.746) (-1983.415) [-1973.956] (-1978.510) -- 0:03:03

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-1977.578) [-1974.910] (-1978.152) (-1978.756) * (-1975.909) (-1976.281) [-1971.054] (-1974.593) -- 0:03:09
      121000 -- [-1978.840] (-1976.338) (-1979.445) (-1980.400) * (-1979.861) (-1973.741) [-1975.819] (-1976.783) -- 0:03:08
      121500 -- (-1981.180) (-1975.031) [-1975.073] (-1973.764) * (-1983.344) (-1978.987) [-1978.151] (-1977.210) -- 0:03:07
      122000 -- (-1973.999) (-1977.684) (-1983.485) [-1976.633] * (-1980.689) (-1975.367) (-1977.328) [-1973.847] -- 0:03:07
      122500 -- [-1976.125] (-1971.245) (-1980.611) (-1973.043) * (-1979.472) [-1983.612] (-1978.453) (-1975.426) -- 0:03:06
      123000 -- (-1976.045) (-1978.856) (-1979.066) [-1976.759] * (-1979.601) [-1975.870] (-1987.053) (-1974.055) -- 0:03:05
      123500 -- (-1973.441) (-1975.673) [-1974.559] (-1971.864) * (-1975.505) [-1974.388] (-1973.136) (-1980.927) -- 0:03:04
      124000 -- (-1975.568) (-1988.883) (-1978.829) [-1971.710] * (-1984.692) (-1975.450) (-1973.604) [-1976.595] -- 0:03:03
      124500 -- (-1980.926) (-1981.490) [-1982.691] (-1981.153) * (-1974.308) [-1972.999] (-1973.596) (-1976.811) -- 0:03:02
      125000 -- [-1979.530] (-1974.003) (-1976.658) (-1977.151) * (-1975.986) (-1974.697) [-1976.885] (-1981.191) -- 0:03:09

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-1974.008) (-1977.090) (-1979.116) [-1981.313] * (-1976.340) [-1971.684] (-1977.528) (-1975.408) -- 0:03:08
      126000 -- (-1977.871) (-1975.367) [-1977.589] (-1976.916) * (-1979.293) (-1974.689) [-1978.095] (-1979.530) -- 0:03:07
      126500 -- (-1977.712) (-1974.524) [-1973.800] (-1983.754) * [-1982.867] (-1974.819) (-1975.096) (-1974.531) -- 0:03:06
      127000 -- (-1974.917) (-1976.466) [-1971.811] (-1978.659) * [-1974.051] (-1975.676) (-1978.237) (-1975.750) -- 0:03:05
      127500 -- (-1974.622) [-1976.647] (-1975.866) (-1976.945) * (-1984.860) (-1976.242) (-1975.695) [-1975.544] -- 0:03:04
      128000 -- [-1970.523] (-1981.544) (-1972.852) (-1972.416) * (-1984.686) [-1975.485] (-1979.747) (-1982.038) -- 0:03:03
      128500 -- (-1974.351) (-1980.281) (-1973.230) [-1975.594] * [-1975.927] (-1976.731) (-1977.200) (-1972.529) -- 0:03:03
      129000 -- (-1976.412) (-1977.779) (-1977.814) [-1979.620] * [-1978.299] (-1979.457) (-1975.073) (-1973.827) -- 0:03:02
      129500 -- (-1978.866) [-1978.653] (-1976.043) (-1978.191) * [-1984.049] (-1981.378) (-1979.338) (-1976.528) -- 0:03:01
      130000 -- (-1977.018) [-1982.134] (-1979.967) (-1978.196) * (-1986.084) (-1977.330) (-1979.208) [-1977.268] -- 0:03:07

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-1974.723) [-1979.123] (-1972.946) (-1974.424) * (-1980.009) [-1982.178] (-1980.892) (-1975.202) -- 0:03:06
      131000 -- (-1975.866) (-1982.111) [-1975.462] (-1980.147) * (-1980.365) [-1983.078] (-1980.904) (-1984.943) -- 0:03:05
      131500 -- (-1984.569) (-1980.577) [-1977.323] (-1982.742) * (-1980.458) [-1982.144] (-1982.636) (-1974.085) -- 0:03:04
      132000 -- [-1975.732] (-1976.902) (-1971.590) (-1977.510) * [-1973.221] (-1976.391) (-1984.612) (-1975.339) -- 0:03:04
      132500 -- (-1974.410) (-1976.764) (-1975.552) [-1975.261] * (-1975.237) (-1978.875) (-1986.053) [-1978.234] -- 0:03:03
      133000 -- (-1979.282) (-1977.720) (-1978.610) [-1980.379] * [-1979.115] (-1977.152) (-1981.212) (-1975.379) -- 0:03:02
      133500 -- (-1984.365) (-1974.272) [-1974.104] (-1975.025) * (-1977.768) (-1978.909) [-1981.289] (-1972.532) -- 0:03:01
      134000 -- [-1977.137] (-1973.117) (-1976.457) (-1978.981) * (-1977.265) [-1974.080] (-1980.345) (-1975.180) -- 0:03:00
      134500 -- (-1978.496) [-1976.570] (-1979.214) (-1976.180) * (-1979.796) [-1975.050] (-1977.761) (-1978.674) -- 0:03:06
      135000 -- (-1971.957) (-1981.319) [-1977.710] (-1976.135) * (-1977.946) [-1973.806] (-1979.827) (-1971.655) -- 0:03:05

      Average standard deviation of split frequencies: 0.000000

      135500 -- [-1974.713] (-1978.098) (-1977.981) (-1972.508) * (-1976.496) (-1971.901) (-1977.724) [-1979.654] -- 0:03:05
      136000 -- (-1974.712) (-1976.069) (-1985.054) [-1980.543] * (-1977.871) [-1977.564] (-1986.460) (-1977.061) -- 0:03:04
      136500 -- (-1975.630) (-1977.788) [-1978.237] (-1975.574) * (-1977.988) [-1972.691] (-1979.577) (-1973.132) -- 0:03:03
      137000 -- (-1984.245) [-1982.293] (-1981.639) (-1976.367) * (-1977.975) (-1973.815) (-1978.000) [-1978.792] -- 0:03:02
      137500 -- (-1987.823) (-1979.730) [-1973.619] (-1977.933) * (-1977.743) (-1973.650) (-1974.988) [-1985.906] -- 0:03:01
      138000 -- (-1985.491) (-1981.894) (-1979.583) [-1975.497] * (-1980.486) [-1977.010] (-1980.456) (-1979.914) -- 0:03:01
      138500 -- [-1974.802] (-1983.125) (-1974.560) (-1972.947) * (-1981.210) [-1972.404] (-1976.101) (-1977.888) -- 0:03:00
      139000 -- (-1977.127) [-1980.451] (-1980.597) (-1975.534) * (-1978.675) (-1976.069) [-1973.843] (-1979.746) -- 0:02:59
      139500 -- (-1971.608) (-1975.842) [-1972.372] (-1973.113) * (-1979.636) (-1972.020) (-1977.557) [-1979.835] -- 0:03:05
      140000 -- (-1978.595) (-1981.450) [-1971.525] (-1981.087) * [-1973.620] (-1981.612) (-1977.788) (-1980.593) -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-1975.350) (-1974.055) [-1978.688] (-1981.059) * (-1974.040) (-1978.432) (-1971.607) [-1975.881] -- 0:03:03
      141000 -- (-1975.878) [-1978.359] (-1979.477) (-1980.179) * (-1982.011) (-1977.915) [-1973.459] (-1982.623) -- 0:03:02
      141500 -- (-1980.987) (-1982.082) [-1978.330] (-1981.622) * (-1977.160) (-1974.301) [-1978.787] (-1981.848) -- 0:03:02
      142000 -- [-1974.823] (-1978.122) (-1980.902) (-1977.358) * [-1975.786] (-1973.124) (-1977.564) (-1980.901) -- 0:03:01
      142500 -- [-1978.943] (-1975.381) (-1980.290) (-1972.873) * (-1973.571) [-1973.961] (-1974.956) (-1978.765) -- 0:03:00
      143000 -- [-1978.874] (-1978.441) (-1979.182) (-1983.490) * [-1977.081] (-1979.456) (-1972.322) (-1980.480) -- 0:02:59
      143500 -- (-1978.968) (-1976.058) (-1977.390) [-1981.222] * (-1977.256) (-1980.544) (-1979.983) [-1978.709] -- 0:02:59
      144000 -- (-1980.154) (-1977.904) [-1975.129] (-1976.699) * [-1975.152] (-1982.811) (-1981.605) (-1973.223) -- 0:02:58
      144500 -- (-1976.207) [-1978.278] (-1979.164) (-1976.747) * (-1974.463) [-1976.810] (-1971.656) (-1977.378) -- 0:03:03
      145000 -- (-1976.151) (-1981.901) [-1982.742] (-1974.230) * (-1976.674) (-1976.541) (-1972.776) [-1977.718] -- 0:03:02

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-1988.125) [-1978.093] (-1985.272) (-1977.868) * [-1976.091] (-1980.549) (-1975.512) (-1975.934) -- 0:03:02
      146000 -- (-1975.574) (-1982.406) (-1976.661) [-1978.547] * [-1974.780] (-1975.756) (-1975.623) (-1977.778) -- 0:03:01
      146500 -- (-1970.133) (-1976.708) [-1975.403] (-1979.012) * [-1972.742] (-1974.735) (-1975.320) (-1979.266) -- 0:03:00
      147000 -- (-1983.784) (-1978.737) [-1973.885] (-1974.397) * (-1972.655) (-1973.941) (-1981.744) [-1974.681] -- 0:02:59
      147500 -- (-1985.742) (-1974.139) [-1972.962] (-1977.202) * [-1972.589] (-1984.174) (-1996.302) (-1974.673) -- 0:02:59
      148000 -- (-1984.082) [-1974.188] (-1975.956) (-1976.086) * (-1971.355) (-1980.724) (-1977.720) [-1973.363] -- 0:02:58
      148500 -- (-1979.939) [-1976.926] (-1975.688) (-1979.504) * (-1975.541) (-1979.021) [-1980.760] (-1976.532) -- 0:02:57
      149000 -- (-1978.385) [-1975.384] (-1976.186) (-1980.752) * (-1981.198) [-1974.970] (-1978.382) (-1979.380) -- 0:03:02
      149500 -- (-1976.260) [-1981.790] (-1976.605) (-1986.133) * (-1979.047) (-1973.990) [-1973.346] (-1977.090) -- 0:03:02
      150000 -- [-1977.112] (-1976.072) (-1976.339) (-1977.990) * (-1976.643) [-1970.965] (-1979.753) (-1977.432) -- 0:03:01

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-1980.355) (-1978.384) [-1976.206] (-1980.370) * (-1973.340) [-1980.335] (-1976.597) (-1978.813) -- 0:03:00
      151000 -- [-1978.363] (-1981.315) (-1974.662) (-1978.154) * [-1976.062] (-1984.230) (-1978.016) (-1978.598) -- 0:02:59
      151500 -- [-1982.812] (-1978.414) (-1971.465) (-1978.564) * [-1974.650] (-1977.207) (-1975.308) (-1981.232) -- 0:02:59
      152000 -- (-1976.510) (-1981.803) [-1971.695] (-1973.999) * (-1972.761) [-1974.647] (-1979.826) (-1980.300) -- 0:02:58
      152500 -- (-1980.210) (-1978.051) [-1977.840] (-1983.986) * (-1977.937) (-1976.005) (-1978.285) [-1984.836] -- 0:02:57
      153000 -- (-1978.601) (-1975.409) [-1978.999] (-1976.035) * (-1975.635) (-1979.738) [-1973.629] (-1975.624) -- 0:02:57
      153500 -- (-1980.829) (-1977.909) [-1974.764] (-1978.847) * (-1980.906) [-1977.087] (-1974.321) (-1974.549) -- 0:02:56
      154000 -- (-1979.102) [-1978.192] (-1983.651) (-1977.321) * (-1982.864) [-1971.686] (-1976.915) (-1985.747) -- 0:03:01
      154500 -- (-1974.855) (-1977.505) (-1980.144) [-1977.997] * (-1979.206) [-1976.531] (-1974.273) (-1974.951) -- 0:03:00
      155000 -- [-1975.866] (-1981.511) (-1984.225) (-1977.115) * (-1974.293) (-1972.775) (-1979.614) [-1973.893] -- 0:02:59

      Average standard deviation of split frequencies: 0.000000

      155500 -- [-1980.555] (-1978.490) (-1986.926) (-1978.160) * (-1974.339) [-1974.820] (-1982.268) (-1985.393) -- 0:02:59
      156000 -- (-1971.662) (-1975.599) (-1980.702) [-1980.264] * [-1972.965] (-1980.772) (-1978.697) (-1977.517) -- 0:02:58
      156500 -- (-1970.414) [-1975.512] (-1976.952) (-1973.980) * (-1973.442) (-1980.372) (-1978.407) [-1978.779] -- 0:02:57
      157000 -- (-1977.370) (-1977.294) (-1977.177) [-1976.884] * [-1973.887] (-1973.512) (-1982.299) (-1985.348) -- 0:02:57
      157500 -- [-1979.587] (-1973.797) (-1976.690) (-1979.664) * (-1981.002) [-1978.528] (-1981.649) (-1978.668) -- 0:02:56
      158000 -- (-1976.138) [-1976.768] (-1978.955) (-1983.315) * (-1981.073) (-1979.202) (-1976.723) [-1973.299] -- 0:02:55
      158500 -- (-1977.435) (-1975.103) [-1975.325] (-1980.289) * (-1979.789) (-1986.354) (-1975.974) [-1974.273] -- 0:02:55
      159000 -- (-1987.536) (-1978.046) (-1979.634) [-1981.553] * (-1984.675) [-1973.402] (-1979.988) (-1980.764) -- 0:02:59
      159500 -- (-1979.128) [-1979.816] (-1976.593) (-1983.022) * [-1986.910] (-1971.920) (-1986.416) (-1978.937) -- 0:02:59
      160000 -- (-1974.683) [-1973.918] (-1976.031) (-1979.345) * (-1987.546) (-1977.336) (-1986.762) [-1973.791] -- 0:02:58

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-1974.305) (-1979.117) [-1973.150] (-1977.938) * [-1985.241] (-1989.723) (-1979.521) (-1980.281) -- 0:02:57
      161000 -- [-1979.513] (-1981.417) (-1977.948) (-1979.898) * (-1983.382) (-1982.212) [-1980.575] (-1974.518) -- 0:02:57
      161500 -- [-1980.047] (-1975.792) (-1978.048) (-1980.286) * (-1981.573) (-1982.738) (-1974.379) [-1974.544] -- 0:02:56
      162000 -- (-1982.617) [-1976.467] (-1979.675) (-1977.803) * (-1977.652) (-1979.912) (-1972.869) [-1980.507] -- 0:02:55
      162500 -- (-1975.059) [-1980.531] (-1973.408) (-1975.313) * (-1977.035) (-1976.171) (-1974.118) [-1976.662] -- 0:02:55
      163000 -- (-1973.745) (-1974.664) [-1977.883] (-1973.824) * (-1974.453) (-1982.655) (-1974.837) [-1975.461] -- 0:02:54
      163500 -- (-1978.389) [-1973.460] (-1977.918) (-1977.118) * (-1979.969) (-1973.622) (-1973.349) [-1981.090] -- 0:02:53
      164000 -- [-1974.692] (-1973.986) (-1977.788) (-1978.320) * (-1976.772) (-1975.637) [-1980.844] (-1987.125) -- 0:02:58
      164500 -- (-1976.433) [-1974.095] (-1973.917) (-1982.908) * (-1982.345) (-1976.326) [-1983.082] (-1976.952) -- 0:02:57
      165000 -- [-1973.599] (-1977.485) (-1978.006) (-1975.166) * (-1971.411) (-1976.619) (-1986.300) [-1978.594] -- 0:02:57

      Average standard deviation of split frequencies: 0.000000

      165500 -- (-1977.289) [-1974.749] (-1973.351) (-1974.822) * (-1978.570) [-1978.162] (-1982.994) (-1985.377) -- 0:02:56
      166000 -- [-1975.026] (-1976.102) (-1971.647) (-1980.629) * (-1980.623) (-1978.899) (-1976.508) [-1977.677] -- 0:02:55
      166500 -- (-1981.966) [-1973.577] (-1974.236) (-1975.529) * (-1982.205) (-1985.286) [-1975.276] (-1977.200) -- 0:02:55
      167000 -- (-1976.088) [-1974.631] (-1976.477) (-1977.380) * (-1982.502) [-1974.128] (-1976.325) (-1982.143) -- 0:02:54
      167500 -- (-1972.479) (-1978.192) [-1971.911] (-1977.514) * [-1970.758] (-1974.030) (-1977.568) (-1973.925) -- 0:02:53
      168000 -- (-1973.935) [-1976.014] (-1972.593) (-1982.616) * (-1979.792) (-1973.806) [-1976.996] (-1975.056) -- 0:02:53
      168500 -- (-1980.346) (-1978.793) (-1980.356) [-1979.758] * (-1971.540) (-1976.214) (-1977.815) [-1978.695] -- 0:02:57
      169000 -- (-1970.878) (-1976.287) [-1975.728] (-1972.206) * (-1979.325) [-1978.479] (-1978.779) (-1978.892) -- 0:02:57
      169500 -- (-1974.044) (-1980.856) [-1972.474] (-1978.851) * (-1975.174) (-1981.064) [-1979.616] (-1986.978) -- 0:02:56
      170000 -- (-1975.069) [-1979.676] (-1977.321) (-1981.482) * (-1976.332) (-1982.899) (-1976.513) [-1976.152] -- 0:02:55

      Average standard deviation of split frequencies: 0.000000

      170500 -- (-1977.666) (-1982.615) (-1976.997) [-1976.970] * [-1976.849] (-1974.807) (-1977.548) (-1977.934) -- 0:02:55
      171000 -- [-1971.923] (-1985.961) (-1973.539) (-1977.865) * [-1975.374] (-1982.972) (-1980.227) (-1979.558) -- 0:02:54
      171500 -- (-1980.639) (-1984.918) (-1975.661) [-1979.933] * (-1981.340) (-1980.662) (-1978.595) [-1978.472] -- 0:02:53
      172000 -- (-1977.570) (-1980.928) [-1973.663] (-1974.787) * (-1983.462) (-1979.585) [-1972.375] (-1983.654) -- 0:02:53
      172500 -- (-1984.205) [-1976.776] (-1981.309) (-1974.600) * [-1978.171] (-1976.575) (-1975.611) (-1980.697) -- 0:02:52
      173000 -- (-1980.785) [-1972.372] (-1981.864) (-1980.793) * (-1974.757) (-1978.489) [-1976.580] (-1977.130) -- 0:02:52
      173500 -- (-1977.824) [-1975.763] (-1981.056) (-1983.039) * [-1972.823] (-1981.304) (-1974.916) (-1971.685) -- 0:02:56
      174000 -- (-1977.903) (-1973.213) [-1978.645] (-1976.467) * (-1976.341) (-1980.210) (-1976.784) [-1976.860] -- 0:02:55
      174500 -- [-1983.387] (-1977.405) (-1974.187) (-1985.486) * (-1979.054) (-1983.333) [-1976.582] (-1980.038) -- 0:02:55
      175000 -- (-1985.326) (-1984.564) [-1976.448] (-1979.585) * (-1981.090) (-1989.209) (-1984.155) [-1978.083] -- 0:02:54

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-1979.618) [-1975.402] (-1984.087) (-1975.264) * (-1978.552) [-1972.153] (-1978.718) (-1980.237) -- 0:02:53
      176000 -- (-1973.903) [-1974.376] (-1976.295) (-1983.701) * [-1979.021] (-1977.024) (-1984.006) (-1977.688) -- 0:02:53
      176500 -- (-1974.105) [-1976.884] (-1977.094) (-1983.366) * (-1976.845) (-1976.280) [-1975.302] (-1978.541) -- 0:02:52
      177000 -- (-1976.986) (-1983.054) (-1979.545) [-1980.999] * (-1988.559) [-1983.886] (-1971.823) (-1980.237) -- 0:02:52
      177500 -- [-1978.393] (-1975.565) (-1976.470) (-1979.209) * (-1975.486) [-1978.123] (-1975.035) (-1981.211) -- 0:02:51
      178000 -- (-1979.912) (-1974.414) [-1973.629] (-1984.742) * [-1976.696] (-1978.351) (-1975.056) (-1977.471) -- 0:02:55
      178500 -- (-1979.519) (-1974.026) (-1974.716) [-1986.689] * (-1979.111) [-1976.941] (-1976.886) (-1975.731) -- 0:02:54
      179000 -- (-1977.834) [-1974.969] (-1974.646) (-1977.346) * (-1972.874) [-1971.355] (-1972.548) (-1975.405) -- 0:02:54
      179500 -- (-1973.025) (-1974.900) [-1976.444] (-1979.028) * (-1977.037) (-1977.481) (-1982.749) [-1976.494] -- 0:02:53
      180000 -- (-1975.450) (-1978.422) (-1977.734) [-1972.815] * (-1978.786) (-1980.984) (-1973.680) [-1972.827] -- 0:02:53

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-1977.788) (-1984.830) [-1981.812] (-1976.765) * (-1978.006) (-1983.634) (-1972.387) [-1975.110] -- 0:02:52
      181000 -- (-1978.788) (-1977.802) [-1978.630] (-1979.479) * (-1982.036) (-1971.550) [-1974.025] (-1982.140) -- 0:02:51
      181500 -- (-1975.187) (-1985.887) (-1977.072) [-1980.076] * (-1971.995) [-1973.518] (-1971.875) (-1976.323) -- 0:02:51
      182000 -- (-1975.464) [-1986.847] (-1982.974) (-1984.402) * (-1972.851) (-1985.186) (-1976.767) [-1974.561] -- 0:02:50
      182500 -- (-1977.068) (-1976.957) (-1980.182) [-1975.627] * (-1973.549) (-1975.798) [-1976.901] (-1978.643) -- 0:02:50
      183000 -- (-1975.909) (-1977.581) [-1985.154] (-1981.697) * (-1975.512) (-1975.281) [-1974.168] (-1978.571) -- 0:02:54
      183500 -- (-1978.988) [-1984.868] (-1981.791) (-1978.875) * (-1976.717) (-1975.758) (-1975.693) [-1973.376] -- 0:02:53
      184000 -- (-1972.639) (-1978.592) (-1990.898) [-1979.574] * (-1975.184) [-1980.348] (-1979.343) (-1975.716) -- 0:02:52
      184500 -- (-1976.013) (-1983.568) [-1980.708] (-1979.122) * (-1974.593) (-1977.670) (-1979.238) [-1979.104] -- 0:02:52
      185000 -- (-1977.085) [-1979.540] (-1982.800) (-1977.444) * [-1972.083] (-1976.759) (-1976.515) (-1973.071) -- 0:02:51

      Average standard deviation of split frequencies: 0.000000

      185500 -- [-1981.506] (-1975.762) (-1976.103) (-1978.428) * (-1981.095) (-1978.753) [-1975.270] (-1981.569) -- 0:02:51
      186000 -- [-1974.358] (-1974.989) (-1976.789) (-1971.140) * [-1977.205] (-1976.359) (-1976.396) (-1972.235) -- 0:02:50
      186500 -- (-1980.565) (-1971.592) (-1975.294) [-1979.352] * [-1972.669] (-1978.144) (-1974.481) (-1976.363) -- 0:02:50
      187000 -- (-1974.134) [-1973.779] (-1980.063) (-1976.735) * (-1972.930) (-1978.685) [-1977.495] (-1979.335) -- 0:02:49
      187500 -- (-1981.410) (-1986.223) (-1980.892) [-1977.305] * [-1972.307] (-1975.327) (-1982.031) (-1971.607) -- 0:02:49
      188000 -- [-1974.455] (-1983.203) (-1979.070) (-1981.932) * (-1974.632) (-1983.517) (-1977.864) [-1971.878] -- 0:02:52
      188500 -- (-1978.682) (-1974.921) (-1976.317) [-1983.869] * [-1975.916] (-1973.433) (-1978.919) (-1978.022) -- 0:02:52
      189000 -- (-1975.528) (-1980.098) [-1973.002] (-1979.435) * (-1976.191) (-1978.829) [-1976.770] (-1979.123) -- 0:02:51
      189500 -- [-1974.969] (-1980.011) (-1971.558) (-1978.219) * (-1977.967) (-1977.612) [-1977.911] (-1976.187) -- 0:02:51
      190000 -- (-1977.512) (-1975.966) [-1973.920] (-1975.930) * (-1971.765) (-1980.382) [-1973.124] (-1978.753) -- 0:02:50

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-1986.113) (-1977.743) [-1976.167] (-1973.935) * [-1974.528] (-1984.801) (-1970.120) (-1979.143) -- 0:02:49
      191000 -- (-1977.820) [-1975.609] (-1981.539) (-1977.890) * (-1974.307) (-1975.719) [-1974.833] (-1984.626) -- 0:02:49
      191500 -- (-1980.314) (-1979.299) (-1972.742) [-1977.743] * (-1979.695) (-1978.504) [-1980.226] (-1981.976) -- 0:02:48
      192000 -- (-1979.299) (-1977.191) [-1973.116] (-1978.620) * (-1973.699) [-1978.143] (-1980.264) (-1981.822) -- 0:02:48
      192500 -- (-1982.156) (-1975.641) [-1974.628] (-1981.061) * (-1975.933) [-1975.543] (-1979.301) (-1981.576) -- 0:02:51
      193000 -- (-1975.996) (-1978.345) (-1974.690) [-1972.630] * (-1978.269) (-1972.688) [-1975.121] (-1989.531) -- 0:02:51
      193500 -- [-1974.613] (-1978.223) (-1977.929) (-1973.752) * (-1976.479) [-1975.074] (-1974.904) (-1977.357) -- 0:02:50
      194000 -- (-1981.222) (-1976.892) [-1979.718] (-1974.009) * [-1978.473] (-1979.916) (-1975.129) (-1980.298) -- 0:02:50
      194500 -- [-1980.631] (-1980.086) (-1975.803) (-1977.911) * [-1975.477] (-1978.479) (-1979.671) (-1976.959) -- 0:02:49
      195000 -- [-1978.628] (-1979.222) (-1978.671) (-1976.857) * (-1974.957) [-1971.603] (-1978.174) (-1981.062) -- 0:02:49

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-1978.516) (-1974.061) (-1985.903) [-1975.303] * [-1977.612] (-1975.667) (-1974.405) (-1980.576) -- 0:02:48
      196000 -- (-1972.758) (-1976.495) (-1978.857) [-1976.460] * (-1979.228) (-1974.539) (-1973.917) [-1976.342] -- 0:02:48
      196500 -- (-1974.885) [-1980.960] (-1980.267) (-1974.553) * (-1976.419) (-1974.080) (-1979.427) [-1975.463] -- 0:02:47
      197000 -- [-1974.436] (-1976.683) (-1978.314) (-1982.674) * (-1976.387) (-1976.144) (-1972.260) [-1978.081] -- 0:02:51
      197500 -- (-1976.578) [-1977.771] (-1980.218) (-1979.877) * [-1973.967] (-1978.116) (-1979.038) (-1974.360) -- 0:02:50
      198000 -- (-1976.817) (-1981.598) (-1974.340) [-1973.343] * (-1973.121) (-1979.229) (-1978.363) [-1975.688] -- 0:02:50
      198500 -- (-1977.088) (-1971.447) (-1974.818) [-1972.005] * (-1975.573) (-1976.939) (-1983.835) [-1981.831] -- 0:02:49
      199000 -- (-1969.968) [-1973.227] (-1979.791) (-1977.484) * [-1972.315] (-1972.026) (-1979.140) (-1975.707) -- 0:02:49
      199500 -- (-1976.444) [-1974.284] (-1977.785) (-1981.422) * (-1976.191) (-1974.016) (-1972.398) [-1976.763] -- 0:02:48
      200000 -- (-1981.826) (-1973.063) (-1983.629) [-1979.156] * [-1977.753] (-1975.686) (-1973.988) (-1976.062) -- 0:02:48

      Average standard deviation of split frequencies: 0.000000

      200500 -- (-1981.444) [-1972.566] (-1974.535) (-1980.882) * (-1979.057) [-1977.164] (-1976.096) (-1981.901) -- 0:02:47
      201000 -- (-1979.288) (-1977.740) (-1973.168) [-1971.887] * (-1977.033) (-1974.857) [-1976.548] (-1978.164) -- 0:02:46
      201500 -- (-1972.407) (-1978.021) (-1974.183) [-1977.247] * (-1975.776) (-1973.444) (-1974.505) [-1977.263] -- 0:02:50
      202000 -- [-1973.322] (-1973.764) (-1986.011) (-1981.227) * (-1971.915) (-1980.742) (-1979.495) [-1976.680] -- 0:02:49
      202500 -- (-1975.701) (-1977.497) [-1981.388] (-1976.174) * (-1977.710) (-1979.109) (-1985.709) [-1976.188] -- 0:02:49
      203000 -- (-1975.219) (-1978.926) (-1989.633) [-1975.946] * (-1978.550) [-1973.507] (-1977.954) (-1982.952) -- 0:02:48
      203500 -- (-1974.323) (-1971.295) (-1976.163) [-1979.579] * [-1974.442] (-1978.380) (-1975.422) (-1985.313) -- 0:02:48
      204000 -- (-1982.099) (-1972.811) [-1973.095] (-1975.440) * (-1972.821) [-1977.487] (-1975.563) (-1982.389) -- 0:02:47
      204500 -- (-1985.986) (-1975.593) (-1973.833) [-1979.569] * [-1976.999] (-1970.887) (-1975.914) (-1980.719) -- 0:02:47
      205000 -- (-1981.853) [-1975.620] (-1972.218) (-1980.159) * (-1977.087) (-1974.473) (-1979.445) [-1980.781] -- 0:02:46

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-1974.541) [-1977.595] (-1979.637) (-1973.756) * (-1977.373) (-1977.411) (-1980.352) [-1969.524] -- 0:02:46
      206000 -- (-1975.987) [-1974.949] (-1980.646) (-1972.426) * (-1975.750) [-1973.850] (-1979.562) (-1978.139) -- 0:02:45
      206500 -- (-1973.470) (-1977.158) [-1984.782] (-1976.153) * (-1982.445) (-1976.483) [-1970.948] (-1980.542) -- 0:02:49
      207000 -- (-1973.423) [-1973.822] (-1977.264) (-1971.273) * (-1973.796) (-1972.085) (-1980.413) [-1974.452] -- 0:02:48
      207500 -- (-1974.001) (-1976.024) (-1976.732) [-1978.169] * [-1973.922] (-1976.976) (-1978.241) (-1979.498) -- 0:02:48
      208000 -- (-1974.713) [-1974.985] (-1981.494) (-1979.793) * (-1974.991) (-1980.643) [-1975.832] (-1977.147) -- 0:02:47
      208500 -- [-1971.050] (-1973.094) (-1976.892) (-1980.214) * [-1975.798] (-1979.432) (-1979.271) (-1975.820) -- 0:02:47
      209000 -- (-1971.906) (-1975.378) (-1978.510) [-1981.911] * (-1973.121) (-1978.670) [-1978.108] (-1977.064) -- 0:02:46
      209500 -- [-1975.279] (-1983.137) (-1976.861) (-1979.453) * (-1978.091) (-1976.886) [-1975.063] (-1972.402) -- 0:02:46
      210000 -- (-1972.378) (-1977.463) (-1976.679) [-1972.184] * [-1978.788] (-1979.918) (-1984.063) (-1975.568) -- 0:02:45

      Average standard deviation of split frequencies: 0.000000

      210500 -- (-1977.527) [-1972.867] (-1972.769) (-1971.837) * (-1970.557) [-1979.298] (-1978.239) (-1974.711) -- 0:02:45
      211000 -- (-1985.584) (-1972.658) [-1971.163] (-1975.626) * (-1981.410) (-1978.424) (-1980.242) [-1978.013] -- 0:02:44
      211500 -- (-1983.765) (-1978.282) [-1976.002] (-1976.139) * [-1977.158] (-1977.305) (-1979.584) (-1982.882) -- 0:02:47
      212000 -- (-1974.533) [-1977.014] (-1980.144) (-1981.471) * [-1976.381] (-1982.188) (-1980.285) (-1981.478) -- 0:02:47
      212500 -- (-1976.314) [-1979.733] (-1987.198) (-1973.290) * [-1977.621] (-1973.629) (-1974.147) (-1978.008) -- 0:02:46
      213000 -- (-1976.257) (-1978.439) [-1973.208] (-1980.250) * (-1978.361) (-1973.946) [-1972.516] (-1975.227) -- 0:02:46
      213500 -- (-1972.362) (-1975.410) (-1978.279) [-1976.541] * (-1978.223) (-1975.240) [-1980.040] (-1985.000) -- 0:02:45
      214000 -- (-1979.489) (-1971.179) [-1979.189] (-1977.494) * (-1974.472) [-1973.586] (-1979.542) (-1977.185) -- 0:02:45
      214500 -- (-1972.501) (-1977.636) [-1972.380] (-1974.563) * [-1976.534] (-1971.779) (-1977.801) (-1979.578) -- 0:02:44
      215000 -- (-1974.126) [-1976.895] (-1972.471) (-1972.204) * (-1974.634) [-1979.808] (-1972.326) (-1974.753) -- 0:02:44

      Average standard deviation of split frequencies: 0.000000

      215500 -- [-1979.186] (-1969.528) (-1974.570) (-1976.412) * (-1979.092) (-1977.014) [-1971.227] (-1979.077) -- 0:02:43
      216000 -- (-1973.343) (-1977.209) [-1974.624] (-1971.500) * [-1977.056] (-1978.692) (-1976.853) (-1977.870) -- 0:02:46
      216500 -- (-1975.111) (-1970.425) (-1975.757) [-1972.642] * (-1981.407) (-1983.090) [-1975.845] (-1981.311) -- 0:02:46
      217000 -- [-1976.975] (-1974.084) (-1978.921) (-1974.318) * (-1974.844) (-1980.437) [-1976.358] (-1978.131) -- 0:02:45
      217500 -- [-1972.139] (-1982.733) (-1979.602) (-1973.357) * (-1971.858) (-1981.344) (-1975.769) [-1981.505] -- 0:02:45
      218000 -- [-1978.499] (-1973.982) (-1978.189) (-1973.501) * (-1983.799) (-1983.222) [-1972.244] (-1985.912) -- 0:02:45
      218500 -- (-1977.018) [-1974.448] (-1980.512) (-1984.231) * (-1982.479) (-1982.720) [-1977.473] (-1984.285) -- 0:02:44
      219000 -- (-1971.582) (-1976.018) (-1977.152) [-1977.653] * [-1981.001] (-1982.400) (-1975.753) (-1980.269) -- 0:02:44
      219500 -- (-1979.185) [-1972.076] (-1983.146) (-1975.663) * (-1980.693) (-1975.751) (-1975.799) [-1974.442] -- 0:02:43
      220000 -- (-1983.209) [-1973.546] (-1980.790) (-1980.459) * (-1977.990) (-1976.234) [-1976.001] (-1978.376) -- 0:02:43

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-1976.249) (-1976.070) [-1975.969] (-1985.698) * (-1973.810) [-1980.802] (-1973.773) (-1976.994) -- 0:02:42
      221000 -- (-1982.942) (-1983.824) (-1976.028) [-1973.408] * (-1981.222) [-1980.902] (-1979.844) (-1977.503) -- 0:02:45
      221500 -- (-1986.163) [-1977.884] (-1981.048) (-1973.564) * (-1975.332) [-1974.252] (-1975.201) (-1980.080) -- 0:02:45
      222000 -- (-1974.048) (-1976.600) [-1971.088] (-1976.694) * [-1974.896] (-1976.151) (-1973.328) (-1973.324) -- 0:02:44
      222500 -- [-1973.631] (-1972.891) (-1976.638) (-1977.660) * (-1973.388) (-1973.172) [-1981.546] (-1977.474) -- 0:02:44
      223000 -- [-1974.335] (-1978.298) (-1986.492) (-1980.319) * (-1974.658) (-1978.731) [-1975.984] (-1982.468) -- 0:02:43
      223500 -- [-1973.197] (-1974.339) (-1978.829) (-1975.644) * (-1975.259) (-1979.830) [-1976.691] (-1978.237) -- 0:02:43
      224000 -- [-1971.912] (-1976.950) (-1973.256) (-1982.704) * (-1977.602) (-1975.187) [-1977.265] (-1982.808) -- 0:02:42
      224500 -- [-1974.199] (-1979.405) (-1977.765) (-1977.298) * (-1974.949) [-1974.498] (-1972.595) (-1977.386) -- 0:02:42
      225000 -- (-1979.004) (-1981.257) [-1976.405] (-1979.437) * (-1977.321) (-1981.522) (-1974.966) [-1986.344] -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-1974.281) [-1978.501] (-1980.163) (-1977.648) * [-1978.983] (-1975.477) (-1977.878) (-1970.828) -- 0:02:41
      226000 -- (-1971.249) (-1978.153) (-1976.758) [-1973.942] * [-1973.226] (-1973.991) (-1971.144) (-1976.064) -- 0:02:44
      226500 -- (-1979.581) (-1974.036) [-1975.786] (-1985.773) * [-1973.285] (-1977.218) (-1976.421) (-1976.785) -- 0:02:43
      227000 -- (-1979.868) [-1973.131] (-1976.666) (-1978.679) * (-1972.156) (-1978.300) (-1975.292) [-1973.651] -- 0:02:43
      227500 -- [-1975.521] (-1975.172) (-1971.525) (-1984.784) * (-1973.178) (-1984.837) (-1982.366) [-1978.696] -- 0:02:42
      228000 -- [-1973.003] (-1975.983) (-1974.580) (-1980.771) * (-1975.160) [-1982.153] (-1978.050) (-1988.428) -- 0:02:42
      228500 -- (-1977.089) (-1979.681) [-1976.486] (-1984.117) * (-1978.179) [-1981.396] (-1977.419) (-1980.668) -- 0:02:42
      229000 -- [-1976.237] (-1981.940) (-1981.279) (-1977.711) * (-1979.834) [-1975.860] (-1984.164) (-1975.023) -- 0:02:41
      229500 -- (-1975.860) (-1978.831) [-1979.896] (-1982.180) * [-1971.625] (-1979.894) (-1975.597) (-1978.124) -- 0:02:41
      230000 -- [-1975.087] (-1978.227) (-1975.990) (-1975.744) * (-1976.133) (-1979.793) (-1979.135) [-1976.217] -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-1981.545) (-1974.227) [-1972.918] (-1979.504) * (-1978.886) (-1969.897) [-1972.621] (-1980.789) -- 0:02:43
      231000 -- (-1979.066) (-1973.252) [-1972.199] (-1975.382) * (-1976.120) (-1971.540) [-1973.778] (-1970.101) -- 0:02:43
      231500 -- [-1975.642] (-1979.876) (-1973.109) (-1979.197) * (-1984.046) (-1979.650) [-1974.936] (-1972.821) -- 0:02:42
      232000 -- (-1978.429) [-1972.032] (-1982.791) (-1979.677) * (-1980.604) (-1978.533) [-1970.365] (-1983.190) -- 0:02:42
      232500 -- (-1980.715) (-1977.953) [-1975.931] (-1977.755) * (-1977.125) (-1977.281) [-1973.361] (-1981.815) -- 0:02:41
      233000 -- [-1983.086] (-1984.178) (-1974.733) (-1977.419) * (-1979.192) [-1976.045] (-1973.366) (-1976.275) -- 0:02:41
      233500 -- (-1985.222) (-1975.382) (-1975.928) [-1970.659] * (-1978.876) [-1973.979] (-1979.557) (-1973.238) -- 0:02:40
      234000 -- (-1977.373) [-1978.647] (-1977.671) (-1972.395) * (-1974.667) (-1973.124) [-1972.678] (-1981.282) -- 0:02:40
      234500 -- (-1979.292) (-1977.940) (-1978.354) [-1981.028] * (-1978.010) [-1974.413] (-1979.064) (-1977.496) -- 0:02:39
      235000 -- [-1975.442] (-1974.830) (-1976.678) (-1976.222) * (-1982.181) (-1976.895) (-1986.339) [-1978.436] -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      235500 -- [-1975.710] (-1977.360) (-1971.122) (-1979.797) * [-1975.254] (-1981.110) (-1979.865) (-1973.904) -- 0:02:42
      236000 -- (-1975.471) (-1981.124) [-1976.344] (-1981.470) * [-1977.184] (-1977.391) (-1982.329) (-1983.025) -- 0:02:41
      236500 -- [-1974.271] (-1972.833) (-1981.691) (-1974.912) * (-1976.448) (-1972.818) (-1983.182) [-1979.604] -- 0:02:41
      237000 -- (-1981.686) (-1973.429) [-1976.082] (-1977.825) * (-1977.007) [-1975.221] (-1976.229) (-1978.663) -- 0:02:40
      237500 -- (-1972.362) (-1973.593) [-1973.589] (-1975.202) * (-1980.744) (-1974.706) [-1973.033] (-1979.644) -- 0:02:40
      238000 -- (-1977.944) (-1979.192) [-1981.988] (-1976.081) * [-1976.381] (-1970.663) (-1975.555) (-1976.731) -- 0:02:40
      238500 -- (-1974.533) (-1976.678) [-1977.130] (-1975.394) * [-1974.167] (-1972.752) (-1979.972) (-1979.210) -- 0:02:39
      239000 -- [-1973.988] (-1977.284) (-1976.989) (-1978.060) * (-1974.544) (-1975.731) (-1974.923) [-1974.889] -- 0:02:39
      239500 -- (-1973.188) (-1980.877) (-1973.337) [-1974.476] * (-1975.537) (-1976.744) (-1975.599) [-1978.991] -- 0:02:38
      240000 -- [-1971.975] (-1976.187) (-1977.251) (-1975.699) * (-1973.252) (-1981.954) [-1974.335] (-1978.305) -- 0:02:41

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-1976.305) (-1982.060) [-1980.396] (-1977.748) * (-1980.029) (-1976.170) (-1982.714) [-1977.129] -- 0:02:41
      241000 -- (-1977.701) [-1974.544] (-1976.094) (-1985.183) * (-1981.354) [-1973.209] (-1972.738) (-1976.047) -- 0:02:40
      241500 -- (-1978.606) [-1971.016] (-1975.279) (-1978.630) * (-1979.305) [-1973.370] (-1973.032) (-1974.256) -- 0:02:40
      242000 -- (-1981.345) [-1980.264] (-1979.560) (-1980.836) * (-1971.015) (-1974.790) [-1973.583] (-1976.800) -- 0:02:39
      242500 -- (-1980.012) [-1975.690] (-1982.360) (-1982.857) * (-1977.267) (-1976.695) [-1973.832] (-1979.054) -- 0:02:39
      243000 -- [-1976.608] (-1977.263) (-1976.352) (-1989.302) * (-1980.267) [-1972.601] (-1970.873) (-1973.912) -- 0:02:38
      243500 -- [-1982.357] (-1975.396) (-1979.368) (-1979.894) * [-1978.285] (-1973.143) (-1972.115) (-1978.140) -- 0:02:38
      244000 -- (-1972.163) (-1978.820) (-1977.432) [-1975.305] * [-1976.121] (-1975.174) (-1982.914) (-1972.062) -- 0:02:38
      244500 -- [-1971.445] (-1982.473) (-1981.948) (-1982.890) * (-1979.220) (-1975.099) [-1972.965] (-1978.073) -- 0:02:37
      245000 -- (-1978.298) (-1974.574) (-1974.488) [-1975.526] * (-1981.437) [-1975.398] (-1979.636) (-1975.579) -- 0:02:40

      Average standard deviation of split frequencies: 0.000000

      245500 -- [-1975.715] (-1978.208) (-1977.835) (-1970.825) * (-1972.040) [-1972.466] (-1976.584) (-1983.112) -- 0:02:39
      246000 -- (-1977.817) [-1984.645] (-1977.717) (-1987.657) * (-1976.077) (-1974.113) [-1974.235] (-1976.891) -- 0:02:39
      246500 -- (-1978.706) (-1979.967) [-1978.047] (-1971.750) * (-1977.489) (-1975.547) [-1975.300] (-1980.375) -- 0:02:38
      247000 -- (-1975.880) (-1978.174) [-1976.277] (-1973.485) * (-1971.981) (-1979.445) (-1972.881) [-1984.757] -- 0:02:38
      247500 -- (-1975.900) (-1976.283) [-1973.369] (-1973.006) * (-1972.345) (-1981.093) (-1976.578) [-1978.410] -- 0:02:38
      248000 -- (-1975.582) (-1976.861) (-1972.427) [-1973.699] * (-1973.345) (-1978.711) [-1975.780] (-1978.243) -- 0:02:37
      248500 -- [-1971.081] (-1973.305) (-1974.874) (-1977.543) * [-1977.111] (-1978.156) (-1985.517) (-1981.672) -- 0:02:37
      249000 -- [-1972.677] (-1970.887) (-1972.576) (-1975.691) * [-1972.043] (-1976.024) (-1976.362) (-1973.302) -- 0:02:36
      249500 -- (-1975.731) (-1973.204) [-1973.286] (-1975.554) * (-1981.766) (-1976.993) [-1974.379] (-1975.345) -- 0:02:36
      250000 -- (-1978.724) (-1979.115) [-1985.467] (-1978.720) * (-1977.419) [-1975.751] (-1977.214) (-1983.921) -- 0:02:39

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-1976.151) [-1975.677] (-1978.158) (-1970.990) * (-1974.437) (-1974.985) (-1974.203) [-1978.174] -- 0:02:38
      251000 -- (-1973.869) (-1977.972) (-1977.790) [-1973.401] * (-1971.647) [-1977.987] (-1976.725) (-1977.194) -- 0:02:38
      251500 -- (-1978.720) (-1975.163) [-1977.065] (-1979.909) * [-1978.460] (-1976.996) (-1975.228) (-1975.397) -- 0:02:37
      252000 -- (-1973.802) [-1973.688] (-1973.098) (-1975.501) * (-1973.769) (-1975.422) [-1974.877] (-1974.862) -- 0:02:37
      252500 -- (-1974.483) (-1971.010) [-1973.181] (-1976.610) * [-1980.030] (-1977.252) (-1971.764) (-1979.356) -- 0:02:36
      253000 -- [-1975.459] (-1977.327) (-1972.828) (-1975.985) * (-1979.313) [-1981.420] (-1973.645) (-1982.846) -- 0:02:36
      253500 -- (-1973.662) (-1973.565) [-1973.419] (-1972.232) * (-1983.511) [-1981.486] (-1975.234) (-1972.125) -- 0:02:36
      254000 -- (-1975.294) (-1979.585) [-1973.084] (-1976.818) * [-1974.465] (-1978.673) (-1980.091) (-1974.699) -- 0:02:35
      254500 -- [-1978.204] (-1977.011) (-1977.694) (-1976.763) * (-1974.676) [-1975.632] (-1975.300) (-1975.934) -- 0:02:35
      255000 -- (-1975.887) (-1980.713) (-1975.746) [-1975.219] * (-1975.615) (-1970.797) (-1977.431) [-1973.452] -- 0:02:37

      Average standard deviation of split frequencies: 0.000000

      255500 -- [-1973.716] (-1973.706) (-1985.604) (-1972.569) * [-1978.028] (-1981.957) (-1979.398) (-1978.480) -- 0:02:37
      256000 -- (-1972.849) [-1971.015] (-1976.563) (-1980.701) * (-1973.572) (-1979.781) (-1980.847) [-1976.730] -- 0:02:36
      256500 -- [-1973.503] (-1979.399) (-1973.283) (-1978.031) * [-1973.187] (-1973.381) (-1983.504) (-1975.319) -- 0:02:36
      257000 -- [-1972.179] (-1978.918) (-1978.525) (-1976.655) * (-1975.407) (-1974.066) (-1979.245) [-1976.300] -- 0:02:36
      257500 -- [-1977.101] (-1976.488) (-1976.943) (-1978.264) * (-1980.363) [-1982.585] (-1981.316) (-1973.914) -- 0:02:35
      258000 -- (-1979.279) [-1976.522] (-1976.696) (-1975.494) * (-1980.571) [-1974.706] (-1976.474) (-1980.511) -- 0:02:35
      258500 -- [-1979.604] (-1985.667) (-1973.879) (-1974.083) * (-1975.126) [-1977.506] (-1977.167) (-1984.680) -- 0:02:34
      259000 -- (-1978.576) (-1978.613) [-1970.808] (-1982.483) * [-1979.257] (-1981.508) (-1987.951) (-1982.153) -- 0:02:34
      259500 -- [-1977.680] (-1977.969) (-1972.765) (-1979.127) * [-1978.642] (-1978.610) (-1982.445) (-1975.382) -- 0:02:36
      260000 -- [-1975.109] (-1978.079) (-1975.235) (-1980.454) * (-1977.078) (-1975.296) (-1982.629) [-1974.659] -- 0:02:36

      Average standard deviation of split frequencies: 0.000000

      260500 -- (-1981.741) [-1978.427] (-1983.611) (-1980.946) * (-1975.092) [-1971.936] (-1975.879) (-1975.556) -- 0:02:36
      261000 -- (-1975.408) (-1979.016) [-1975.924] (-1981.908) * (-1979.091) [-1972.966] (-1983.680) (-1978.218) -- 0:02:35
      261500 -- (-1980.180) [-1978.471] (-1975.866) (-1975.891) * (-1975.300) (-1980.542) (-1975.351) [-1980.518] -- 0:02:35
      262000 -- (-1983.624) (-1974.121) [-1980.053] (-1973.244) * (-1983.086) (-1974.777) [-1976.532] (-1978.492) -- 0:02:34
      262500 -- (-1990.086) [-1973.782] (-1980.876) (-1979.400) * (-1977.899) (-1975.806) (-1971.740) [-1980.371] -- 0:02:34
      263000 -- [-1984.076] (-1980.343) (-1974.600) (-1980.316) * [-1972.392] (-1975.708) (-1983.869) (-1974.371) -- 0:02:34
      263500 -- (-1982.230) [-1977.465] (-1973.434) (-1982.009) * [-1979.010] (-1975.759) (-1986.918) (-1978.894) -- 0:02:33
      264000 -- (-1977.011) (-1977.715) [-1970.920] (-1979.575) * (-1977.210) [-1978.781] (-1975.872) (-1980.098) -- 0:02:33
      264500 -- (-1981.767) [-1981.861] (-1973.857) (-1976.239) * [-1978.015] (-1980.636) (-1974.910) (-1974.259) -- 0:02:35
      265000 -- (-1975.708) (-1978.564) (-1977.215) [-1976.931] * (-1989.041) (-1978.990) [-1975.915] (-1976.524) -- 0:02:35

      Average standard deviation of split frequencies: 0.000000

      265500 -- [-1974.257] (-1976.909) (-1982.216) (-1977.291) * (-1980.289) (-1980.759) (-1970.605) [-1981.430] -- 0:02:34
      266000 -- (-1978.253) (-1976.334) [-1976.281] (-1987.856) * (-1983.185) (-1980.201) [-1974.463] (-1983.934) -- 0:02:34
      266500 -- (-1972.913) (-1979.392) [-1972.808] (-1979.676) * (-1980.484) [-1976.164] (-1975.564) (-1979.984) -- 0:02:34
      267000 -- (-1977.114) (-1979.296) [-1975.135] (-1977.513) * (-1981.829) (-1982.511) [-1975.250] (-1981.502) -- 0:02:33
      267500 -- [-1970.960] (-1971.821) (-1982.781) (-1976.409) * (-1977.493) (-1979.612) [-1976.905] (-1983.390) -- 0:02:33
      268000 -- (-1971.427) (-1975.326) (-1973.660) [-1972.472] * (-1975.300) [-1976.460] (-1983.236) (-1975.350) -- 0:02:32
      268500 -- (-1980.895) (-1978.595) [-1974.442] (-1972.940) * (-1980.068) (-1978.821) (-1973.491) [-1976.149] -- 0:02:32
      269000 -- (-1973.260) (-1984.334) (-1976.647) [-1975.208] * [-1987.385] (-1979.928) (-1969.901) (-1971.666) -- 0:02:34
      269500 -- (-1976.646) (-1973.525) [-1978.551] (-1984.714) * (-1974.279) (-1979.736) [-1970.433] (-1982.995) -- 0:02:34
      270000 -- (-1985.282) [-1977.488] (-1973.880) (-1978.581) * (-1975.100) [-1979.269] (-1975.929) (-1983.820) -- 0:02:34

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-1985.407) (-1979.534) (-1978.514) [-1973.797] * [-1976.125] (-1974.447) (-1981.449) (-1974.159) -- 0:02:33
      271000 -- (-1984.979) (-1979.853) (-1975.667) [-1978.297] * (-1981.252) (-1978.333) (-1975.794) [-1973.064] -- 0:02:33
      271500 -- (-1971.851) (-1976.372) (-1980.225) [-1979.783] * (-1983.098) (-1980.062) [-1972.693] (-1973.270) -- 0:02:32
      272000 -- (-1972.721) [-1975.625] (-1974.079) (-1976.005) * (-1982.073) (-1971.165) (-1971.121) [-1980.265] -- 0:02:32
      272500 -- [-1977.906] (-1974.971) (-1979.197) (-1976.526) * (-1979.511) (-1977.615) [-1975.950] (-1977.373) -- 0:02:32
      273000 -- (-1979.249) (-1975.118) (-1975.783) [-1978.166] * [-1972.092] (-1980.023) (-1978.076) (-1976.735) -- 0:02:31
      273500 -- (-1979.394) (-1977.011) (-1983.141) [-1981.076] * (-1975.323) [-1973.068] (-1976.645) (-1976.907) -- 0:02:31
      274000 -- (-1972.865) [-1977.255] (-1983.211) (-1973.373) * [-1976.813] (-1971.670) (-1980.419) (-1982.502) -- 0:02:33
      274500 -- (-1975.717) [-1983.640] (-1986.275) (-1975.035) * (-1976.207) (-1975.821) [-1974.863] (-1986.135) -- 0:02:33
      275000 -- (-1979.893) (-1972.719) [-1978.752] (-1977.226) * (-1974.648) (-1979.027) (-1975.749) [-1977.720] -- 0:02:32

      Average standard deviation of split frequencies: 0.000000

      275500 -- [-1972.984] (-1981.539) (-1978.122) (-1974.954) * (-1971.581) [-1975.367] (-1976.016) (-1979.037) -- 0:02:32
      276000 -- (-1979.476) (-1983.958) (-1971.853) [-1978.617] * [-1973.303] (-1978.303) (-1977.753) (-1975.593) -- 0:02:32
      276500 -- (-1984.391) (-1981.337) [-1972.990] (-1975.198) * (-1981.769) (-1979.145) [-1974.095] (-1975.127) -- 0:02:31
      277000 -- (-1974.083) [-1978.825] (-1975.860) (-1972.447) * (-1978.611) (-1982.721) (-1977.340) [-1979.045] -- 0:02:31
      277500 -- (-1976.902) (-1973.314) (-1985.682) [-1977.844] * (-1974.836) (-1978.758) [-1974.506] (-1985.500) -- 0:02:31
      278000 -- (-1972.828) (-1976.118) [-1979.477] (-1976.496) * (-1978.719) [-1980.698] (-1976.979) (-1981.631) -- 0:02:30
      278500 -- (-1977.257) [-1977.838] (-1975.056) (-1975.926) * (-1976.812) [-1971.371] (-1972.516) (-1978.643) -- 0:02:32
      279000 -- (-1977.209) (-1977.252) (-1973.823) [-1975.585] * (-1979.359) (-1972.767) (-1976.642) [-1975.338] -- 0:02:32
      279500 -- (-1977.414) (-1974.957) (-1972.191) [-1973.858] * (-1976.273) (-1975.006) [-1973.805] (-1978.265) -- 0:02:32
      280000 -- (-1979.080) (-1975.807) [-1972.088] (-1977.445) * (-1976.498) (-1972.895) (-1977.627) [-1973.105] -- 0:02:31

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-1983.300) (-1976.788) (-1976.684) [-1971.459] * (-1981.515) (-1972.363) [-1973.726] (-1976.263) -- 0:02:31
      281000 -- (-1983.935) (-1974.872) (-1974.161) [-1973.529] * (-1979.080) (-1975.098) (-1983.041) [-1973.885] -- 0:02:30
      281500 -- (-1980.043) (-1978.172) (-1972.879) [-1978.570] * (-1973.733) (-1972.258) (-1982.170) [-1974.607] -- 0:02:30
      282000 -- (-1980.021) (-1978.012) [-1975.907] (-1979.507) * (-1983.436) (-1972.213) (-1983.266) [-1983.813] -- 0:02:30
      282500 -- (-1987.671) [-1974.243] (-1976.950) (-1975.122) * (-1978.219) [-1977.740] (-1981.457) (-1987.227) -- 0:02:29
      283000 -- (-1976.792) [-1975.177] (-1977.304) (-1976.392) * [-1971.789] (-1978.299) (-1974.536) (-1980.409) -- 0:02:29
      283500 -- [-1972.970] (-1975.252) (-1984.486) (-1979.238) * (-1979.797) (-1980.615) (-1976.102) [-1979.759] -- 0:02:31
      284000 -- (-1980.069) [-1974.309] (-1974.774) (-1971.797) * [-1974.710] (-1976.995) (-1971.640) (-1980.720) -- 0:02:31
      284500 -- (-1969.480) [-1975.680] (-1984.276) (-1975.921) * [-1978.004] (-1978.641) (-1972.857) (-1988.120) -- 0:02:30
      285000 -- (-1974.654) (-1975.264) (-1980.242) [-1974.851] * (-1970.302) (-1974.348) [-1975.504] (-1982.062) -- 0:02:30

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-1976.158) [-1977.999] (-1982.465) (-1982.783) * [-1974.605] (-1978.146) (-1979.649) (-1977.294) -- 0:02:30
      286000 -- (-1980.196) (-1975.069) (-1983.637) [-1971.840] * (-1975.558) (-1980.540) (-1978.707) [-1977.371] -- 0:02:29
      286500 -- [-1976.542] (-1977.269) (-1990.182) (-1980.094) * (-1977.144) (-1976.513) [-1974.825] (-1975.434) -- 0:02:29
      287000 -- (-1974.831) (-1976.189) (-1981.976) [-1976.811] * [-1970.334] (-1973.615) (-1978.197) (-1972.345) -- 0:02:29
      287500 -- (-1976.687) [-1974.822] (-1981.830) (-1979.566) * (-1977.206) (-1985.424) [-1976.172] (-1975.471) -- 0:02:28
      288000 -- [-1977.232] (-1978.721) (-1981.318) (-1979.152) * [-1972.682] (-1978.872) (-1974.808) (-1974.250) -- 0:02:28
      288500 -- (-1976.476) [-1977.849] (-1979.639) (-1975.685) * (-1974.467) [-1972.761] (-1978.132) (-1976.877) -- 0:02:30
      289000 -- [-1978.074] (-1977.007) (-1980.106) (-1977.767) * [-1977.986] (-1976.364) (-1975.117) (-1981.479) -- 0:02:30
      289500 -- (-1984.675) (-1981.678) (-1977.433) [-1975.104] * [-1979.293] (-1973.353) (-1971.641) (-1974.064) -- 0:02:29
      290000 -- (-1982.031) (-1977.965) [-1977.916] (-1981.738) * (-1983.860) [-1972.604] (-1976.877) (-1974.114) -- 0:02:29

      Average standard deviation of split frequencies: 0.000000

      290500 -- [-1981.758] (-1984.124) (-1977.302) (-1978.821) * (-1978.666) [-1973.683] (-1991.339) (-1980.219) -- 0:02:28
      291000 -- (-1982.571) (-1975.583) (-1974.841) [-1975.692] * (-1978.003) (-1984.330) [-1981.410] (-1978.929) -- 0:02:28
      291500 -- [-1979.203] (-1975.147) (-1973.444) (-1979.980) * (-1976.396) (-1977.947) (-1981.246) [-1981.896] -- 0:02:28
      292000 -- (-1980.537) (-1980.007) (-1977.715) [-1979.115] * (-1979.060) (-1973.076) (-1977.205) [-1973.837] -- 0:02:27
      292500 -- (-1973.807) (-1983.175) [-1983.935] (-1977.371) * (-1972.734) (-1979.803) (-1975.581) [-1975.233] -- 0:02:27
      293000 -- (-1983.008) (-1977.370) (-1980.173) [-1976.764] * (-1980.199) (-1983.082) [-1979.236] (-1974.013) -- 0:02:29
      293500 -- [-1976.090] (-1982.353) (-1985.696) (-1980.022) * (-1982.201) (-1975.716) (-1975.911) [-1975.027] -- 0:02:29
      294000 -- [-1979.654] (-1979.455) (-1980.170) (-1978.738) * (-1976.990) (-1974.801) (-1979.333) [-1973.854] -- 0:02:28
      294500 -- (-1983.152) (-1983.653) [-1975.004] (-1984.148) * (-1985.363) (-1975.555) (-1973.057) [-1973.449] -- 0:02:28
      295000 -- (-1979.543) (-1975.380) (-1977.311) [-1974.714] * (-1976.547) (-1976.034) [-1976.679] (-1974.327) -- 0:02:28

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-1971.214) (-1978.365) [-1974.762] (-1979.808) * (-1976.637) (-1979.754) (-1982.748) [-1975.962] -- 0:02:27
      296000 -- (-1977.787) [-1975.325] (-1978.097) (-1985.078) * [-1974.191] (-1986.818) (-1974.940) (-1974.966) -- 0:02:27
      296500 -- (-1977.022) (-1971.176) [-1979.099] (-1985.911) * [-1973.077] (-1980.323) (-1974.760) (-1976.592) -- 0:02:27
      297000 -- [-1976.904] (-1975.163) (-1981.604) (-1978.095) * (-1977.199) (-1979.100) [-1979.817] (-1976.080) -- 0:02:26
      297500 -- (-1980.098) (-1976.123) [-1975.647] (-1972.168) * (-1981.129) (-1974.255) (-1980.387) [-1976.648] -- 0:02:26
      298000 -- (-1975.702) (-1981.875) (-1976.113) [-1983.597] * (-1976.424) (-1973.804) [-1974.226] (-1974.449) -- 0:02:28
      298500 -- (-1974.906) (-1975.350) [-1979.960] (-1977.293) * (-1979.907) (-1977.707) [-1977.953] (-1975.392) -- 0:02:28
      299000 -- [-1974.884] (-1981.084) (-1976.544) (-1974.816) * (-1975.185) [-1978.585] (-1976.939) (-1975.404) -- 0:02:27
      299500 -- (-1976.628) (-1985.191) [-1974.724] (-1979.877) * (-1976.272) [-1981.705] (-1975.340) (-1985.417) -- 0:02:27
      300000 -- (-1977.844) (-1980.878) [-1982.966] (-1970.264) * (-1972.510) (-1974.140) [-1977.118] (-1988.238) -- 0:02:27

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-1977.322) (-1979.738) (-1978.168) [-1974.432] * (-1980.764) (-1976.148) [-1974.365] (-1985.067) -- 0:02:26
      301000 -- [-1973.952] (-1982.311) (-1974.326) (-1975.583) * (-1978.168) (-1978.225) [-1974.730] (-1990.116) -- 0:02:26
      301500 -- (-1984.906) [-1976.687] (-1973.351) (-1982.244) * (-1980.145) [-1975.986] (-1981.048) (-1984.690) -- 0:02:25
      302000 -- (-1977.778) (-1977.612) [-1971.448] (-1977.002) * (-1978.486) (-1974.425) [-1978.704] (-1981.187) -- 0:02:25
      302500 -- [-1974.759] (-1982.490) (-1975.080) (-1977.812) * (-1974.131) (-1983.349) (-1977.953) [-1973.796] -- 0:02:27
      303000 -- (-1981.163) (-1978.875) (-1981.003) [-1982.151] * (-1987.105) (-1974.581) [-1973.770] (-1973.501) -- 0:02:27
      303500 -- (-1979.334) [-1976.679] (-1974.208) (-1979.525) * (-1976.513) (-1976.790) [-1972.167] (-1980.009) -- 0:02:26
      304000 -- (-1982.004) (-1977.574) [-1974.624] (-1974.802) * (-1975.670) (-1988.984) [-1974.277] (-1983.599) -- 0:02:26
      304500 -- (-1972.824) [-1975.588] (-1975.540) (-1973.538) * [-1973.503] (-1979.455) (-1973.279) (-1976.603) -- 0:02:26
      305000 -- (-1976.698) (-1979.993) [-1973.113] (-1981.987) * (-1980.853) (-1976.019) [-1976.052] (-1977.431) -- 0:02:25

      Average standard deviation of split frequencies: 0.000000

      305500 -- [-1977.719] (-1978.047) (-1975.504) (-1974.196) * [-1973.157] (-1980.111) (-1976.914) (-1978.122) -- 0:02:25
      306000 -- (-1977.786) (-1978.988) (-1980.329) [-1974.057] * (-1971.940) (-1977.007) [-1971.564] (-1978.445) -- 0:02:25
      306500 -- [-1984.206] (-1984.138) (-1979.908) (-1980.323) * (-1979.639) (-1977.838) (-1976.402) [-1977.310] -- 0:02:24
      307000 -- [-1982.115] (-1976.613) (-1980.167) (-1978.022) * (-1975.412) (-1979.271) (-1978.286) [-1974.604] -- 0:02:24
      307500 -- [-1975.985] (-1973.143) (-1982.914) (-1975.812) * [-1974.422] (-1976.487) (-1971.739) (-1977.303) -- 0:02:26
      308000 -- [-1971.722] (-1973.518) (-1986.909) (-1977.289) * (-1976.851) (-1973.550) (-1976.680) [-1971.634] -- 0:02:26
      308500 -- (-1976.064) (-1977.300) (-1984.682) [-1978.663] * (-1975.686) [-1977.883] (-1975.287) (-1978.830) -- 0:02:25
      309000 -- (-1972.839) [-1981.418] (-1982.498) (-1978.173) * (-1974.447) (-1973.815) (-1971.839) [-1973.815] -- 0:02:25
      309500 -- (-1975.779) [-1974.437] (-1985.104) (-1980.496) * (-1973.329) [-1975.944] (-1973.198) (-1976.277) -- 0:02:25
      310000 -- (-1979.120) [-1973.659] (-1983.447) (-1977.131) * [-1973.519] (-1975.696) (-1974.248) (-1975.799) -- 0:02:24

      Average standard deviation of split frequencies: 0.000000

      310500 -- [-1977.646] (-1973.783) (-1983.580) (-1981.502) * (-1982.788) (-1975.346) (-1973.853) [-1973.394] -- 0:02:24
      311000 -- (-1975.929) (-1976.901) (-1978.490) [-1982.098] * (-1985.368) (-1980.785) [-1971.868] (-1974.908) -- 0:02:24
      311500 -- (-1989.100) [-1975.645] (-1982.929) (-1982.519) * (-1981.716) [-1983.028] (-1974.660) (-1980.812) -- 0:02:23
      312000 -- (-1978.971) [-1973.036] (-1974.554) (-1980.844) * [-1978.978] (-1977.744) (-1974.741) (-1977.398) -- 0:02:25
      312500 -- (-1980.323) (-1982.462) (-1975.542) [-1982.279] * (-1982.140) [-1976.647] (-1975.087) (-1975.923) -- 0:02:25
      313000 -- (-1980.694) [-1974.884] (-1977.154) (-1984.632) * (-1982.164) [-1977.626] (-1980.679) (-1973.810) -- 0:02:24
      313500 -- (-1977.439) [-1973.542] (-1973.842) (-1979.036) * (-1978.579) [-1980.002] (-1982.612) (-1979.181) -- 0:02:24
      314000 -- (-1984.506) (-1973.176) (-1976.307) [-1978.871] * (-1970.144) (-1981.093) (-1978.116) [-1971.388] -- 0:02:24
      314500 -- (-1986.823) (-1978.542) (-1980.102) [-1975.305] * (-1972.105) (-1980.026) (-1971.823) [-1976.353] -- 0:02:23
      315000 -- (-1984.598) (-1977.719) (-1980.522) [-1974.817] * [-1973.498] (-1980.239) (-1972.684) (-1974.382) -- 0:02:23

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-1978.932) (-1979.584) [-1978.264] (-1975.340) * [-1975.314] (-1974.155) (-1979.979) (-1971.328) -- 0:02:23
      316000 -- (-1971.628) [-1973.916] (-1979.917) (-1977.738) * (-1974.031) (-1976.174) (-1977.879) [-1970.756] -- 0:02:22
      316500 -- [-1975.854] (-1973.811) (-1978.563) (-1980.768) * [-1975.116] (-1971.760) (-1976.024) (-1971.967) -- 0:02:22
      317000 -- (-1983.794) [-1974.049] (-1976.303) (-1977.833) * (-1983.248) (-1979.224) [-1973.076] (-1972.881) -- 0:02:24
      317500 -- (-1975.503) (-1980.783) (-1974.409) [-1973.533] * (-1985.866) (-1978.355) (-1971.084) [-1973.444] -- 0:02:24
      318000 -- (-1978.007) (-1975.354) (-1979.516) [-1974.038] * (-1980.663) (-1975.421) [-1970.607] (-1974.157) -- 0:02:23
      318500 -- (-1979.151) (-1977.311) [-1978.684] (-1976.720) * (-1973.328) (-1973.845) [-1975.080] (-1973.466) -- 0:02:23
      319000 -- (-1973.293) (-1975.301) [-1974.838] (-1975.351) * (-1977.222) [-1978.047] (-1973.386) (-1979.424) -- 0:02:23
      319500 -- (-1973.675) (-1978.678) [-1980.218] (-1975.160) * [-1983.128] (-1977.811) (-1976.606) (-1974.975) -- 0:02:22
      320000 -- (-1973.935) (-1979.781) (-1974.758) [-1977.493] * (-1978.138) (-1976.576) [-1978.437] (-1977.674) -- 0:02:22

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-1971.728) (-1977.747) [-1973.621] (-1978.820) * (-1978.276) (-1977.249) (-1975.043) [-1975.019] -- 0:02:22
      321000 -- (-1981.596) [-1972.033] (-1974.204) (-1983.144) * [-1974.306] (-1990.494) (-1973.126) (-1978.075) -- 0:02:21
      321500 -- [-1974.847] (-1977.174) (-1974.399) (-1982.769) * (-1978.094) [-1976.961] (-1979.531) (-1977.461) -- 0:02:21
      322000 -- [-1973.156] (-1975.567) (-1977.510) (-1979.273) * [-1975.966] (-1975.890) (-1973.539) (-1978.170) -- 0:02:23
      322500 -- (-1975.055) (-1976.734) [-1973.450] (-1977.069) * (-1982.437) [-1972.774] (-1984.180) (-1977.063) -- 0:02:22
      323000 -- (-1977.440) (-1979.584) [-1977.158] (-1982.911) * (-1979.641) (-1979.354) (-1981.345) [-1976.860] -- 0:02:22
      323500 -- [-1975.732] (-1977.431) (-1983.195) (-1981.031) * [-1975.620] (-1970.150) (-1979.864) (-1972.963) -- 0:02:22
      324000 -- (-1975.586) [-1980.398] (-1980.081) (-1979.219) * (-1980.142) [-1976.883] (-1988.511) (-1975.858) -- 0:02:21
      324500 -- (-1976.019) [-1974.792] (-1981.981) (-1979.281) * [-1980.112] (-1977.529) (-1978.804) (-1975.875) -- 0:02:21
      325000 -- (-1982.580) (-1980.960) (-1977.752) [-1973.151] * [-1987.780] (-1976.304) (-1992.775) (-1976.911) -- 0:02:21

      Average standard deviation of split frequencies: 0.000000

      325500 -- [-1976.741] (-1988.520) (-1972.118) (-1975.990) * (-1985.797) (-1986.305) (-1979.775) [-1971.719] -- 0:02:20
      326000 -- (-1975.048) (-1981.079) (-1982.811) [-1976.983] * [-1978.148] (-1982.201) (-1976.959) (-1978.466) -- 0:02:20
      326500 -- (-1972.595) [-1977.885] (-1979.684) (-1978.984) * (-1980.408) [-1974.136] (-1978.414) (-1978.482) -- 0:02:22
      327000 -- (-1986.395) (-1983.606) [-1978.036] (-1980.414) * (-1986.833) (-1976.198) (-1980.030) [-1975.989] -- 0:02:22
      327500 -- (-1972.414) (-1979.124) (-1974.450) [-1975.357] * (-1981.251) [-1971.368] (-1977.583) (-1975.534) -- 0:02:21
      328000 -- (-1974.466) [-1980.832] (-1979.051) (-1980.696) * (-1989.113) (-1975.229) (-1986.278) [-1972.726] -- 0:02:21
      328500 -- [-1984.875] (-1977.793) (-1979.052) (-1975.747) * (-1978.235) (-1985.290) (-1984.472) [-1975.105] -- 0:02:21
      329000 -- (-1971.820) [-1977.492] (-1976.033) (-1979.896) * [-1970.055] (-1975.341) (-1988.349) (-1976.432) -- 0:02:20
      329500 -- (-1975.751) [-1985.915] (-1979.168) (-1980.353) * [-1972.907] (-1981.405) (-1988.983) (-1977.797) -- 0:02:20
      330000 -- (-1991.467) [-1976.623] (-1975.252) (-1980.891) * (-1977.621) (-1976.105) (-1981.293) [-1978.403] -- 0:02:20

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-1974.012) (-1977.067) (-1974.554) [-1976.222] * [-1979.459] (-1978.048) (-1976.666) (-1984.162) -- 0:02:19
      331000 -- (-1976.775) [-1976.071] (-1974.208) (-1980.894) * (-1976.845) [-1979.507] (-1978.629) (-1980.398) -- 0:02:19
      331500 -- (-1977.307) (-1977.402) [-1982.862] (-1976.799) * (-1975.489) (-1977.069) [-1977.839] (-1978.779) -- 0:02:21
      332000 -- (-1980.419) [-1973.409] (-1972.765) (-1975.286) * (-1977.500) [-1980.084] (-1974.382) (-1979.938) -- 0:02:20
      332500 -- [-1977.798] (-1974.631) (-1979.033) (-1975.343) * [-1979.459] (-1979.003) (-1971.531) (-1979.065) -- 0:02:20
      333000 -- (-1978.066) (-1983.530) (-1981.643) [-1977.956] * (-1975.533) [-1983.156] (-1976.767) (-1980.875) -- 0:02:20
      333500 -- (-1991.721) (-1985.245) [-1980.262] (-1977.065) * (-1971.517) (-1982.246) (-1974.389) [-1977.555] -- 0:02:19
      334000 -- [-1978.301] (-1980.508) (-1973.230) (-1981.100) * (-1978.786) (-1981.399) [-1973.658] (-1986.086) -- 0:02:19
      334500 -- (-1982.294) (-1976.192) [-1973.075] (-1976.988) * (-1977.330) [-1971.190] (-1973.469) (-1978.674) -- 0:02:19
      335000 -- (-1975.526) [-1980.211] (-1974.557) (-1971.335) * (-1981.143) (-1971.443) [-1982.769] (-1978.603) -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      335500 -- (-1974.748) (-1977.068) (-1972.258) [-1972.702] * (-1972.634) (-1976.907) [-1976.697] (-1973.006) -- 0:02:18
      336000 -- (-1976.320) (-1974.743) [-1975.323] (-1971.619) * [-1975.109] (-1975.585) (-1978.704) (-1976.985) -- 0:02:20
      336500 -- (-1976.143) [-1978.383] (-1976.551) (-1979.774) * (-1979.497) (-1977.080) [-1977.201] (-1979.133) -- 0:02:19
      337000 -- (-1977.293) [-1978.986] (-1976.993) (-1978.665) * [-1977.527] (-1980.167) (-1980.369) (-1990.411) -- 0:02:19
      337500 -- (-1979.507) (-1974.871) (-1977.224) [-1978.126] * [-1977.514] (-1976.061) (-1976.973) (-1983.065) -- 0:02:19
      338000 -- (-1992.589) (-1975.692) [-1976.705] (-1978.296) * (-1974.799) (-1978.116) [-1976.158] (-1981.971) -- 0:02:19
      338500 -- (-1980.733) [-1971.579] (-1980.715) (-1980.713) * (-1978.350) [-1973.805] (-1974.375) (-1982.163) -- 0:02:18
      339000 -- [-1977.619] (-1976.230) (-1975.700) (-1984.210) * (-1979.288) [-1976.006] (-1975.447) (-1976.415) -- 0:02:18
      339500 -- [-1974.976] (-1973.537) (-1979.266) (-1985.045) * (-1979.410) [-1977.558] (-1985.938) (-1976.383) -- 0:02:20
      340000 -- (-1976.052) (-1981.576) [-1975.268] (-1988.466) * (-1973.424) [-1977.010] (-1975.692) (-1976.551) -- 0:02:19

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-1977.207] (-1980.107) (-1981.895) (-1977.811) * (-1975.575) (-1974.894) [-1973.622] (-1980.299) -- 0:02:19
      341000 -- [-1980.204] (-1972.945) (-1982.199) (-1977.008) * (-1974.352) [-1974.626] (-1973.733) (-1976.674) -- 0:02:19
      341500 -- (-1982.950) (-1977.402) [-1977.243] (-1985.910) * [-1979.151] (-1978.934) (-1974.467) (-1978.309) -- 0:02:18
      342000 -- (-1981.219) (-1972.419) [-1975.101] (-1982.462) * (-1978.625) (-1975.000) [-1979.243] (-1980.026) -- 0:02:18
      342500 -- (-1981.169) [-1976.249] (-1979.673) (-1980.251) * (-1982.035) (-1977.293) (-1975.150) [-1983.064] -- 0:02:18
      343000 -- [-1979.680] (-1975.808) (-1977.703) (-1977.668) * (-1977.122) (-1979.245) (-1974.866) [-1973.698] -- 0:02:17
      343500 -- [-1977.288] (-1981.328) (-1977.140) (-1978.069) * [-1973.364] (-1973.434) (-1976.751) (-1980.635) -- 0:02:17
      344000 -- (-1972.728) (-1977.914) (-1974.070) [-1977.153] * [-1974.711] (-1976.041) (-1974.813) (-1975.914) -- 0:02:19
      344500 -- [-1982.844] (-1982.346) (-1976.999) (-1979.917) * (-1975.827) (-1977.198) [-1979.764] (-1979.453) -- 0:02:18
      345000 -- (-1981.813) (-1972.720) (-1977.804) [-1978.614] * (-1977.094) (-1980.123) (-1979.634) [-1973.148] -- 0:02:18

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-1979.460) (-1980.433) [-1972.492] (-1981.430) * (-1975.665) [-1977.050] (-1980.841) (-1970.367) -- 0:02:18
      346000 -- (-1977.967) [-1976.127] (-1977.775) (-1979.810) * (-1978.617) (-1974.127) [-1978.745] (-1987.137) -- 0:02:17
      346500 -- (-1976.995) (-1975.337) (-1978.413) [-1978.454] * [-1977.611] (-1970.188) (-1980.380) (-1972.819) -- 0:02:17
      347000 -- (-1971.602) (-1974.985) [-1972.967] (-1980.850) * (-1980.085) [-1970.466] (-1980.926) (-1972.420) -- 0:02:17
      347500 -- (-1974.362) [-1973.842] (-1980.146) (-1971.446) * (-1977.891) (-1975.929) [-1975.725] (-1976.056) -- 0:02:17
      348000 -- (-1975.906) (-1977.949) (-1974.110) [-1975.602] * (-1974.215) [-1976.049] (-1975.483) (-1979.388) -- 0:02:16
      348500 -- (-1977.165) [-1972.222] (-1973.476) (-1989.370) * (-1977.682) [-1977.728] (-1978.282) (-1975.529) -- 0:02:16
      349000 -- (-1976.531) [-1972.756] (-1977.316) (-1977.534) * (-1975.092) [-1977.284] (-1986.000) (-1980.029) -- 0:02:18
      349500 -- (-1979.718) [-1976.505] (-1974.087) (-1973.688) * (-1975.194) (-1985.056) (-1975.638) [-1979.206] -- 0:02:17
      350000 -- (-1978.540) (-1979.176) (-1975.094) [-1973.798] * (-1972.845) (-1978.755) [-1979.264] (-1981.468) -- 0:02:17

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-1981.131) (-1977.275) (-1982.830) [-1975.793] * (-1975.001) (-1977.428) [-1977.968] (-1972.931) -- 0:02:17
      351000 -- (-1973.519) (-1971.926) (-1977.846) [-1973.661] * (-1977.818) (-1974.391) (-1981.305) [-1973.103] -- 0:02:16
      351500 -- (-1985.197) (-1985.911) [-1976.881] (-1974.159) * [-1980.477] (-1977.653) (-1975.485) (-1977.475) -- 0:02:16
      352000 -- (-1975.123) (-1987.435) [-1975.047] (-1976.010) * (-1972.148) [-1973.433] (-1976.636) (-1975.015) -- 0:02:16
      352500 -- [-1976.757] (-1973.058) (-1978.494) (-1976.594) * (-1974.257) (-1976.377) (-1981.328) [-1972.973] -- 0:02:15
      353000 -- (-1976.712) (-1980.080) [-1976.224] (-1983.096) * (-1976.116) (-1978.537) (-1981.142) [-1974.034] -- 0:02:15
      353500 -- [-1972.966] (-1978.480) (-1971.526) (-1976.465) * [-1981.345] (-1979.984) (-1980.291) (-1976.205) -- 0:02:17
      354000 -- (-1981.765) (-1976.287) (-1976.246) [-1974.508] * (-1974.488) (-1976.756) [-1974.263] (-1974.644) -- 0:02:16
      354500 -- (-1979.410) [-1973.739] (-1976.208) (-1982.500) * [-1973.673] (-1974.075) (-1976.122) (-1977.808) -- 0:02:16
      355000 -- [-1979.254] (-1977.897) (-1980.163) (-1976.737) * [-1975.045] (-1977.679) (-1975.081) (-1974.201) -- 0:02:16

      Average standard deviation of split frequencies: 0.000000

      355500 -- [-1977.784] (-1978.214) (-1972.068) (-1980.032) * [-1975.879] (-1982.879) (-1976.539) (-1971.744) -- 0:02:15
      356000 -- (-1979.609) (-1980.255) (-1979.962) [-1971.961] * (-1986.489) (-1985.920) [-1975.208] (-1973.485) -- 0:02:15
      356500 -- (-1980.734) (-1975.372) [-1979.934] (-1977.895) * [-1984.211] (-1986.583) (-1974.500) (-1975.953) -- 0:02:15
      357000 -- (-1975.799) (-1975.814) (-1979.284) [-1981.552] * (-1977.392) (-1987.282) (-1975.849) [-1974.580] -- 0:02:15
      357500 -- [-1974.618] (-1972.518) (-1975.278) (-1979.176) * (-1975.494) (-1980.414) (-1977.170) [-1977.706] -- 0:02:14
      358000 -- (-1976.589) [-1970.946] (-1984.922) (-1981.844) * [-1983.597] (-1974.457) (-1980.483) (-1971.483) -- 0:02:14
      358500 -- (-1978.887) [-1976.133] (-1982.347) (-1978.101) * (-1985.320) [-1973.401] (-1972.453) (-1980.869) -- 0:02:15
      359000 -- (-1978.877) [-1983.231] (-1978.615) (-1978.652) * (-1971.513) (-1977.777) [-1975.214] (-1982.121) -- 0:02:15
      359500 -- (-1976.108) [-1971.813] (-1979.221) (-1982.251) * [-1971.120] (-1973.383) (-1977.325) (-1979.360) -- 0:02:15
      360000 -- (-1974.541) [-1978.248] (-1977.614) (-1976.170) * [-1974.357] (-1975.691) (-1969.519) (-1981.253) -- 0:02:15

      Average standard deviation of split frequencies: 0.000000

      360500 -- (-1982.081) (-1975.062) [-1976.626] (-1974.701) * (-1975.831) (-1981.224) (-1979.247) [-1974.761] -- 0:02:14
      361000 -- (-1981.660) (-1974.533) (-1974.483) [-1977.267] * [-1976.985] (-1977.846) (-1974.723) (-1975.865) -- 0:02:14
      361500 -- (-1977.928) (-1977.619) (-1973.188) [-1975.527] * (-1975.604) (-1978.977) [-1976.151] (-1975.298) -- 0:02:14
      362000 -- (-1977.780) [-1975.494] (-1976.227) (-1982.449) * [-1974.585] (-1973.785) (-1975.762) (-1973.229) -- 0:02:15
      362500 -- (-1973.966) (-1976.468) (-1981.594) [-1977.078] * (-1974.348) (-1974.537) [-1974.765] (-1977.918) -- 0:02:15
      363000 -- (-1975.903) (-1979.094) (-1975.415) [-1980.038] * (-1972.349) (-1979.229) (-1976.448) [-1972.782] -- 0:02:15
      363500 -- [-1969.771] (-1976.501) (-1976.593) (-1977.046) * (-1973.585) (-1981.574) [-1977.567] (-1977.675) -- 0:02:14
      364000 -- [-1974.923] (-1977.103) (-1972.657) (-1983.736) * (-1976.163) (-1981.420) (-1975.662) [-1978.376] -- 0:02:14
      364500 -- (-1975.691) [-1974.987] (-1973.098) (-1973.585) * [-1973.765] (-1980.034) (-1980.323) (-1977.554) -- 0:02:14
      365000 -- (-1976.026) (-1975.859) (-1976.738) [-1976.061] * (-1981.685) (-1977.850) (-1977.176) [-1970.915] -- 0:02:13

      Average standard deviation of split frequencies: 0.000000

      365500 -- (-1974.006) (-1976.838) (-1979.108) [-1972.513] * (-1975.073) [-1977.272] (-1971.472) (-1974.050) -- 0:02:13
      366000 -- (-1974.476) (-1977.042) (-1978.179) [-1974.160] * [-1977.248] (-1980.183) (-1977.040) (-1975.542) -- 0:02:13
      366500 -- [-1980.344] (-1983.990) (-1982.565) (-1973.454) * (-1984.970) [-1977.002] (-1977.977) (-1972.907) -- 0:02:13
      367000 -- (-1976.158) [-1975.078] (-1988.485) (-1977.786) * (-1980.257) (-1984.161) [-1972.144] (-1980.158) -- 0:02:14
      367500 -- (-1980.248) (-1973.135) [-1973.690] (-1970.407) * [-1979.709] (-1979.897) (-1976.220) (-1979.675) -- 0:02:14
      368000 -- [-1974.367] (-1971.647) (-1974.424) (-1980.994) * (-1979.692) [-1977.068] (-1975.913) (-1979.234) -- 0:02:13
      368500 -- (-1983.357) (-1973.994) (-1976.795) [-1978.664] * (-1977.155) (-1972.154) (-1975.786) [-1972.484] -- 0:02:13
      369000 -- [-1975.970] (-1973.348) (-1975.030) (-1982.005) * [-1972.219] (-1974.478) (-1979.948) (-1977.180) -- 0:02:13
      369500 -- (-1980.521) (-1974.072) [-1976.976] (-1982.859) * (-1974.332) [-1974.019] (-1978.731) (-1983.470) -- 0:02:13
      370000 -- (-1977.293) (-1976.591) [-1973.397] (-1978.417) * [-1979.585] (-1978.750) (-1982.078) (-1979.782) -- 0:02:12

      Average standard deviation of split frequencies: 0.000000

      370500 -- (-1977.367) (-1978.874) (-1972.664) [-1977.817] * [-1975.921] (-1979.524) (-1976.698) (-1976.080) -- 0:02:12
      371000 -- (-1976.053) [-1973.233] (-1977.815) (-1979.245) * (-1976.696) (-1974.540) [-1970.580] (-1974.261) -- 0:02:12
      371500 -- [-1972.242] (-1978.544) (-1981.630) (-1979.316) * [-1975.976] (-1980.683) (-1974.975) (-1972.976) -- 0:02:11
      372000 -- (-1974.191) (-1979.610) [-1977.964] (-1977.001) * (-1974.713) [-1974.361] (-1976.575) (-1977.819) -- 0:02:13
      372500 -- [-1981.656] (-1979.810) (-1976.676) (-1976.620) * (-1977.581) [-1978.642] (-1978.060) (-1979.388) -- 0:02:13
      373000 -- (-1976.139) (-1974.526) [-1970.686] (-1975.026) * (-1977.139) (-1975.479) (-1975.090) [-1977.066] -- 0:02:12
      373500 -- (-1976.535) (-1977.051) (-1981.226) [-1978.901] * (-1979.252) (-1972.587) (-1977.563) [-1971.601] -- 0:02:12
      374000 -- [-1979.340] (-1978.389) (-1976.895) (-1984.031) * [-1974.736] (-1976.430) (-1982.014) (-1980.765) -- 0:02:12
      374500 -- (-1979.889) (-1975.446) (-1972.352) [-1975.961] * [-1971.281] (-1975.186) (-1984.751) (-1975.402) -- 0:02:11
      375000 -- (-1975.500) (-1985.733) [-1976.116] (-1974.920) * [-1974.693] (-1974.504) (-1978.671) (-1981.001) -- 0:02:11

      Average standard deviation of split frequencies: 0.000000

      375500 -- (-1977.041) (-1985.096) (-1977.071) [-1973.568] * (-1979.338) [-1975.308] (-1982.707) (-1977.482) -- 0:02:11
      376000 -- (-1973.078) (-1978.807) [-1977.825] (-1977.088) * (-1973.401) (-1977.984) (-1976.453) [-1973.671] -- 0:02:11
      376500 -- (-1971.969) [-1975.013] (-1977.165) (-1978.943) * (-1974.688) [-1977.123] (-1977.272) (-1975.719) -- 0:02:12
      377000 -- (-1974.005) (-1985.820) [-1986.227] (-1980.820) * (-1973.491) (-1972.288) (-1981.810) [-1978.552] -- 0:02:12
      377500 -- [-1977.877] (-1983.293) (-1974.204) (-1973.069) * [-1971.312] (-1978.199) (-1980.968) (-1974.835) -- 0:02:11
      378000 -- (-1984.191) [-1979.738] (-1978.102) (-1976.440) * (-1975.508) (-1975.732) (-1977.500) [-1977.674] -- 0:02:11
      378500 -- [-1976.466] (-1977.682) (-1979.688) (-1976.731) * [-1972.574] (-1981.399) (-1978.220) (-1975.210) -- 0:02:11
      379000 -- (-1971.915) [-1977.313] (-1975.635) (-1982.405) * (-1975.218) [-1978.423] (-1982.492) (-1978.185) -- 0:02:11
      379500 -- (-1972.720) (-1982.638) [-1975.840] (-1978.485) * (-1972.037) [-1978.841] (-1975.985) (-1979.165) -- 0:02:10
      380000 -- (-1973.654) (-1978.983) (-1980.221) [-1972.806] * [-1973.121] (-1974.008) (-1978.317) (-1977.825) -- 0:02:10

      Average standard deviation of split frequencies: 0.000000

      380500 -- (-1984.806) (-1975.767) [-1980.715] (-1978.932) * (-1978.234) (-1975.631) (-1972.326) [-1975.087] -- 0:02:10
      381000 -- (-1974.733) (-1973.730) (-1979.514) [-1971.976] * (-1975.178) [-1977.840] (-1970.936) (-1975.113) -- 0:02:09
      381500 -- (-1982.277) (-1976.239) (-1982.025) [-1975.364] * (-1982.227) (-1981.222) [-1974.667] (-1975.425) -- 0:02:11
      382000 -- (-1981.805) (-1975.913) [-1985.249] (-1975.717) * (-1976.063) (-1971.089) (-1975.610) [-1973.415] -- 0:02:11
      382500 -- (-1981.347) (-1972.680) [-1976.888] (-1991.250) * (-1974.046) (-1977.986) (-1984.701) [-1971.911] -- 0:02:10
      383000 -- (-1977.497) (-1976.382) [-1971.674] (-1979.945) * [-1973.644] (-1980.287) (-1977.781) (-1978.198) -- 0:02:10
      383500 -- (-1984.071) (-1970.720) [-1971.983] (-1975.148) * (-1971.952) (-1983.003) (-1983.576) [-1973.468] -- 0:02:10
      384000 -- (-1978.610) [-1976.682] (-1978.724) (-1974.607) * (-1979.113) (-1976.842) [-1982.320] (-1979.662) -- 0:02:09
      384500 -- (-1981.149) (-1979.621) [-1974.076] (-1980.666) * (-1978.053) [-1974.588] (-1975.324) (-1974.947) -- 0:02:09
      385000 -- (-1982.378) [-1971.245] (-1975.273) (-1978.115) * [-1977.580] (-1976.832) (-1983.348) (-1973.288) -- 0:02:09

      Average standard deviation of split frequencies: 0.000000

      385500 -- [-1986.155] (-1978.716) (-1979.936) (-1985.714) * (-1973.805) [-1976.155] (-1982.352) (-1974.766) -- 0:02:09
      386000 -- (-1980.134) (-1983.009) (-1979.415) [-1976.231] * (-1981.632) (-1975.465) [-1974.772] (-1987.657) -- 0:02:08
      386500 -- (-1979.234) [-1979.177] (-1973.168) (-1980.898) * (-1976.039) (-1981.095) [-1976.779] (-1972.282) -- 0:02:10
      387000 -- (-1981.724) [-1975.955] (-1984.463) (-1974.848) * (-1975.259) (-1973.767) [-1979.762] (-1973.104) -- 0:02:09
      387500 -- (-1977.983) (-1976.153) (-1977.985) [-1977.936] * (-1978.912) (-1974.942) (-1978.483) [-1974.698] -- 0:02:09
      388000 -- [-1981.275] (-1976.114) (-1978.448) (-1981.472) * (-1980.984) (-1979.434) (-1985.190) [-1977.172] -- 0:02:09
      388500 -- (-1980.491) (-1977.133) [-1979.074] (-1975.916) * (-1981.458) (-1980.793) (-1982.219) [-1974.012] -- 0:02:09
      389000 -- (-1976.131) [-1974.885] (-1979.427) (-1979.022) * (-1978.517) (-1983.853) (-1981.286) [-1979.095] -- 0:02:08
      389500 -- (-1975.360) [-1977.479] (-1988.746) (-1980.782) * (-1981.445) (-1985.342) (-1980.132) [-1977.429] -- 0:02:08
      390000 -- (-1980.240) (-1978.777) (-1984.363) [-1978.578] * (-1975.921) (-1983.110) (-1979.973) [-1977.773] -- 0:02:08

      Average standard deviation of split frequencies: 0.000000

      390500 -- (-1982.533) [-1975.875] (-1988.026) (-1976.800) * [-1978.529] (-1983.198) (-1978.713) (-1978.939) -- 0:02:07
      391000 -- (-1974.264) (-1975.479) (-1975.361) [-1972.436] * (-1976.103) (-1981.528) (-1981.454) [-1978.449] -- 0:02:09
      391500 -- [-1973.737] (-1973.078) (-1982.167) (-1975.726) * (-1974.018) [-1972.675] (-1984.881) (-1970.862) -- 0:02:09
      392000 -- (-1976.139) [-1974.608] (-1971.787) (-1970.419) * (-1978.633) (-1981.005) [-1974.751] (-1976.311) -- 0:02:08
      392500 -- (-1974.793) [-1979.171] (-1980.530) (-1973.207) * (-1980.554) (-1978.990) (-1977.755) [-1971.891] -- 0:02:08
      393000 -- (-1978.854) [-1972.272] (-1982.769) (-1977.053) * (-1973.530) (-1975.349) (-1974.214) [-1972.501] -- 0:02:08
      393500 -- (-1976.751) (-1974.405) (-1978.942) [-1977.710] * (-1974.691) [-1972.046] (-1975.959) (-1976.191) -- 0:02:07
      394000 -- [-1979.838] (-1978.009) (-1981.555) (-1974.550) * (-1975.528) (-1974.030) [-1973.882] (-1979.260) -- 0:02:07
      394500 -- [-1981.699] (-1978.271) (-1983.198) (-1972.055) * (-1975.022) [-1978.781] (-1971.537) (-1973.647) -- 0:02:07
      395000 -- (-1973.005) [-1974.261] (-1979.695) (-1984.303) * (-1978.728) (-1970.658) (-1974.310) [-1976.712] -- 0:02:07

      Average standard deviation of split frequencies: 0.000000

      395500 -- (-1977.956) (-1981.689) [-1984.426] (-1978.228) * [-1971.156] (-1976.880) (-1974.314) (-1984.064) -- 0:02:08
      396000 -- [-1981.571] (-1975.274) (-1982.748) (-1972.845) * (-1969.712) (-1978.659) (-1975.568) [-1971.251] -- 0:02:08
      396500 -- (-1978.749) (-1981.534) (-1978.728) [-1973.813] * (-1980.510) (-1979.558) (-1979.862) [-1971.393] -- 0:02:07
      397000 -- (-1982.300) (-1982.546) (-1980.037) [-1977.181] * (-1977.993) (-1981.256) [-1975.792] (-1973.692) -- 0:02:07
      397500 -- (-1979.107) [-1977.883] (-1979.453) (-1973.585) * (-1975.625) [-1977.574] (-1984.885) (-1985.047) -- 0:02:07
      398000 -- (-1975.789) (-1980.083) (-1983.904) [-1977.873] * [-1974.230] (-1975.515) (-1973.465) (-1973.808) -- 0:02:07
      398500 -- (-1976.046) (-1972.756) (-1975.155) [-1979.558] * (-1974.302) (-1982.379) [-1977.059] (-1979.673) -- 0:02:06
      399000 -- [-1972.064] (-1982.516) (-1979.729) (-1969.822) * [-1970.431] (-1976.262) (-1973.163) (-1978.291) -- 0:02:06
      399500 -- (-1973.634) (-1976.927) (-1980.409) [-1975.051] * (-1980.146) (-1977.127) [-1973.091] (-1981.075) -- 0:02:06
      400000 -- (-1976.976) (-1986.236) [-1975.386] (-1979.862) * [-1975.294] (-1974.262) (-1977.403) (-1976.576) -- 0:02:06

      Average standard deviation of split frequencies: 0.000000

      400500 -- (-1974.601) (-1981.409) (-1975.217) [-1975.823] * (-1979.495) (-1986.348) [-1974.444] (-1985.442) -- 0:02:07
      401000 -- (-1977.570) (-1979.387) (-1981.532) [-1985.454] * [-1976.485] (-1980.014) (-1978.278) (-1975.847) -- 0:02:06
      401500 -- [-1971.456] (-1980.588) (-1979.960) (-1980.656) * (-1974.365) (-1989.872) [-1975.359] (-1977.593) -- 0:02:06
      402000 -- [-1976.605] (-1976.064) (-1973.598) (-1980.611) * (-1979.902) [-1975.133] (-1977.910) (-1984.095) -- 0:02:06
      402500 -- (-1972.859) (-1982.432) (-1975.856) [-1986.001] * [-1975.938] (-1974.119) (-1979.765) (-1981.129) -- 0:02:06
      403000 -- (-1980.415) (-1990.144) [-1982.382] (-1979.955) * (-1972.868) [-1972.745] (-1974.421) (-1975.615) -- 0:02:05
      403500 -- (-1977.526) [-1980.998] (-1983.808) (-1983.266) * (-1978.082) (-1974.856) (-1976.925) [-1973.899] -- 0:02:05
      404000 -- (-1977.010) (-1977.366) (-1978.055) [-1978.873] * [-1974.544] (-1972.313) (-1978.991) (-1974.222) -- 0:02:05
      404500 -- (-1977.498) [-1974.044] (-1981.126) (-1975.014) * (-1973.190) [-1974.866] (-1978.677) (-1985.428) -- 0:02:05
      405000 -- (-1974.889) (-1974.006) [-1974.571] (-1978.595) * [-1983.826] (-1976.922) (-1976.698) (-1977.868) -- 0:02:06

      Average standard deviation of split frequencies: 0.000000

      405500 -- (-1975.979) (-1976.479) (-1976.208) [-1975.749] * (-1981.748) (-1975.420) (-1972.750) [-1977.851] -- 0:02:06
      406000 -- [-1976.776] (-1972.323) (-1981.085) (-1973.128) * (-1978.524) (-1974.190) [-1973.379] (-1973.314) -- 0:02:05
      406500 -- (-1983.237) [-1974.704] (-1979.184) (-1977.509) * [-1975.429] (-1974.669) (-1981.081) (-1974.863) -- 0:02:05
      407000 -- [-1981.386] (-1980.607) (-1984.208) (-1978.127) * [-1973.234] (-1970.745) (-1981.501) (-1982.934) -- 0:02:05
      407500 -- (-1982.086) (-1978.508) (-1978.860) [-1976.213] * (-1975.481) [-1974.801] (-1973.767) (-1985.796) -- 0:02:05
      408000 -- (-1973.112) [-1976.353] (-1976.185) (-1983.005) * (-1980.272) [-1980.268] (-1978.438) (-1981.059) -- 0:02:04
      408500 -- (-1974.283) (-1979.762) (-1981.126) [-1979.111] * (-1976.913) (-1970.744) (-1981.607) [-1984.772] -- 0:02:04
      409000 -- [-1974.257] (-1978.128) (-1976.524) (-1978.063) * (-1977.083) (-1980.035) (-1978.044) [-1979.484] -- 0:02:04
      409500 -- (-1975.557) (-1976.996) (-1978.323) [-1979.513] * (-1976.455) [-1969.240] (-1987.317) (-1981.731) -- 0:02:04
      410000 -- (-1971.329) (-1977.766) (-1982.611) [-1981.322] * (-1979.006) [-1971.671] (-1984.926) (-1979.691) -- 0:02:05

      Average standard deviation of split frequencies: 0.000000

      410500 -- (-1977.564) (-1978.118) (-1984.011) [-1972.289] * (-1972.575) (-1981.917) [-1977.329] (-1989.328) -- 0:02:04
      411000 -- [-1977.216] (-1973.232) (-1980.940) (-1982.482) * (-1975.482) (-1982.057) (-1976.681) [-1978.261] -- 0:02:04
      411500 -- (-1976.639) [-1973.768] (-1980.513) (-1981.915) * [-1976.761] (-1974.574) (-1979.320) (-1982.426) -- 0:02:04
      412000 -- (-1971.709) (-1980.589) [-1978.134] (-1986.420) * (-1981.370) (-1980.439) [-1979.560] (-1979.784) -- 0:02:04
      412500 -- [-1979.476] (-1979.521) (-1986.750) (-1977.753) * (-1979.526) [-1974.318] (-1975.669) (-1986.902) -- 0:02:03
      413000 -- (-1973.354) [-1973.718] (-1977.501) (-1982.711) * (-1975.802) [-1981.198] (-1974.429) (-1979.986) -- 0:02:03
      413500 -- (-1977.693) (-1978.347) (-1980.548) [-1973.597] * (-1977.952) (-1984.508) [-1975.025] (-1974.293) -- 0:02:03
      414000 -- [-1976.225] (-1975.269) (-1975.214) (-1982.349) * [-1974.266] (-1978.324) (-1976.874) (-1975.992) -- 0:02:03
      414500 -- (-1974.625) [-1978.149] (-1979.966) (-1978.666) * (-1977.665) (-1971.894) [-1974.291] (-1980.672) -- 0:02:04
      415000 -- (-1977.267) (-1981.413) [-1973.645] (-1978.067) * (-1978.873) (-1974.653) [-1974.698] (-1973.412) -- 0:02:04

      Average standard deviation of split frequencies: 0.000000

      415500 -- [-1973.148] (-1981.155) (-1981.881) (-1975.323) * (-1974.878) [-1976.409] (-1979.703) (-1976.961) -- 0:02:03
      416000 -- (-1985.459) [-1976.785] (-1987.226) (-1979.100) * (-1974.682) (-1981.600) [-1975.009] (-1976.177) -- 0:02:03
      416500 -- (-1984.861) (-1985.176) (-1976.489) [-1971.002] * [-1973.136] (-1985.681) (-1976.313) (-1976.368) -- 0:02:03
      417000 -- [-1979.748] (-1980.856) (-1976.905) (-1974.772) * (-1978.162) (-1978.270) [-1973.053] (-1980.704) -- 0:02:03
      417500 -- [-1971.199] (-1978.150) (-1976.026) (-1982.090) * (-1983.479) [-1970.946] (-1977.214) (-1975.420) -- 0:02:02
      418000 -- [-1977.211] (-1972.550) (-1977.057) (-1981.627) * (-1981.669) (-1978.082) [-1975.217] (-1976.959) -- 0:02:02
      418500 -- (-1979.140) [-1978.504] (-1978.340) (-1975.162) * [-1978.204] (-1982.179) (-1976.456) (-1977.367) -- 0:02:02
      419000 -- (-1978.858) (-1975.541) [-1973.085] (-1985.860) * (-1975.138) [-1975.090] (-1980.157) (-1975.207) -- 0:02:02
      419500 -- (-1972.191) (-1981.112) (-1980.336) [-1973.011] * (-1986.114) [-1976.073] (-1977.776) (-1984.376) -- 0:02:03
      420000 -- (-1976.195) (-1978.839) [-1974.528] (-1972.593) * (-1974.457) [-1975.855] (-1975.384) (-1973.530) -- 0:02:02

      Average standard deviation of split frequencies: 0.000000

      420500 -- (-1978.083) (-1978.842) [-1974.809] (-1973.330) * (-1975.338) (-1978.718) [-1976.758] (-1977.732) -- 0:02:02
      421000 -- [-1975.472] (-1979.168) (-1976.951) (-1979.132) * [-1975.810] (-1981.411) (-1974.520) (-1976.151) -- 0:02:02
      421500 -- (-1978.772) [-1973.243] (-1981.755) (-1978.655) * (-1976.678) (-1975.939) (-1977.765) [-1972.085] -- 0:02:02
      422000 -- (-1975.408) (-1977.966) (-1985.619) [-1974.573] * (-1973.530) (-1982.104) (-1973.823) [-1974.195] -- 0:02:01
      422500 -- (-1983.877) [-1977.184] (-1978.774) (-1976.264) * (-1979.477) (-1981.001) [-1980.412] (-1979.716) -- 0:02:01
      423000 -- [-1976.243] (-1980.446) (-1976.768) (-1983.566) * (-1980.341) (-1978.183) (-1976.650) [-1980.914] -- 0:02:01
      423500 -- [-1975.294] (-1981.833) (-1983.965) (-1979.384) * (-1984.903) (-1983.273) (-1978.052) [-1972.892] -- 0:02:01
      424000 -- (-1975.181) (-1973.007) (-1975.532) [-1986.272] * (-1983.255) (-1974.261) (-1974.958) [-1975.533] -- 0:02:02
      424500 -- (-1981.141) (-1985.690) (-1973.175) [-1980.200] * (-1977.848) (-1971.753) [-1976.869] (-1978.097) -- 0:02:02
      425000 -- (-1985.398) [-1974.597] (-1975.836) (-1984.315) * (-1972.881) (-1976.962) [-1976.919] (-1981.508) -- 0:02:01

      Average standard deviation of split frequencies: 0.000000

      425500 -- (-1975.293) [-1971.872] (-1978.299) (-1980.009) * [-1978.333] (-1975.586) (-1971.867) (-1978.655) -- 0:02:01
      426000 -- (-1981.822) (-1976.148) (-1977.715) [-1977.547] * (-1973.750) [-1979.990] (-1982.457) (-1974.982) -- 0:02:01
      426500 -- (-1985.203) (-1978.224) (-1975.799) [-1976.806] * [-1977.358] (-1983.291) (-1977.992) (-1970.625) -- 0:02:01
      427000 -- (-1975.479) (-1977.420) [-1976.414] (-1972.453) * (-1975.618) (-1980.077) [-1978.624] (-1974.640) -- 0:02:00
      427500 -- (-1977.070) (-1982.108) [-1975.213] (-1979.554) * (-1981.309) (-1973.366) (-1978.210) [-1975.534] -- 0:02:00
      428000 -- (-1977.051) (-1976.746) [-1972.229] (-1974.405) * (-1974.697) (-1975.400) (-1979.770) [-1976.080] -- 0:02:00
      428500 -- [-1978.391] (-1983.794) (-1979.028) (-1977.871) * (-1972.188) (-1977.964) [-1973.587] (-1976.310) -- 0:02:00
      429000 -- [-1971.426] (-1983.679) (-1981.560) (-1984.855) * (-1972.341) [-1972.167] (-1979.405) (-1977.045) -- 0:02:01
      429500 -- (-1974.286) [-1975.359] (-1973.561) (-1980.995) * (-1973.274) [-1976.505] (-1980.854) (-1978.269) -- 0:02:00
      430000 -- [-1974.981] (-1977.785) (-1975.737) (-1972.283) * (-1974.610) (-1975.200) [-1970.953] (-1978.787) -- 0:02:00

      Average standard deviation of split frequencies: 0.000000

      430500 -- (-1987.682) (-1975.192) [-1975.331] (-1981.022) * (-1978.626) (-1972.603) (-1973.058) [-1978.640] -- 0:02:00
      431000 -- (-1974.898) (-1976.267) (-1970.457) [-1975.493] * (-1978.384) (-1978.411) [-1975.556] (-1974.660) -- 0:02:00
      431500 -- [-1976.958] (-1976.295) (-1972.934) (-1977.926) * (-1975.405) (-1975.968) [-1971.206] (-1977.139) -- 0:01:59
      432000 -- [-1972.052] (-1975.523) (-1973.323) (-1979.167) * (-1976.336) (-1973.026) (-1974.857) [-1977.609] -- 0:01:59
      432500 -- [-1975.989] (-1977.420) (-1977.774) (-1979.112) * (-1976.004) [-1976.215] (-1981.866) (-1976.724) -- 0:01:59
      433000 -- (-1973.384) (-1977.941) (-1979.467) [-1978.136] * (-1976.654) (-1978.650) (-1977.669) [-1975.940] -- 0:01:59
      433500 -- (-1973.368) (-1978.723) (-1985.248) [-1976.483] * (-1978.112) (-1983.082) [-1974.745] (-1974.924) -- 0:01:58
      434000 -- [-1978.024] (-1975.242) (-1979.713) (-1971.341) * (-1975.354) (-1979.505) (-1972.798) [-1972.216] -- 0:01:59
      434500 -- [-1976.393] (-1982.573) (-1983.892) (-1974.499) * [-1973.912] (-1975.429) (-1973.543) (-1972.369) -- 0:01:59
      435000 -- [-1981.395] (-1978.946) (-1980.481) (-1974.219) * (-1974.600) (-1977.011) (-1977.465) [-1976.669] -- 0:01:59

      Average standard deviation of split frequencies: 0.000000

      435500 -- (-1974.466) (-1983.695) [-1983.056] (-1983.023) * [-1977.096] (-1983.583) (-1980.201) (-1975.333) -- 0:01:59
      436000 -- (-1972.292) (-1979.489) (-1978.878) [-1972.863] * (-1980.968) (-1979.214) (-1987.047) [-1979.094] -- 0:01:59
      436500 -- (-1977.293) (-1976.162) (-1976.872) [-1973.383] * [-1971.743] (-1978.010) (-1985.335) (-1974.952) -- 0:01:58
      437000 -- (-1974.967) [-1974.558] (-1975.890) (-1975.351) * [-1977.515] (-1979.289) (-1982.562) (-1976.286) -- 0:01:58
      437500 -- (-1979.404) (-1976.826) (-1974.324) [-1980.034] * (-1980.259) (-1984.397) [-1979.853] (-1974.256) -- 0:01:58
      438000 -- (-1982.126) (-1984.100) (-1974.792) [-1976.668] * (-1975.683) (-1978.619) [-1977.712] (-1979.278) -- 0:01:58
      438500 -- (-1977.617) [-1977.306] (-1973.829) (-1974.186) * (-1976.868) (-1982.827) [-1977.422] (-1982.228) -- 0:01:59
      439000 -- [-1979.421] (-1974.669) (-1977.885) (-1978.059) * (-1983.295) (-1976.263) [-1974.346] (-1976.829) -- 0:01:58
      439500 -- (-1974.307) (-1975.350) (-1978.099) [-1974.823] * [-1970.962] (-1971.650) (-1975.882) (-1978.974) -- 0:01:58
      440000 -- [-1971.144] (-1977.414) (-1975.076) (-1977.851) * (-1971.260) [-1978.212] (-1970.581) (-1981.624) -- 0:01:58

      Average standard deviation of split frequencies: 0.000000

      440500 -- (-1976.409) (-1975.695) (-1979.641) [-1977.047] * (-1977.148) (-1976.120) (-1978.326) [-1984.262] -- 0:01:58
      441000 -- (-1977.477) [-1977.140] (-1979.844) (-1975.243) * (-1977.291) (-1974.307) [-1973.864] (-1981.896) -- 0:01:57
      441500 -- (-1976.502) (-1979.994) [-1972.654] (-1973.974) * (-1986.463) (-1977.376) [-1972.807] (-1982.188) -- 0:01:57
      442000 -- [-1974.609] (-1976.221) (-1977.214) (-1977.628) * (-1976.077) (-1978.413) [-1977.795] (-1984.907) -- 0:01:57
      442500 -- (-1979.011) (-1972.272) [-1977.849] (-1980.670) * [-1974.774] (-1976.643) (-1976.661) (-1978.418) -- 0:01:57
      443000 -- (-1979.919) [-1972.517] (-1974.426) (-1979.864) * [-1977.208] (-1980.728) (-1974.143) (-1976.562) -- 0:01:56
      443500 -- (-1982.219) [-1976.227] (-1975.775) (-1984.817) * (-1976.867) (-1975.208) [-1978.731] (-1979.051) -- 0:01:57
      444000 -- (-1977.860) (-1972.852) (-1975.255) [-1978.153] * (-1974.663) (-1980.010) [-1974.382] (-1976.525) -- 0:01:57
      444500 -- [-1977.146] (-1974.790) (-1978.716) (-1978.401) * [-1979.011] (-1977.839) (-1974.188) (-1979.380) -- 0:01:57
      445000 -- (-1974.678) (-1973.985) (-1977.446) [-1975.677] * (-1973.541) (-1980.732) [-1979.876] (-1976.805) -- 0:01:57

      Average standard deviation of split frequencies: 0.000000

      445500 -- (-1975.876) [-1981.346] (-1972.667) (-1978.547) * (-1972.301) (-1976.457) (-1976.049) [-1975.031] -- 0:01:56
      446000 -- (-1974.741) [-1978.997] (-1976.084) (-1977.542) * [-1974.903] (-1974.033) (-1975.982) (-1979.488) -- 0:01:56
      446500 -- (-1977.732) (-1977.805) [-1975.088] (-1975.442) * (-1980.019) (-1980.231) (-1975.677) [-1979.424] -- 0:01:56
      447000 -- (-1977.064) [-1978.328] (-1977.330) (-1975.630) * (-1975.541) [-1975.784] (-1979.199) (-1981.142) -- 0:01:56
      447500 -- (-1986.726) [-1974.478] (-1975.487) (-1977.736) * (-1973.089) (-1975.344) (-1989.388) [-1981.245] -- 0:01:56
      448000 -- [-1982.437] (-1979.840) (-1986.348) (-1979.085) * (-1976.706) [-1973.162] (-1979.153) (-1972.545) -- 0:01:57
      448500 -- (-1981.662) (-1979.518) (-1984.280) [-1973.499] * (-1980.916) [-1976.524] (-1975.473) (-1974.399) -- 0:01:56
      449000 -- (-1976.342) [-1977.338] (-1983.225) (-1973.691) * [-1974.225] (-1987.245) (-1976.836) (-1971.911) -- 0:01:56
      449500 -- (-1972.769) (-1976.411) (-1978.135) [-1974.863] * (-1977.133) (-1978.824) [-1974.379] (-1972.567) -- 0:01:56
      450000 -- [-1976.988] (-1979.173) (-1978.450) (-1973.842) * [-1977.711] (-1972.216) (-1977.331) (-1975.141) -- 0:01:56

      Average standard deviation of split frequencies: 0.000000

      450500 -- (-1983.730) (-1989.804) [-1980.462] (-1980.200) * [-1974.937] (-1979.063) (-1976.123) (-1976.316) -- 0:01:55
      451000 -- (-1977.104) (-1994.274) (-1975.347) [-1977.318] * (-1980.015) (-1972.202) [-1980.312] (-1980.416) -- 0:01:55
      451500 -- (-1975.409) (-1977.593) [-1977.848] (-1977.018) * (-1976.371) (-1976.342) (-1977.824) [-1977.008] -- 0:01:55
      452000 -- [-1978.371] (-1973.726) (-1973.981) (-1978.048) * (-1983.960) [-1974.865] (-1974.996) (-1977.190) -- 0:01:55
      452500 -- (-1971.398) [-1972.766] (-1976.823) (-1972.287) * (-1978.927) (-1974.140) (-1973.538) [-1976.265] -- 0:01:54
      453000 -- (-1980.817) [-1972.389] (-1974.179) (-1973.763) * (-1980.273) (-1975.231) [-1973.440] (-1976.127) -- 0:01:55
      453500 -- [-1976.252] (-1973.286) (-1982.817) (-1976.864) * [-1980.573] (-1975.044) (-1976.628) (-1981.040) -- 0:01:55
      454000 -- (-1981.888) (-1977.860) [-1976.350] (-1975.687) * (-1977.363) (-1976.539) [-1979.867] (-1979.155) -- 0:01:55
      454500 -- [-1973.862] (-1976.552) (-1975.195) (-1982.754) * (-1981.320) (-1983.910) (-1975.687) [-1974.072] -- 0:01:55
      455000 -- (-1983.142) [-1974.821] (-1976.760) (-1980.584) * (-1977.098) (-1977.331) (-1975.996) [-1972.351] -- 0:01:54

      Average standard deviation of split frequencies: 0.000000

      455500 -- (-1973.006) (-1975.977) [-1975.978] (-1995.029) * (-1980.801) [-1976.449] (-1975.750) (-1981.967) -- 0:01:54
      456000 -- (-1977.211) (-1982.381) [-1977.983] (-1977.687) * [-1979.135] (-1978.386) (-1980.761) (-1981.826) -- 0:01:54
      456500 -- [-1974.755] (-1977.904) (-1977.715) (-1982.752) * (-1979.400) [-1977.508] (-1980.074) (-1974.759) -- 0:01:54
      457000 -- (-1976.777) [-1976.390] (-1976.768) (-1975.577) * (-1977.359) [-1971.651] (-1979.538) (-1972.912) -- 0:01:54
      457500 -- [-1977.213] (-1978.595) (-1977.195) (-1979.805) * (-1975.137) [-1972.819] (-1979.532) (-1981.896) -- 0:01:55
      458000 -- (-1978.461) (-1975.184) (-1983.859) [-1974.528] * (-1979.338) (-1978.927) [-1980.294] (-1980.575) -- 0:01:54
      458500 -- [-1982.245] (-1977.613) (-1979.536) (-1981.163) * (-1979.255) (-1975.699) [-1973.316] (-1973.485) -- 0:01:54
      459000 -- (-1983.771) (-1982.978) [-1976.850] (-1977.702) * (-1978.856) (-1974.095) (-1977.375) [-1976.516] -- 0:01:54
      459500 -- (-1975.637) (-1977.137) [-1974.484] (-1984.913) * (-1977.835) [-1973.461] (-1976.373) (-1979.419) -- 0:01:54
      460000 -- (-1970.573) (-1979.678) (-1977.743) [-1972.320] * (-1978.676) [-1977.572] (-1973.290) (-1975.181) -- 0:01:53

      Average standard deviation of split frequencies: 0.000000

      460500 -- (-1976.820) (-1981.726) (-1977.461) [-1979.092] * (-1979.486) (-1980.456) [-1975.227] (-1973.547) -- 0:01:53
      461000 -- (-1973.881) (-1980.434) (-1981.844) [-1978.099] * (-1988.293) (-1978.969) (-1974.867) [-1975.448] -- 0:01:53
      461500 -- [-1980.401] (-1987.296) (-1979.507) (-1975.232) * [-1978.987] (-1985.738) (-1975.715) (-1975.102) -- 0:01:53
      462000 -- (-1977.355) [-1981.715] (-1984.481) (-1976.707) * (-1975.897) (-1981.805) [-1972.116] (-1983.838) -- 0:01:52
      462500 -- (-1979.579) (-1976.941) (-1977.531) [-1974.594] * (-1978.400) (-1978.439) [-1976.841] (-1973.266) -- 0:01:53
      463000 -- (-1977.638) [-1975.488] (-1974.772) (-1981.740) * (-1982.854) (-1978.595) [-1977.563] (-1977.718) -- 0:01:53
      463500 -- (-1978.637) (-1979.338) [-1983.429] (-1984.430) * (-1972.814) [-1978.129] (-1980.329) (-1976.444) -- 0:01:53
      464000 -- (-1975.793) (-1981.177) [-1978.717] (-1979.338) * (-1975.071) [-1970.864] (-1981.789) (-1979.164) -- 0:01:53
      464500 -- [-1974.016] (-1982.539) (-1977.529) (-1977.622) * [-1976.250] (-1986.972) (-1980.605) (-1975.655) -- 0:01:52
      465000 -- [-1977.386] (-1981.504) (-1974.170) (-1976.276) * (-1975.237) [-1980.046] (-1978.896) (-1975.144) -- 0:01:52

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-1973.331) (-1979.959) [-1972.301] (-1977.661) * (-1975.118) [-1975.343] (-1984.230) (-1982.785) -- 0:01:52
      466000 -- (-1980.625) (-1978.018) [-1976.810] (-1977.385) * (-1976.938) (-1975.614) (-1982.324) [-1974.725] -- 0:01:52
      466500 -- (-1975.511) (-1977.904) [-1974.084] (-1975.051) * (-1974.204) [-1978.566] (-1979.635) (-1981.001) -- 0:01:52
      467000 -- [-1975.857] (-1979.003) (-1976.037) (-1973.704) * [-1976.312] (-1977.170) (-1975.020) (-1978.927) -- 0:01:51
      467500 -- (-1977.303) (-1977.574) [-1976.344] (-1978.590) * [-1975.607] (-1977.927) (-1980.470) (-1983.854) -- 0:01:52
      468000 -- [-1974.823] (-1982.738) (-1978.068) (-1975.880) * (-1977.908) (-1981.513) [-1973.713] (-1976.321) -- 0:01:52
      468500 -- [-1974.409] (-1979.664) (-1975.471) (-1977.988) * (-1980.285) (-1973.390) [-1979.921] (-1983.695) -- 0:01:52
      469000 -- (-1979.038) (-1975.838) [-1972.530] (-1978.018) * (-1971.852) (-1977.793) (-1977.163) [-1973.581] -- 0:01:52
      469500 -- (-1981.968) (-1979.074) (-1975.839) [-1971.976] * (-1975.461) [-1975.638] (-1978.105) (-1974.315) -- 0:01:51
      470000 -- (-1976.861) (-1977.788) (-1976.829) [-1975.374] * (-1973.248) (-1976.466) [-1975.608] (-1980.248) -- 0:01:51

      Average standard deviation of split frequencies: 0.000000

      470500 -- (-1974.351) [-1979.352] (-1974.233) (-1979.290) * (-1974.444) (-1975.471) [-1971.955] (-1979.845) -- 0:01:51
      471000 -- (-1981.411) (-1977.435) (-1978.891) [-1977.400] * [-1974.667] (-1974.332) (-1975.898) (-1981.923) -- 0:01:51
      471500 -- (-1990.722) [-1975.141] (-1980.530) (-1974.301) * (-1976.053) (-1975.242) [-1974.062] (-1984.720) -- 0:01:50
      472000 -- (-1976.339) (-1973.622) [-1976.273] (-1983.379) * (-1977.528) (-1976.053) [-1974.437] (-1980.793) -- 0:01:51
      472500 -- (-1980.018) (-1973.336) [-1975.733] (-1979.263) * (-1977.011) (-1980.675) (-1976.367) [-1973.352] -- 0:01:51
      473000 -- (-1979.413) (-1977.571) (-1978.018) [-1972.267] * (-1976.692) (-1977.657) [-1971.747] (-1977.559) -- 0:01:51
      473500 -- (-1975.999) (-1977.658) (-1981.231) [-1973.477] * (-1976.436) (-1976.747) (-1973.392) [-1974.679] -- 0:01:51
      474000 -- (-1976.805) (-1974.780) [-1973.838] (-1976.747) * [-1977.703] (-1976.383) (-1978.410) (-1970.470) -- 0:01:50
      474500 -- (-1974.228) (-1986.658) (-1983.165) [-1979.687] * (-1977.467) [-1976.539] (-1973.238) (-1977.115) -- 0:01:50
      475000 -- (-1975.622) (-1975.617) [-1980.035] (-1975.854) * [-1981.325] (-1973.258) (-1981.150) (-1979.913) -- 0:01:50

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-1972.083) (-1982.497) [-1974.420] (-1975.270) * (-1974.345) [-1971.763] (-1983.200) (-1976.357) -- 0:01:50
      476000 -- [-1976.012] (-1985.339) (-1977.885) (-1980.865) * (-1977.322) [-1980.576] (-1977.985) (-1977.526) -- 0:01:50
      476500 -- (-1979.385) (-1982.587) (-1985.359) [-1978.175] * (-1979.664) [-1971.563] (-1977.722) (-1975.456) -- 0:01:49
      477000 -- (-1974.129) (-1973.031) [-1973.160] (-1975.955) * (-1977.277) [-1975.856] (-1973.199) (-1975.461) -- 0:01:50
      477500 -- [-1970.925] (-1973.728) (-1978.621) (-1980.182) * (-1977.694) (-1977.109) (-1981.634) [-1976.076] -- 0:01:50
      478000 -- (-1974.020) (-1974.894) [-1981.619] (-1978.575) * (-1977.514) (-1974.491) (-1976.355) [-1974.939] -- 0:01:50
      478500 -- (-1978.020) [-1985.032] (-1975.526) (-1977.252) * (-1980.334) (-1975.589) [-1974.941] (-1977.900) -- 0:01:50
      479000 -- [-1972.579] (-1978.167) (-1979.803) (-1979.197) * [-1977.906] (-1973.620) (-1977.484) (-1981.633) -- 0:01:49
      479500 -- (-1979.670) [-1970.691] (-1973.191) (-1973.518) * (-1984.915) (-1974.481) [-1974.777] (-1984.996) -- 0:01:49
      480000 -- (-1979.117) (-1975.177) (-1986.674) [-1974.483] * (-1976.347) (-1986.420) [-1974.140] (-1983.368) -- 0:01:49

      Average standard deviation of split frequencies: 0.000000

      480500 -- (-1980.352) [-1984.633] (-1977.505) (-1977.843) * [-1975.846] (-1980.422) (-1973.897) (-1977.419) -- 0:01:49
      481000 -- (-1974.510) (-1979.670) (-1975.875) [-1970.350] * [-1972.873] (-1979.320) (-1979.717) (-1977.955) -- 0:01:48
      481500 -- (-1985.322) (-1978.400) (-1975.015) [-1976.003] * (-1978.086) [-1982.852] (-1982.080) (-1983.696) -- 0:01:49
      482000 -- (-1974.310) [-1974.392] (-1978.558) (-1978.656) * [-1978.446] (-1984.018) (-1983.086) (-1979.664) -- 0:01:49
      482500 -- (-1977.008) (-1979.412) [-1975.942] (-1981.002) * [-1978.111] (-1978.207) (-1978.121) (-1978.173) -- 0:01:49
      483000 -- (-1971.826) [-1979.034] (-1975.712) (-1981.022) * (-1975.996) [-1972.920] (-1978.028) (-1975.892) -- 0:01:49
      483500 -- (-1977.672) [-1976.269] (-1980.624) (-1979.490) * (-1976.987) (-1974.301) (-1986.200) [-1979.674] -- 0:01:48
      484000 -- (-1977.066) (-1984.082) (-1975.764) [-1972.556] * (-1978.269) (-1974.819) [-1974.230] (-1979.394) -- 0:01:48
      484500 -- (-1988.273) [-1977.536] (-1977.723) (-1974.942) * (-1982.351) (-1975.685) (-1973.802) [-1981.093] -- 0:01:48
      485000 -- (-1977.882) (-1974.768) (-1975.775) [-1972.901] * [-1975.947] (-1980.910) (-1972.966) (-1981.006) -- 0:01:48

      Average standard deviation of split frequencies: 0.000000

      485500 -- (-1971.758) [-1976.023] (-1983.719) (-1971.267) * [-1972.165] (-1981.213) (-1978.128) (-1985.777) -- 0:01:48
      486000 -- (-1973.171) (-1978.170) [-1975.113] (-1980.759) * [-1981.438] (-1981.434) (-1979.207) (-1980.541) -- 0:01:47
      486500 -- (-1980.135) (-1973.050) [-1976.498] (-1978.666) * (-1978.884) [-1976.562] (-1981.309) (-1971.602) -- 0:01:48
      487000 -- (-1977.624) [-1977.181] (-1976.073) (-1976.144) * (-1978.689) [-1978.055] (-1980.610) (-1974.205) -- 0:01:48
      487500 -- (-1975.814) (-1985.535) (-1978.440) [-1976.428] * [-1975.763] (-1979.812) (-1982.269) (-1972.681) -- 0:01:48
      488000 -- (-1973.831) (-1971.960) [-1978.282] (-1974.873) * [-1969.407] (-1974.207) (-1984.183) (-1978.025) -- 0:01:48
      488500 -- (-1977.694) (-1972.743) (-1979.092) [-1977.965] * [-1974.507] (-1979.107) (-1984.537) (-1978.735) -- 0:01:47
      489000 -- [-1979.224] (-1976.789) (-1974.920) (-1980.938) * (-1975.021) (-1979.702) [-1976.419] (-1979.637) -- 0:01:47
      489500 -- [-1976.990] (-1988.634) (-1977.567) (-1972.599) * (-1975.481) [-1975.057] (-1981.263) (-1980.968) -- 0:01:47
      490000 -- (-1982.038) (-1985.096) (-1974.543) [-1972.932] * (-1977.116) (-1975.485) (-1974.631) [-1973.060] -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      490500 -- (-1975.518) (-1977.663) (-1976.202) [-1976.670] * [-1976.778] (-1972.297) (-1974.512) (-1975.662) -- 0:01:46
      491000 -- (-1972.596) (-1979.879) [-1979.124] (-1971.251) * [-1978.879] (-1973.305) (-1976.348) (-1981.325) -- 0:01:47
      491500 -- (-1979.589) (-1975.241) (-1977.397) [-1975.370] * (-1981.675) [-1976.180] (-1981.044) (-1980.967) -- 0:01:47
      492000 -- [-1974.946] (-1975.289) (-1974.237) (-1975.593) * (-1979.134) (-1983.879) (-1978.843) [-1973.824] -- 0:01:47
      492500 -- (-1974.918) [-1973.073] (-1974.500) (-1971.451) * (-1974.445) (-1970.601) [-1977.210] (-1982.157) -- 0:01:47
      493000 -- (-1977.452) [-1976.759] (-1973.382) (-1980.986) * (-1984.020) [-1973.723] (-1975.286) (-1978.304) -- 0:01:46
      493500 -- (-1976.071) (-1978.862) [-1973.436] (-1979.073) * (-1980.016) (-1977.751) [-1975.181] (-1984.084) -- 0:01:46
      494000 -- (-1975.811) (-1984.258) (-1976.969) [-1975.857] * (-1975.168) (-1982.292) (-1977.140) [-1975.855] -- 0:01:46
      494500 -- (-1977.516) (-1981.790) (-1974.620) [-1977.583] * (-1984.564) (-1977.272) (-1980.879) [-1978.628] -- 0:01:46
      495000 -- (-1978.634) (-1978.847) (-1977.927) [-1984.655] * (-1990.286) (-1975.060) (-1973.869) [-1970.015] -- 0:01:46

      Average standard deviation of split frequencies: 0.000000

      495500 -- [-1975.790] (-1979.672) (-1982.099) (-1976.246) * (-1981.860) (-1979.094) (-1979.768) [-1981.000] -- 0:01:45
      496000 -- (-1976.580) (-1975.239) (-1975.233) [-1976.233] * (-1980.313) [-1979.975] (-1983.926) (-1974.526) -- 0:01:46
      496500 -- (-1983.764) (-1976.156) [-1973.407] (-1972.801) * (-1975.753) (-1977.831) [-1981.147] (-1975.050) -- 0:01:46
      497000 -- (-1986.769) [-1978.149] (-1978.099) (-1973.858) * (-1977.564) (-1979.853) [-1977.558] (-1976.004) -- 0:01:46
      497500 -- (-1978.035) [-1976.059] (-1978.649) (-1978.022) * (-1974.277) (-1987.092) (-1977.302) [-1978.312] -- 0:01:46
      498000 -- (-1979.288) (-1976.105) [-1975.229] (-1980.227) * [-1979.490] (-1983.769) (-1974.841) (-1977.652) -- 0:01:45
      498500 -- (-1979.868) (-1975.276) (-1979.014) [-1972.000] * [-1974.697] (-1978.717) (-1975.654) (-1978.368) -- 0:01:45
      499000 -- [-1972.121] (-1976.409) (-1976.840) (-1975.837) * (-1975.748) (-1978.490) [-1976.131] (-1973.489) -- 0:01:45
      499500 -- (-1980.719) [-1973.578] (-1975.384) (-1979.609) * (-1974.182) [-1976.166] (-1976.665) (-1976.023) -- 0:01:45
      500000 -- [-1974.185] (-1980.697) (-1977.783) (-1985.631) * [-1983.092] (-1976.678) (-1979.034) (-1976.069) -- 0:01:45

      Average standard deviation of split frequencies: 0.000000

      500500 -- (-1972.747) (-1976.554) [-1977.306] (-1982.018) * (-1981.850) [-1985.139] (-1974.200) (-1978.003) -- 0:01:45
      501000 -- (-1975.790) (-1979.360) (-1977.949) [-1976.433] * [-1975.787] (-1979.294) (-1972.674) (-1974.907) -- 0:01:45
      501500 -- (-1973.228) [-1977.389] (-1977.590) (-1975.235) * (-1978.943) [-1975.079] (-1974.559) (-1977.925) -- 0:01:45
      502000 -- (-1976.551) (-1975.614) (-1976.565) [-1976.174] * (-1980.029) (-1980.728) [-1975.994] (-1974.814) -- 0:01:45
      502500 -- (-1978.410) [-1976.247] (-1973.183) (-1973.786) * [-1975.216] (-1975.621) (-1975.247) (-1972.075) -- 0:01:44
      503000 -- (-1974.304) [-1977.935] (-1976.337) (-1976.932) * (-1973.982) [-1972.101] (-1980.278) (-1979.120) -- 0:01:44
      503500 -- (-1973.216) (-1977.817) (-1982.633) [-1975.446] * [-1977.673] (-1978.814) (-1984.030) (-1983.849) -- 0:01:44
      504000 -- [-1970.423] (-1980.231) (-1978.649) (-1979.582) * (-1974.167) (-1974.514) [-1975.728] (-1977.984) -- 0:01:44
      504500 -- (-1977.084) (-1977.599) (-1986.365) [-1981.619] * (-1982.188) (-1973.936) [-1973.964] (-1971.521) -- 0:01:44
      505000 -- (-1983.571) [-1976.511] (-1977.258) (-1973.396) * (-1980.581) (-1975.019) [-1973.563] (-1976.850) -- 0:01:43

      Average standard deviation of split frequencies: 0.000000

      505500 -- (-1981.445) [-1971.083] (-1978.544) (-1976.064) * (-1975.534) (-1977.435) [-1976.301] (-1978.094) -- 0:01:44
      506000 -- (-1975.568) [-1981.239] (-1975.812) (-1984.459) * (-1973.310) [-1974.649] (-1975.136) (-1973.914) -- 0:01:44
      506500 -- (-1980.785) (-1975.722) (-1979.513) [-1979.099] * (-1976.146) (-1972.007) (-1979.048) [-1983.896] -- 0:01:44
      507000 -- (-1975.867) (-1983.723) [-1972.173] (-1984.482) * (-1978.285) [-1975.032] (-1977.293) (-1984.892) -- 0:01:44
      507500 -- (-1979.066) (-1981.663) (-1970.117) [-1975.734] * (-1974.387) (-1978.443) [-1977.716] (-1976.336) -- 0:01:43
      508000 -- [-1982.769] (-1976.462) (-1982.230) (-1974.343) * (-1980.413) (-1978.268) [-1971.974] (-1980.503) -- 0:01:43
      508500 -- [-1976.394] (-1978.611) (-1972.604) (-1975.945) * (-1978.634) [-1973.419] (-1974.784) (-1979.885) -- 0:01:43
      509000 -- [-1971.583] (-1979.631) (-1974.436) (-1983.580) * [-1973.943] (-1978.442) (-1975.734) (-1979.271) -- 0:01:43
      509500 -- (-1973.496) (-1977.003) (-1980.065) [-1976.424] * [-1972.818] (-1974.163) (-1971.200) (-1979.598) -- 0:01:43
      510000 -- (-1975.072) (-1979.856) (-1969.767) [-1975.149] * (-1976.045) (-1974.866) [-1975.901] (-1974.565) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      510500 -- [-1978.230] (-1981.649) (-1980.808) (-1972.952) * (-1970.984) [-1977.180] (-1977.279) (-1978.552) -- 0:01:43
      511000 -- [-1977.324] (-1977.586) (-1976.066) (-1975.602) * (-1979.432) (-1975.010) [-1975.573] (-1979.881) -- 0:01:43
      511500 -- (-1974.444) [-1979.308] (-1976.372) (-1972.786) * [-1971.643] (-1977.089) (-1977.592) (-1978.614) -- 0:01:43
      512000 -- (-1974.074) [-1980.774] (-1972.768) (-1977.021) * (-1978.314) (-1975.109) (-1976.576) [-1983.415] -- 0:01:42
      512500 -- [-1973.117] (-1985.151) (-1979.279) (-1974.847) * (-1971.862) [-1974.792] (-1978.361) (-1977.273) -- 0:01:42
      513000 -- (-1975.556) (-1985.914) (-1977.265) [-1976.634] * (-1977.090) (-1973.981) (-1973.602) [-1974.865] -- 0:01:42
      513500 -- [-1973.124] (-1980.844) (-1977.794) (-1978.255) * (-1978.211) (-1978.920) [-1979.162] (-1972.946) -- 0:01:42
      514000 -- [-1978.441] (-1984.659) (-1980.576) (-1974.964) * (-1974.117) (-1978.274) [-1981.016] (-1971.714) -- 0:01:42
      514500 -- (-1976.985) (-1973.293) (-1974.056) [-1979.187] * (-1975.606) (-1979.602) (-1978.980) [-1971.733] -- 0:01:41
      515000 -- [-1974.568] (-1981.480) (-1968.888) (-1980.402) * (-1977.782) [-1983.517] (-1980.527) (-1975.271) -- 0:01:42

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-1974.192) (-1976.693) [-1973.192] (-1977.622) * (-1977.505) (-1976.030) [-1974.764] (-1979.346) -- 0:01:42
      516000 -- (-1973.171) [-1974.310] (-1979.999) (-1980.513) * (-1978.550) [-1976.220] (-1974.686) (-1973.927) -- 0:01:42
      516500 -- (-1978.584) [-1974.653] (-1981.833) (-1975.553) * (-1981.831) (-1976.738) (-1982.646) [-1974.573] -- 0:01:42
      517000 -- (-1975.870) [-1976.068] (-1978.492) (-1981.294) * [-1980.307] (-1975.153) (-1980.976) (-1990.234) -- 0:01:41
      517500 -- (-1978.553) [-1972.937] (-1979.091) (-1984.518) * (-1978.585) (-1979.994) [-1974.244] (-1976.225) -- 0:01:41
      518000 -- (-1978.324) [-1973.798] (-1974.701) (-1980.814) * (-1982.703) (-1977.100) (-1979.962) [-1977.227] -- 0:01:41
      518500 -- [-1976.682] (-1978.098) (-1978.626) (-1978.170) * (-1977.379) (-1978.363) (-1974.616) [-1977.169] -- 0:01:41
      519000 -- [-1971.313] (-1973.625) (-1975.972) (-1976.432) * (-1974.169) (-1977.853) (-1975.984) [-1976.111] -- 0:01:41
      519500 -- (-1978.504) (-1976.423) (-1976.606) [-1980.932] * (-1977.640) (-1975.836) (-1972.796) [-1974.497] -- 0:01:40
      520000 -- (-1970.213) [-1971.608] (-1984.141) (-1975.848) * (-1974.919) (-1977.949) (-1979.878) [-1977.077] -- 0:01:41

      Average standard deviation of split frequencies: 0.000000

      520500 -- (-1979.317) (-1973.666) [-1976.965] (-1976.079) * [-1977.119] (-1976.587) (-1980.108) (-1974.408) -- 0:01:41
      521000 -- (-1976.051) (-1970.266) [-1975.867] (-1977.558) * [-1970.467] (-1978.110) (-1986.582) (-1978.978) -- 0:01:41
      521500 -- [-1973.847] (-1973.304) (-1978.580) (-1971.973) * (-1973.591) (-1974.581) (-1978.741) [-1975.211] -- 0:01:40
      522000 -- (-1980.935) [-1976.295] (-1969.772) (-1973.752) * (-1976.665) (-1981.907) (-1976.064) [-1972.541] -- 0:01:40
      522500 -- (-1977.515) (-1978.622) [-1974.221] (-1973.301) * (-1975.485) (-1977.114) [-1973.946] (-1979.873) -- 0:01:40
      523000 -- (-1974.743) (-1976.397) (-1975.340) [-1976.633] * (-1975.592) [-1980.188] (-1992.493) (-1979.675) -- 0:01:40
      523500 -- (-1986.970) (-1975.332) [-1979.059] (-1980.306) * (-1977.617) [-1980.682] (-1973.211) (-1984.268) -- 0:01:40
      524000 -- [-1973.303] (-1979.840) (-1977.974) (-1978.936) * (-1974.590) [-1975.210] (-1978.397) (-1973.769) -- 0:01:39
      524500 -- [-1983.216] (-1981.182) (-1980.969) (-1977.185) * (-1973.009) (-1975.700) [-1975.808] (-1972.203) -- 0:01:40
      525000 -- (-1976.451) [-1977.590] (-1977.762) (-1978.335) * (-1976.478) (-1977.447) [-1974.411] (-1979.089) -- 0:01:40

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-1976.665) (-1977.225) [-1979.835] (-1979.587) * (-1978.751) [-1977.029] (-1975.824) (-1976.530) -- 0:01:40
      526000 -- (-1979.653) [-1972.786] (-1982.061) (-1979.025) * (-1974.607) [-1975.577] (-1979.819) (-1978.250) -- 0:01:40
      526500 -- (-1984.711) (-1973.068) [-1979.972] (-1979.538) * (-1979.012) (-1972.480) (-1982.310) [-1972.815] -- 0:01:39
      527000 -- [-1980.308] (-1978.189) (-1977.359) (-1978.655) * [-1984.759] (-1974.178) (-1980.782) (-1979.269) -- 0:01:39
      527500 -- (-1984.520) [-1977.146] (-1985.053) (-1981.744) * (-1979.863) [-1977.395] (-1979.404) (-1980.126) -- 0:01:39
      528000 -- (-1978.859) (-1972.509) (-1972.704) [-1976.073] * (-1976.341) (-1976.955) [-1979.286] (-1975.300) -- 0:01:39
      528500 -- (-1978.867) [-1973.993] (-1979.291) (-1976.035) * (-1972.579) (-1980.661) [-1976.573] (-1975.474) -- 0:01:39
      529000 -- (-1981.514) (-1974.309) [-1974.648] (-1974.450) * (-1980.588) [-1979.090] (-1980.978) (-1982.994) -- 0:01:38
      529500 -- [-1980.349] (-1976.144) (-1976.748) (-1979.455) * (-1975.073) [-1973.938] (-1976.826) (-1976.787) -- 0:01:39
      530000 -- (-1979.861) (-1984.108) [-1976.659] (-1973.724) * (-1981.107) (-1975.059) [-1979.892] (-1974.876) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      530500 -- (-1982.219) (-1976.977) [-1972.024] (-1978.556) * [-1977.614] (-1976.638) (-1973.838) (-1981.849) -- 0:01:39
      531000 -- (-1975.276) [-1973.463] (-1981.348) (-1972.933) * (-1976.294) (-1972.626) (-1980.268) [-1971.904] -- 0:01:38
      531500 -- (-1987.520) (-1976.301) (-1976.764) [-1975.833] * [-1977.176] (-1970.493) (-1976.094) (-1977.747) -- 0:01:38
      532000 -- (-1973.055) (-1977.441) [-1973.331] (-1975.027) * (-1974.376) (-1975.350) (-1976.076) [-1976.010] -- 0:01:38
      532500 -- (-1970.817) [-1975.453] (-1982.040) (-1978.408) * (-1975.498) (-1972.259) (-1980.691) [-1977.409] -- 0:01:38
      533000 -- [-1971.960] (-1974.609) (-1972.256) (-1982.609) * (-1976.613) (-1975.244) [-1980.820] (-1973.269) -- 0:01:38
      533500 -- [-1975.459] (-1982.760) (-1973.177) (-1977.391) * (-1977.174) (-1972.921) (-1977.180) [-1972.303] -- 0:01:37
      534000 -- (-1971.707) (-1983.582) (-1972.265) [-1974.440] * (-1979.755) (-1977.841) (-1975.202) [-1976.072] -- 0:01:37
      534500 -- [-1974.949] (-1981.498) (-1975.683) (-1979.185) * (-1976.384) (-1973.562) (-1979.236) [-1979.555] -- 0:01:38
      535000 -- [-1973.457] (-1976.483) (-1979.002) (-1978.967) * (-1971.297) [-1972.507] (-1983.426) (-1976.398) -- 0:01:38

      Average standard deviation of split frequencies: 0.000000

      535500 -- [-1975.253] (-1976.573) (-1978.648) (-1977.116) * (-1977.888) (-1980.967) (-1979.354) [-1976.373] -- 0:01:38
      536000 -- (-1971.001) (-1975.248) (-1983.137) [-1979.770] * (-1978.879) (-1973.466) (-1985.359) [-1972.444] -- 0:01:37
      536500 -- (-1981.992) (-1980.047) (-1976.199) [-1974.555] * (-1978.424) (-1979.264) [-1977.570] (-1974.902) -- 0:01:37
      537000 -- [-1975.093] (-1975.438) (-1977.277) (-1975.904) * (-1972.565) [-1970.409] (-1975.317) (-1986.167) -- 0:01:37
      537500 -- (-1980.061) (-1975.918) [-1978.214] (-1974.950) * (-1979.693) [-1970.597] (-1981.269) (-1987.048) -- 0:01:37
      538000 -- [-1977.718] (-1974.118) (-1976.664) (-1976.621) * (-1981.972) (-1975.105) (-1978.365) [-1977.911] -- 0:01:37
      538500 -- [-1975.756] (-1977.005) (-1973.036) (-1976.904) * (-1978.565) (-1975.341) [-1972.294] (-1974.985) -- 0:01:36
      539000 -- (-1979.394) [-1975.473] (-1978.293) (-1979.176) * [-1974.310] (-1973.869) (-1982.719) (-1974.286) -- 0:01:37
      539500 -- (-1973.938) [-1973.203] (-1974.343) (-1980.861) * (-1975.669) (-1978.442) (-1976.305) [-1978.565] -- 0:01:37
      540000 -- (-1980.768) (-1977.821) [-1978.590] (-1973.760) * (-1978.900) (-1980.144) (-1972.889) [-1974.709] -- 0:01:37

      Average standard deviation of split frequencies: 0.000000

      540500 -- (-1975.479) (-1979.110) (-1974.379) [-1974.462] * [-1977.871] (-1981.653) (-1975.427) (-1980.152) -- 0:01:36
      541000 -- (-1983.462) [-1976.367] (-1975.747) (-1976.783) * (-1975.716) (-1976.866) [-1977.593] (-1986.798) -- 0:01:36
      541500 -- (-1976.989) (-1980.790) (-1973.411) [-1981.611] * (-1982.869) [-1975.702] (-1976.125) (-1977.605) -- 0:01:36
      542000 -- (-1973.932) (-1977.337) (-1972.111) [-1977.883] * [-1975.147] (-1978.391) (-1975.203) (-1974.461) -- 0:01:36
      542500 -- [-1973.158] (-1973.232) (-1975.407) (-1982.249) * (-1972.205) [-1973.353] (-1977.979) (-1979.295) -- 0:01:36
      543000 -- (-1976.942) (-1980.663) [-1974.488] (-1972.335) * (-1979.998) (-1977.817) (-1978.032) [-1978.655] -- 0:01:35
      543500 -- [-1969.700] (-1975.207) (-1978.114) (-1973.611) * [-1977.757] (-1977.565) (-1974.340) (-1972.755) -- 0:01:36
      544000 -- [-1972.092] (-1974.769) (-1981.418) (-1977.397) * (-1979.094) (-1981.757) (-1974.548) [-1977.786] -- 0:01:36
      544500 -- (-1971.498) [-1981.436] (-1984.487) (-1979.722) * [-1979.204] (-1977.373) (-1976.758) (-1985.104) -- 0:01:36
      545000 -- [-1973.425] (-1988.593) (-1981.466) (-1975.305) * (-1981.258) [-1979.126] (-1987.610) (-1975.737) -- 0:01:36

      Average standard deviation of split frequencies: 0.000000

      545500 -- (-1979.360) (-1987.160) (-1977.477) [-1976.173] * [-1977.068] (-1978.378) (-1974.507) (-1987.205) -- 0:01:35
      546000 -- [-1975.612] (-1983.511) (-1980.708) (-1975.313) * (-1977.671) (-1981.469) [-1978.735] (-1981.562) -- 0:01:35
      546500 -- [-1974.370] (-1983.402) (-1979.148) (-1973.233) * [-1971.683] (-1977.799) (-1983.985) (-1979.377) -- 0:01:35
      547000 -- (-1973.808) (-1974.982) (-1978.087) [-1975.001] * [-1978.034] (-1981.699) (-1977.296) (-1977.808) -- 0:01:35
      547500 -- (-1972.782) (-1974.739) (-1980.013) [-1978.416] * [-1970.172] (-1983.612) (-1984.721) (-1979.926) -- 0:01:35
      548000 -- (-1970.905) (-1976.813) [-1974.089] (-1975.637) * (-1973.227) [-1977.888] (-1978.962) (-1973.204) -- 0:01:34
      548500 -- (-1977.486) (-1982.095) (-1982.906) [-1974.533] * [-1974.367] (-1975.731) (-1980.472) (-1975.187) -- 0:01:35
      549000 -- (-1973.396) (-1974.208) [-1975.484] (-1981.571) * (-1978.775) (-1974.790) [-1974.628] (-1977.853) -- 0:01:35
      549500 -- (-1981.496) (-1976.413) (-1981.203) [-1979.893] * (-1978.650) (-1984.297) (-1974.629) [-1975.973] -- 0:01:35
      550000 -- (-1983.322) (-1978.103) [-1976.309] (-1981.059) * (-1980.290) (-1977.916) [-1975.332] (-1974.644) -- 0:01:34

      Average standard deviation of split frequencies: 0.000000

      550500 -- [-1977.991] (-1984.621) (-1972.084) (-1973.449) * (-1978.085) (-1977.144) [-1981.045] (-1976.599) -- 0:01:34
      551000 -- (-1977.897) [-1977.165] (-1975.799) (-1973.077) * [-1975.142] (-1977.225) (-1976.008) (-1973.622) -- 0:01:34
      551500 -- (-1982.319) (-1975.413) [-1971.548] (-1980.005) * (-1979.216) (-1975.395) (-1982.891) [-1970.572] -- 0:01:34
      552000 -- [-1976.721] (-1977.343) (-1976.661) (-1972.658) * (-1975.781) (-1974.853) [-1976.971] (-1972.396) -- 0:01:34
      552500 -- (-1976.289) (-1976.209) (-1974.123) [-1975.103] * (-1969.657) (-1973.218) [-1978.617] (-1973.194) -- 0:01:33
      553000 -- (-1978.140) (-1973.209) (-1977.629) [-1978.090] * (-1980.922) [-1977.016] (-1972.883) (-1973.830) -- 0:01:33
      553500 -- [-1977.386] (-1970.730) (-1987.920) (-1973.417) * (-1976.435) (-1975.820) [-1976.522] (-1971.873) -- 0:01:34
      554000 -- [-1977.303] (-1981.222) (-1975.577) (-1978.204) * [-1973.071] (-1974.570) (-1978.753) (-1982.675) -- 0:01:34
      554500 -- (-1973.854) (-1975.555) [-1972.280] (-1980.151) * (-1975.299) (-1972.986) [-1973.523] (-1980.259) -- 0:01:34
      555000 -- (-1972.061) (-1973.760) (-1980.364) [-1979.816] * (-1980.022) [-1974.592] (-1977.890) (-1978.363) -- 0:01:33

      Average standard deviation of split frequencies: 0.000000

      555500 -- [-1973.348] (-1977.934) (-1979.386) (-1969.606) * (-1989.854) (-1983.605) [-1973.506] (-1978.273) -- 0:01:33
      556000 -- [-1980.560] (-1973.525) (-1988.161) (-1975.048) * (-1976.102) [-1976.287] (-1985.622) (-1974.088) -- 0:01:33
      556500 -- (-1979.894) [-1974.481] (-1977.308) (-1975.004) * [-1973.649] (-1977.469) (-1980.521) (-1979.412) -- 0:01:33
      557000 -- (-1981.418) [-1979.791] (-1975.708) (-1979.972) * (-1975.722) (-1973.686) (-1977.866) [-1979.685] -- 0:01:33
      557500 -- (-1973.298) (-1970.479) (-1973.505) [-1974.751] * (-1982.087) [-1974.279] (-1982.933) (-1986.760) -- 0:01:32
      558000 -- [-1975.456] (-1982.487) (-1978.921) (-1983.905) * (-1979.263) [-1978.126] (-1979.320) (-1981.206) -- 0:01:33
      558500 -- (-1978.252) (-1984.576) [-1974.333] (-1976.338) * (-1980.335) (-1977.741) [-1975.786] (-1986.145) -- 0:01:33
      559000 -- (-1978.078) [-1974.851] (-1979.783) (-1975.030) * [-1972.814] (-1975.431) (-1974.811) (-1976.406) -- 0:01:33
      559500 -- (-1975.806) (-1975.175) [-1978.958] (-1976.741) * (-1975.415) (-1976.377) [-1973.707] (-1982.522) -- 0:01:32
      560000 -- [-1976.156] (-1980.957) (-1975.837) (-1979.223) * (-1974.103) (-1977.161) [-1975.817] (-1976.233) -- 0:01:32

      Average standard deviation of split frequencies: 0.000000

      560500 -- (-1975.298) [-1972.918] (-1979.166) (-1980.978) * (-1976.817) (-1979.844) (-1977.112) [-1974.017] -- 0:01:32
      561000 -- (-1986.329) [-1971.826] (-1971.781) (-1973.669) * (-1979.032) (-1981.796) (-1974.400) [-1973.911] -- 0:01:32
      561500 -- (-1977.645) (-1972.875) (-1980.266) [-1973.279] * [-1975.596] (-1976.846) (-1979.209) (-1974.369) -- 0:01:32
      562000 -- [-1976.542] (-1974.420) (-1977.282) (-1979.489) * (-1974.836) [-1980.171] (-1983.366) (-1984.554) -- 0:01:31
      562500 -- [-1981.428] (-1978.311) (-1980.853) (-1979.719) * (-1981.520) [-1975.612] (-1976.972) (-1987.532) -- 0:01:31
      563000 -- (-1975.094) (-1970.620) (-1982.775) [-1980.827] * [-1973.621] (-1979.615) (-1980.287) (-1980.221) -- 0:01:32
      563500 -- [-1978.137] (-1975.931) (-1977.578) (-1977.178) * [-1976.145] (-1976.574) (-1976.858) (-1976.926) -- 0:01:32
      564000 -- (-1977.318) (-1976.364) (-1978.772) [-1975.944] * [-1975.930] (-1979.075) (-1976.443) (-1975.840) -- 0:01:31
      564500 -- (-1979.406) (-1970.179) (-1978.234) [-1983.667] * (-1982.745) (-1969.401) [-1971.806] (-1972.648) -- 0:01:31
      565000 -- (-1975.410) (-1983.984) (-1976.454) [-1986.978] * (-1976.549) (-1979.566) [-1972.438] (-1975.802) -- 0:01:31

      Average standard deviation of split frequencies: 0.000000

      565500 -- (-1976.432) [-1973.480] (-1974.289) (-1978.824) * (-1976.469) (-1988.714) (-1978.406) [-1975.947] -- 0:01:31
      566000 -- (-1978.755) (-1976.075) [-1975.258] (-1974.658) * (-1974.786) (-1983.157) (-1973.760) [-1975.727] -- 0:01:31
      566500 -- (-1983.143) (-1972.019) [-1974.942] (-1973.979) * (-1976.987) [-1978.300] (-1985.643) (-1977.178) -- 0:01:31
      567000 -- (-1977.570) [-1973.489] (-1980.831) (-1983.998) * (-1975.380) [-1976.163] (-1976.975) (-1977.014) -- 0:01:30
      567500 -- (-1978.758) (-1977.607) [-1978.000] (-1983.002) * (-1978.341) (-1976.104) [-1971.526] (-1975.464) -- 0:01:31
      568000 -- (-1976.102) (-1971.521) [-1974.385] (-1988.462) * (-1979.680) [-1977.006] (-1978.920) (-1975.815) -- 0:01:31
      568500 -- (-1976.605) (-1972.383) (-1978.915) [-1972.321] * (-1980.415) (-1994.534) (-1976.577) [-1974.178] -- 0:01:31
      569000 -- [-1973.139] (-1977.374) (-1980.125) (-1974.015) * [-1977.171] (-1979.788) (-1972.653) (-1973.537) -- 0:01:30
      569500 -- (-1974.711) [-1971.309] (-1983.584) (-1979.752) * (-1980.050) (-1972.466) [-1979.611] (-1974.797) -- 0:01:30
      570000 -- (-1975.846) (-1978.109) (-1973.977) [-1977.552] * (-1977.054) [-1972.607] (-1974.293) (-1973.756) -- 0:01:30

      Average standard deviation of split frequencies: 0.000000

      570500 -- [-1978.531] (-1977.244) (-1976.012) (-1974.420) * (-1984.329) (-1971.217) [-1981.728] (-1974.936) -- 0:01:30
      571000 -- (-1975.463) [-1973.053] (-1975.681) (-1972.733) * (-1979.221) (-1975.150) [-1973.381] (-1978.780) -- 0:01:30
      571500 -- (-1980.652) (-1975.603) (-1978.257) [-1974.449] * (-1976.580) (-1974.154) [-1978.183] (-1975.276) -- 0:01:29
      572000 -- [-1976.593] (-1986.786) (-1980.327) (-1976.819) * (-1975.050) [-1977.864] (-1974.510) (-1972.615) -- 0:01:29
      572500 -- (-1974.758) [-1975.505] (-1986.071) (-1979.258) * [-1978.916] (-1980.668) (-1976.626) (-1973.850) -- 0:01:30
      573000 -- (-1975.085) [-1971.956] (-1976.786) (-1977.442) * (-1977.030) (-1981.867) (-1976.099) [-1975.622] -- 0:01:30
      573500 -- [-1973.803] (-1977.815) (-1977.940) (-1982.823) * (-1979.368) (-1988.723) (-1978.498) [-1976.234] -- 0:01:29
      574000 -- (-1976.798) (-1974.960) [-1977.483] (-1985.396) * [-1975.624] (-1975.799) (-1971.228) (-1976.289) -- 0:01:29
      574500 -- (-1983.262) (-1977.223) (-1973.870) [-1977.620] * (-1972.970) (-1974.804) [-1971.412] (-1973.929) -- 0:01:29
      575000 -- (-1979.312) (-1980.776) (-1976.517) [-1972.878] * (-1975.562) (-1981.092) (-1975.638) [-1974.621] -- 0:01:29

      Average standard deviation of split frequencies: 0.000000

      575500 -- (-1980.047) (-1977.918) [-1976.343] (-1976.326) * (-1977.259) (-1974.067) (-1975.254) [-1973.712] -- 0:01:29
      576000 -- [-1983.865] (-1979.661) (-1976.468) (-1976.939) * (-1976.886) (-1980.159) [-1975.426] (-1973.013) -- 0:01:29
      576500 -- (-1976.681) (-1981.247) (-1972.262) [-1981.219] * [-1974.210] (-1980.791) (-1972.253) (-1977.098) -- 0:01:28
      577000 -- (-1977.969) (-1978.019) [-1979.460] (-1980.411) * (-1983.140) [-1978.563] (-1976.940) (-1976.698) -- 0:01:29
      577500 -- [-1981.613] (-1978.195) (-1977.986) (-1980.392) * (-1974.644) [-1978.500] (-1976.099) (-1977.915) -- 0:01:29
      578000 -- [-1986.159] (-1977.729) (-1978.343) (-1978.203) * (-1983.396) (-1978.095) [-1978.747] (-1976.471) -- 0:01:29
      578500 -- (-1988.038) (-1981.618) (-1979.705) [-1982.391] * (-1978.771) (-1978.051) [-1976.348] (-1975.382) -- 0:01:28
      579000 -- (-1974.709) [-1978.850] (-1981.494) (-1978.588) * (-1973.171) (-1972.980) [-1975.041] (-1983.501) -- 0:01:28
      579500 -- (-1981.575) [-1977.436] (-1975.930) (-1975.406) * (-1975.561) (-1972.691) (-1973.359) [-1974.603] -- 0:01:28
      580000 -- (-1984.185) (-1975.842) (-1982.485) [-1973.833] * (-1979.818) (-1977.196) (-1973.141) [-1981.562] -- 0:01:28

      Average standard deviation of split frequencies: 0.000000

      580500 -- [-1978.155] (-1978.462) (-1973.326) (-1973.466) * (-1978.418) (-1975.661) [-1980.991] (-1974.524) -- 0:01:28
      581000 -- (-1977.920) [-1972.736] (-1978.691) (-1975.103) * (-1983.629) (-1977.531) [-1976.267] (-1977.889) -- 0:01:27
      581500 -- (-1978.977) (-1974.247) (-1974.425) [-1972.574] * (-1977.123) (-1981.166) (-1976.290) [-1974.027] -- 0:01:27
      582000 -- (-1974.082) (-1987.244) [-1976.621] (-1978.470) * (-1984.300) (-1973.089) [-1974.117] (-1975.811) -- 0:01:28
      582500 -- [-1971.470] (-1976.534) (-1979.506) (-1973.418) * (-1980.221) (-1974.944) [-1974.421] (-1976.128) -- 0:01:28
      583000 -- (-1977.035) (-1981.174) [-1973.361] (-1971.419) * (-1974.832) (-1972.098) [-1977.032] (-1981.321) -- 0:01:27
      583500 -- (-1975.124) [-1975.342] (-1976.941) (-1981.191) * (-1975.013) (-1980.369) (-1978.458) [-1976.259] -- 0:01:27
      584000 -- (-1977.985) (-1983.153) [-1975.051] (-1976.785) * (-1977.800) [-1980.475] (-1975.475) (-1976.814) -- 0:01:27
      584500 -- (-1978.098) [-1982.561] (-1981.280) (-1977.405) * (-1979.509) [-1974.024] (-1982.081) (-1977.966) -- 0:01:27
      585000 -- [-1978.220] (-1982.715) (-1976.197) (-1981.087) * (-1975.187) (-1973.309) [-1975.058] (-1977.098) -- 0:01:27

      Average standard deviation of split frequencies: 0.000000

      585500 -- (-1975.784) (-1981.726) [-1972.506] (-1981.203) * (-1975.174) [-1975.195] (-1978.960) (-1974.210) -- 0:01:27
      586000 -- [-1977.724] (-1981.264) (-1973.288) (-1975.892) * (-1978.210) (-1972.916) [-1975.085] (-1978.584) -- 0:01:26
      586500 -- (-1975.288) [-1971.689] (-1979.721) (-1977.851) * (-1976.894) (-1974.354) [-1977.185] (-1981.736) -- 0:01:26
      587000 -- (-1979.687) (-1972.653) [-1974.793] (-1973.331) * (-1978.635) [-1972.537] (-1978.106) (-1984.461) -- 0:01:27
      587500 -- (-1971.369) (-1981.275) [-1976.353] (-1980.725) * (-1977.289) [-1976.486] (-1982.940) (-1983.009) -- 0:01:27
      588000 -- [-1975.554] (-1976.213) (-1978.373) (-1977.751) * (-1985.938) [-1972.590] (-1981.399) (-1987.429) -- 0:01:26
      588500 -- (-1983.007) [-1977.943] (-1977.953) (-1981.029) * (-1977.581) (-1980.019) (-1982.678) [-1982.948] -- 0:01:26
      589000 -- (-1981.310) [-1974.560] (-1971.458) (-1979.363) * (-1978.948) [-1979.184] (-1971.916) (-1993.127) -- 0:01:26
      589500 -- (-1973.155) (-1979.323) [-1977.358] (-1985.055) * [-1972.533] (-1987.390) (-1983.676) (-1982.528) -- 0:01:26
      590000 -- (-1978.752) (-1978.123) [-1978.146] (-1978.138) * (-1973.527) [-1974.850] (-1980.021) (-1982.892) -- 0:01:26

      Average standard deviation of split frequencies: 0.000000

      590500 -- (-1977.179) (-1976.238) [-1976.527] (-1983.516) * (-1972.628) (-1973.643) (-1978.998) [-1979.973] -- 0:01:25
      591000 -- (-1975.872) [-1974.233] (-1973.759) (-1974.829) * (-1977.414) (-1976.496) [-1975.792] (-1977.297) -- 0:01:25
      591500 -- (-1982.150) (-1974.009) (-1972.590) [-1972.390] * [-1981.787] (-1982.255) (-1979.220) (-1978.328) -- 0:01:26
      592000 -- (-1976.610) (-1979.933) [-1975.709] (-1977.244) * (-1975.813) (-1975.559) (-1975.561) [-1974.407] -- 0:01:26
      592500 -- (-1980.564) (-1987.047) [-1973.335] (-1973.535) * [-1970.904] (-1975.558) (-1979.827) (-1973.915) -- 0:01:25
      593000 -- (-1976.681) (-1974.418) [-1978.556] (-1979.324) * (-1980.790) [-1973.406] (-1982.635) (-1975.909) -- 0:01:25
      593500 -- (-1983.109) (-1977.411) (-1978.014) [-1972.663] * (-1978.495) [-1974.041] (-1975.799) (-1971.902) -- 0:01:25
      594000 -- [-1978.310] (-1975.218) (-1976.016) (-1981.500) * (-1975.903) (-1976.135) (-1980.227) [-1979.646] -- 0:01:25
      594500 -- (-1974.020) (-1972.998) [-1978.382] (-1986.798) * (-1980.137) (-1977.672) (-1990.458) [-1981.188] -- 0:01:25
      595000 -- [-1973.058] (-1978.065) (-1983.205) (-1978.360) * (-1977.043) (-1979.717) (-1976.204) [-1977.542] -- 0:01:25

      Average standard deviation of split frequencies: 0.000000

      595500 -- (-1976.364) (-1975.735) [-1976.499] (-1979.223) * (-1973.099) [-1978.710] (-1981.856) (-1974.777) -- 0:01:24
      596000 -- (-1978.157) (-1976.634) (-1978.782) [-1973.065] * (-1977.957) (-1978.600) [-1976.877] (-1979.151) -- 0:01:24
      596500 -- [-1976.993] (-1983.225) (-1979.050) (-1971.889) * (-1982.484) (-1973.491) [-1975.338] (-1980.452) -- 0:01:25
      597000 -- (-1974.191) [-1974.917] (-1982.720) (-1971.867) * (-1979.963) (-1979.079) (-1973.417) [-1972.317] -- 0:01:25
      597500 -- (-1977.326) (-1974.046) (-1979.701) [-1970.006] * (-1976.720) (-1975.735) (-1976.333) [-1973.321] -- 0:01:24
      598000 -- (-1980.582) [-1978.143] (-1980.297) (-1977.671) * (-1976.299) (-1975.316) (-1977.852) [-1975.738] -- 0:01:24
      598500 -- (-1979.685) (-1972.223) (-1983.764) [-1979.204] * (-1975.855) (-1973.861) [-1974.849] (-1984.674) -- 0:01:24
      599000 -- (-1982.240) [-1972.199] (-1971.835) (-1977.933) * (-1976.630) [-1975.433] (-1981.079) (-1978.224) -- 0:01:24
      599500 -- [-1985.864] (-1976.647) (-1974.444) (-1974.857) * (-1973.974) [-1978.426] (-1976.335) (-1978.027) -- 0:01:24
      600000 -- (-1981.418) (-1971.792) [-1975.726] (-1978.361) * (-1972.669) [-1979.431] (-1975.980) (-1982.846) -- 0:01:24

      Average standard deviation of split frequencies: 0.000000

      600500 -- (-1977.518) (-1977.251) (-1977.285) [-1981.395] * [-1974.310] (-1982.961) (-1978.820) (-1981.494) -- 0:01:23
      601000 -- (-1978.410) (-1976.111) [-1978.452] (-1984.478) * (-1976.243) (-1974.290) [-1977.267] (-1977.923) -- 0:01:24
      601500 -- (-1974.371) (-1978.730) [-1973.451] (-1977.234) * [-1975.556] (-1974.987) (-1974.910) (-1981.063) -- 0:01:24
      602000 -- (-1986.716) [-1975.254] (-1977.236) (-1972.353) * (-1973.447) (-1978.861) [-1974.852] (-1980.380) -- 0:01:23
      602500 -- (-1978.842) [-1973.847] (-1976.245) (-1972.453) * (-1983.640) [-1975.652] (-1978.817) (-1975.435) -- 0:01:23
      603000 -- (-1984.253) (-1982.216) (-1984.226) [-1971.358] * (-1976.116) (-1975.878) (-1977.379) [-1978.392] -- 0:01:23
      603500 -- (-1990.903) [-1974.088] (-1971.083) (-1977.504) * (-1977.272) (-1975.149) [-1973.647] (-1976.592) -- 0:01:23
      604000 -- [-1976.368] (-1979.043) (-1976.509) (-1972.248) * [-1979.953] (-1972.525) (-1979.732) (-1980.207) -- 0:01:23
      604500 -- (-1980.441) [-1981.330] (-1980.937) (-1973.458) * (-1977.090) [-1971.465] (-1980.957) (-1978.399) -- 0:01:23
      605000 -- (-1983.561) [-1977.973] (-1973.829) (-1980.400) * [-1978.019] (-1974.038) (-1981.830) (-1979.942) -- 0:01:22

      Average standard deviation of split frequencies: 0.000000

      605500 -- (-1982.714) [-1975.385] (-1976.456) (-1980.519) * (-1973.936) (-1980.599) (-1975.596) [-1976.051] -- 0:01:22
      606000 -- (-1981.933) [-1981.549] (-1976.640) (-1978.281) * (-1974.913) [-1974.395] (-1976.909) (-1974.448) -- 0:01:23
      606500 -- (-1979.078) (-1978.950) (-1975.368) [-1974.913] * (-1978.092) (-1979.514) [-1978.642] (-1978.383) -- 0:01:23
      607000 -- (-1973.121) [-1974.626] (-1985.072) (-1976.719) * (-1978.893) [-1975.721] (-1978.885) (-1974.883) -- 0:01:22
      607500 -- (-1974.791) (-1977.486) [-1986.979] (-1976.354) * (-1978.093) (-1978.941) (-1970.838) [-1976.186] -- 0:01:22
      608000 -- [-1974.044] (-1977.842) (-1972.070) (-1979.511) * (-1975.044) [-1978.934] (-1977.709) (-1974.182) -- 0:01:22
      608500 -- [-1977.459] (-1982.071) (-1976.997) (-1975.757) * (-1972.231) [-1980.341] (-1977.771) (-1972.544) -- 0:01:22
      609000 -- (-1976.217) (-1977.216) (-1978.608) [-1975.476] * (-1973.871) (-1977.905) [-1975.269] (-1974.559) -- 0:01:22
      609500 -- (-1973.784) [-1977.160] (-1985.540) (-1980.856) * (-1974.698) [-1973.547] (-1979.372) (-1971.434) -- 0:01:22
      610000 -- (-1979.091) (-1979.266) (-1985.853) [-1973.201] * [-1975.684] (-1974.086) (-1980.527) (-1977.373) -- 0:01:21

      Average standard deviation of split frequencies: 0.000000

      610500 -- (-1975.904) [-1975.466] (-1982.350) (-1971.785) * (-1975.333) (-1980.138) [-1978.470] (-1978.057) -- 0:01:22
      611000 -- (-1975.401) [-1976.576] (-1979.956) (-1976.331) * (-1974.822) (-1977.566) (-1973.259) [-1981.662] -- 0:01:22
      611500 -- [-1973.823] (-1978.404) (-1979.696) (-1981.479) * (-1978.279) (-1977.676) (-1973.379) [-1974.326] -- 0:01:21
      612000 -- [-1973.494] (-1976.678) (-1978.818) (-1974.528) * [-1975.868] (-1974.851) (-1977.536) (-1980.834) -- 0:01:21
      612500 -- (-1974.154) (-1976.447) (-1972.124) [-1978.695] * (-1982.089) [-1973.616] (-1982.257) (-1978.858) -- 0:01:21
      613000 -- [-1972.130] (-1973.581) (-1983.585) (-1977.630) * (-1983.904) [-1973.131] (-1978.519) (-1979.058) -- 0:01:21
      613500 -- (-1976.591) [-1975.880] (-1975.706) (-1980.592) * (-1982.022) (-1973.759) [-1973.949] (-1976.485) -- 0:01:21
      614000 -- (-1974.883) [-1976.931] (-1975.848) (-1971.246) * (-1982.434) (-1978.033) (-1972.633) [-1979.373] -- 0:01:21
      614500 -- [-1977.311] (-1973.545) (-1977.581) (-1978.564) * [-1979.131] (-1974.480) (-1974.694) (-1975.558) -- 0:01:20
      615000 -- (-1975.608) (-1975.518) (-1979.385) [-1983.181] * [-1973.625] (-1981.187) (-1977.010) (-1975.367) -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      615500 -- [-1975.465] (-1979.669) (-1976.504) (-1978.064) * [-1976.710] (-1985.404) (-1977.762) (-1979.998) -- 0:01:21
      616000 -- (-1974.315) (-1979.644) (-1980.974) [-1979.740] * (-1973.898) [-1976.899] (-1976.221) (-1979.147) -- 0:01:21
      616500 -- (-1982.643) [-1979.254] (-1978.246) (-1979.375) * [-1971.273] (-1975.037) (-1977.977) (-1975.735) -- 0:01:20
      617000 -- (-1975.931) [-1977.712] (-1977.253) (-1973.884) * (-1973.338) (-1977.730) [-1973.170] (-1970.743) -- 0:01:20
      617500 -- [-1981.949] (-1973.625) (-1974.941) (-1976.864) * (-1977.435) (-1972.495) [-1982.121] (-1978.505) -- 0:01:20
      618000 -- (-1978.584) (-1975.152) (-1976.562) [-1979.371] * [-1975.500] (-1974.926) (-1979.337) (-1979.848) -- 0:01:20
      618500 -- (-1975.474) (-1978.982) (-1978.983) [-1976.673] * [-1973.385] (-1976.565) (-1978.629) (-1976.717) -- 0:01:20
      619000 -- [-1972.097] (-1977.126) (-1979.777) (-1980.904) * (-1976.007) (-1975.687) (-1971.298) [-1983.068] -- 0:01:20
      619500 -- (-1979.792) (-1981.031) (-1973.048) [-1974.699] * [-1982.675] (-1974.380) (-1976.626) (-1978.259) -- 0:01:19
      620000 -- (-1981.260) (-1979.141) [-1974.462] (-1979.024) * (-1978.009) [-1978.435] (-1982.760) (-1980.277) -- 0:01:20

      Average standard deviation of split frequencies: 0.000000

      620500 -- (-1985.020) [-1974.341] (-1980.155) (-1978.134) * (-1975.817) (-1976.262) (-1981.078) [-1973.194] -- 0:01:20
      621000 -- (-1984.490) [-1978.573] (-1977.148) (-1976.216) * (-1976.640) (-1971.865) (-1981.166) [-1980.312] -- 0:01:19
      621500 -- (-1978.569) (-1977.362) (-1979.429) [-1976.688] * (-1981.706) [-1975.011] (-1980.594) (-1976.035) -- 0:01:19
      622000 -- (-1977.736) (-1980.084) (-1977.435) [-1977.740] * (-1975.759) (-1977.720) [-1982.904] (-1978.599) -- 0:01:19
      622500 -- [-1973.109] (-1982.173) (-1986.664) (-1976.532) * (-1978.573) [-1972.918] (-1976.489) (-1978.714) -- 0:01:19
      623000 -- (-1977.318) (-1978.657) (-1980.886) [-1976.387] * (-1981.260) (-1973.592) (-1977.847) [-1976.614] -- 0:01:19
      623500 -- (-1978.172) [-1982.469] (-1978.311) (-1977.594) * (-1979.511) (-1981.877) [-1978.008] (-1975.286) -- 0:01:19
      624000 -- (-1976.976) (-1983.151) [-1972.840] (-1990.993) * [-1976.421] (-1977.530) (-1976.463) (-1976.422) -- 0:01:18
      624500 -- (-1977.823) [-1971.510] (-1979.923) (-1972.813) * [-1973.219] (-1977.076) (-1979.064) (-1993.178) -- 0:01:18
      625000 -- (-1982.079) [-1978.526] (-1983.394) (-1978.348) * (-1978.202) [-1977.471] (-1975.361) (-1974.852) -- 0:01:19

      Average standard deviation of split frequencies: 0.000000

      625500 -- (-1976.768) (-1977.836) [-1973.875] (-1983.190) * (-1979.288) [-1974.548] (-1975.164) (-1978.235) -- 0:01:19
      626000 -- (-1975.623) (-1975.823) (-1977.985) [-1980.544] * [-1972.816] (-1979.627) (-1973.590) (-1985.556) -- 0:01:18
      626500 -- (-1974.764) (-1976.384) (-1978.815) [-1971.784] * [-1973.792] (-1977.301) (-1975.483) (-1979.396) -- 0:01:18
      627000 -- (-1976.574) (-1974.223) (-1980.991) [-1972.982] * (-1975.213) [-1981.270] (-1974.684) (-1979.505) -- 0:01:18
      627500 -- (-1976.907) [-1976.150] (-1977.787) (-1986.824) * (-1984.917) (-1976.053) (-1975.177) [-1978.123] -- 0:01:18
      628000 -- (-1977.454) (-1974.123) (-1976.674) [-1978.358] * (-1980.705) (-1976.522) [-1976.723] (-1976.234) -- 0:01:18
      628500 -- [-1976.891] (-1975.339) (-1976.446) (-1974.796) * (-1980.107) (-1978.242) [-1972.119] (-1974.587) -- 0:01:18
      629000 -- [-1978.898] (-1971.949) (-1978.660) (-1973.463) * (-1981.309) (-1979.206) [-1976.225] (-1973.565) -- 0:01:17
      629500 -- (-1984.215) (-1978.434) (-1984.279) [-1982.798] * (-1977.816) [-1976.341] (-1979.809) (-1980.891) -- 0:01:17
      630000 -- (-1976.751) (-1970.528) [-1978.672] (-1982.005) * (-1979.717) (-1975.824) [-1979.832] (-1981.799) -- 0:01:18

      Average standard deviation of split frequencies: 0.000000

      630500 -- (-1975.267) [-1972.084] (-1978.921) (-1974.657) * (-1979.922) (-1972.071) [-1981.867] (-1973.880) -- 0:01:17
      631000 -- (-1972.005) (-1977.141) [-1976.341] (-1974.977) * (-1972.564) (-1976.049) [-1976.737] (-1980.943) -- 0:01:17
      631500 -- [-1980.338] (-1976.835) (-1985.301) (-1975.090) * (-1979.016) (-1978.480) (-1974.255) [-1975.394] -- 0:01:17
      632000 -- (-1979.911) (-1977.536) (-1975.776) [-1976.623] * (-1975.759) (-1984.154) [-1983.224] (-1980.418) -- 0:01:17
      632500 -- (-1978.374) [-1978.860] (-1973.756) (-1979.396) * (-1977.534) (-1983.412) [-1977.703] (-1977.995) -- 0:01:17
      633000 -- [-1977.328] (-1977.087) (-1975.834) (-1984.162) * (-1973.238) (-1979.073) (-1979.307) [-1977.356] -- 0:01:17
      633500 -- [-1975.102] (-1976.539) (-1976.318) (-1976.389) * [-1977.094] (-1972.794) (-1977.109) (-1975.279) -- 0:01:16
      634000 -- (-1974.616) (-1980.300) [-1974.667] (-1982.128) * (-1977.800) (-1981.798) (-1979.191) [-1973.938] -- 0:01:16
      634500 -- (-1976.704) (-1979.550) (-1975.184) [-1976.576] * (-1975.564) (-1976.291) (-1977.914) [-1972.109] -- 0:01:17
      635000 -- (-1973.086) (-1976.370) [-1973.763] (-1974.529) * [-1976.198] (-1983.359) (-1975.699) (-1972.491) -- 0:01:17

      Average standard deviation of split frequencies: 0.000000

      635500 -- (-1980.920) [-1976.862] (-1976.414) (-1974.471) * (-1979.515) [-1976.728] (-1979.891) (-1972.323) -- 0:01:16
      636000 -- (-1976.043) [-1975.707] (-1978.515) (-1979.254) * [-1975.609] (-1978.002) (-1980.373) (-1977.785) -- 0:01:16
      636500 -- (-1975.102) [-1975.403] (-1977.644) (-1974.567) * (-1976.933) (-1976.179) [-1976.446] (-1982.008) -- 0:01:16
      637000 -- (-1981.779) (-1970.365) (-1980.469) [-1974.153] * (-1983.078) (-1977.275) (-1976.160) [-1972.311] -- 0:01:16
      637500 -- (-1979.131) [-1977.839] (-1981.590) (-1977.322) * (-1973.890) (-1975.884) [-1972.732] (-1978.893) -- 0:01:16
      638000 -- (-1972.655) (-1975.634) [-1981.116] (-1977.140) * [-1975.362] (-1977.334) (-1976.540) (-1976.111) -- 0:01:16
      638500 -- (-1974.863) [-1972.974] (-1980.848) (-1978.325) * [-1971.110] (-1976.775) (-1975.553) (-1977.269) -- 0:01:15
      639000 -- [-1974.366] (-1978.546) (-1976.054) (-1975.054) * [-1978.407] (-1977.507) (-1972.748) (-1986.288) -- 0:01:15
      639500 -- (-1978.592) (-1972.811) [-1977.564] (-1971.979) * (-1983.644) (-1977.027) [-1977.276] (-1985.007) -- 0:01:16
      640000 -- (-1976.316) (-1982.755) [-1976.209] (-1972.609) * (-1971.824) [-1977.125] (-1979.349) (-1982.061) -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      640500 -- [-1973.050] (-1982.654) (-1973.555) (-1978.381) * [-1976.808] (-1977.376) (-1973.755) (-1978.778) -- 0:01:15
      641000 -- (-1981.267) (-1980.014) [-1979.130] (-1982.485) * (-1981.472) [-1973.547] (-1975.358) (-1978.133) -- 0:01:15
      641500 -- (-1979.829) (-1978.313) [-1975.821] (-1980.549) * (-1984.841) (-1977.748) (-1973.936) [-1978.561] -- 0:01:15
      642000 -- [-1972.223] (-1984.389) (-1974.332) (-1974.319) * (-1983.890) (-1982.560) [-1970.795] (-1985.881) -- 0:01:15
      642500 -- (-1978.107) [-1973.017] (-1983.778) (-1978.905) * (-1988.169) (-1976.767) [-1974.681] (-1975.288) -- 0:01:15
      643000 -- (-1981.413) (-1974.729) (-1978.918) [-1977.883] * (-1973.346) (-1973.975) [-1977.134] (-1977.677) -- 0:01:14
      643500 -- (-1978.920) [-1973.644] (-1976.724) (-1974.336) * (-1975.231) (-1979.864) [-1974.042] (-1978.675) -- 0:01:14
      644000 -- (-1980.764) [-1973.863] (-1975.396) (-1975.977) * (-1979.774) (-1974.556) (-1978.495) [-1978.628] -- 0:01:15
      644500 -- (-1983.794) (-1970.990) [-1979.899] (-1981.426) * [-1980.075] (-1979.802) (-1974.005) (-1972.832) -- 0:01:15
      645000 -- [-1978.366] (-1973.904) (-1978.817) (-1980.779) * [-1975.403] (-1978.273) (-1970.980) (-1976.502) -- 0:01:14

      Average standard deviation of split frequencies: 0.000000

      645500 -- [-1972.320] (-1976.650) (-1976.937) (-1982.942) * (-1974.205) (-1978.304) (-1974.600) [-1977.589] -- 0:01:14
      646000 -- [-1977.427] (-1971.729) (-1982.336) (-1982.597) * (-1976.495) (-1974.837) [-1981.788] (-1982.505) -- 0:01:14
      646500 -- [-1975.822] (-1971.613) (-1973.598) (-1978.381) * (-1971.253) (-1970.946) [-1980.658] (-1976.785) -- 0:01:14
      647000 -- (-1978.225) [-1975.876] (-1981.788) (-1979.179) * (-1976.469) (-1977.459) [-1977.655] (-1976.249) -- 0:01:14
      647500 -- [-1970.657] (-1977.907) (-1969.736) (-1983.412) * (-1979.428) (-1976.632) [-1975.427] (-1977.207) -- 0:01:14
      648000 -- (-1977.979) [-1979.634] (-1971.216) (-1974.161) * (-1973.111) (-1977.893) (-1979.155) [-1974.119] -- 0:01:13
      648500 -- (-1979.396) [-1971.914] (-1973.106) (-1981.270) * [-1974.477] (-1977.869) (-1977.371) (-1972.760) -- 0:01:13
      649000 -- (-1982.178) (-1983.976) (-1975.458) [-1979.379] * [-1975.156] (-1974.532) (-1975.215) (-1977.228) -- 0:01:14
      649500 -- [-1974.350] (-1979.064) (-1979.388) (-1984.492) * (-1977.929) [-1976.209] (-1981.650) (-1975.164) -- 0:01:13
      650000 -- (-1981.641) (-1980.689) [-1973.433] (-1980.875) * (-197