--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 24 15:40:59 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/330/Ntmt-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1973.42 -1982.21
2 -1973.09 -1982.06
--------------------------------------
TOTAL -1973.24 -1982.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.374933 0.003232 0.264564 0.480435 0.369938 1276.97 1325.07 1.000
r(A<->C){all} 0.101069 0.000793 0.047157 0.154629 0.098986 848.41 900.31 1.000
r(A<->G){all} 0.292450 0.002609 0.200343 0.396583 0.289384 598.36 766.17 1.001
r(A<->T){all} 0.086027 0.001031 0.027853 0.150188 0.082416 903.47 989.88 1.000
r(C<->G){all} 0.067165 0.000459 0.029942 0.111177 0.065063 890.47 936.09 1.000
r(C<->T){all} 0.385461 0.003123 0.275084 0.490260 0.384191 746.75 794.05 1.001
r(G<->T){all} 0.067828 0.000633 0.022102 0.116987 0.065419 909.67 913.00 1.000
pi(A){all} 0.249291 0.000197 0.221695 0.276218 0.249129 1048.21 1210.93 1.000
pi(C){all} 0.264683 0.000198 0.237316 0.292641 0.265031 1167.30 1207.20 1.001
pi(G){all} 0.287151 0.000221 0.260110 0.317594 0.286916 1093.32 1131.89 1.000
pi(T){all} 0.198875 0.000175 0.173127 0.224392 0.198856 820.01 959.30 1.001
alpha{1,2} 0.055882 0.001615 0.000112 0.127943 0.049388 1183.21 1312.78 1.000
alpha{3} 2.208823 0.672129 0.884970 3.891913 2.080196 1468.81 1484.90 1.000
pinvar{all} 0.289528 0.009824 0.087826 0.475587 0.298077 1212.05 1275.86 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1878.084473
Model 2: PositiveSelection -1878.084473
Model 0: one-ratio -1882.665176
Model 3: discrete -1876.899906
Model 7: beta -1877.119905
Model 8: beta&w>1 -1877.119945
Model 0 vs 1 9.16140600000017
Model 2 vs 1 0.0
Model 8 vs 7 7.999999979801942E-5
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=276
C1 MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
C2 MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
C3 MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
C4 MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
C5 MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
* **** :*********: **:** : :::******** **:.**.*
C1 SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
C2 SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
C3 SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
C4 SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
C5 STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
*::*. *** ************:***********************.***
C1 EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
C2 EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
C3 EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
C4 EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
C5 EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
**************************************.***:*******
C1 SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
C2 SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
C3 SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
C4 SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
C5 SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
*:: ******::**********:*******:*******************
C1 KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
C2 KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
C3 KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
C4 KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
C5 KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
*******.*:*:*******:*:***::*****************:*****
C1 RKVKQQNFPKGLFPVYMIACKPVSKE
C2 RKVKQQNFPKGLFPVYMIACKPVSKE
C3 RKVKQQNFPKGLFPVYMIACKPVSKE
C4 RKVKQQNFPKGLFPVYMIACKPVSKE
C5 RKVKQQNFPKGLFPVYMIACKPVSKE
**************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 276 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 276 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5520]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5520]--->[5520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/330/Ntmt-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.288 Mb, Max= 30.580 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
FORMAT of file /tmp/tmp487571641168774826aln Not Supported[FATAL:T-COFFEE]
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:276 S:100 BS:276
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 94.93 C1 C2 94.93
TOP 1 0 94.93 C2 C1 94.93
BOT 0 2 93.84 C1 C3 93.84
TOP 2 0 93.84 C3 C1 93.84
BOT 0 3 91.67 C1 C4 91.67
TOP 3 0 91.67 C4 C1 91.67
BOT 0 4 90.22 C1 C5 90.22
TOP 4 0 90.22 C5 C1 90.22
BOT 1 2 98.19 C2 C3 98.19
TOP 2 1 98.19 C3 C2 98.19
BOT 1 3 90.94 C2 C4 90.94
TOP 3 1 90.94 C4 C2 90.94
BOT 1 4 89.86 C2 C5 89.86
TOP 4 1 89.86 C5 C2 89.86
BOT 2 3 89.86 C3 C4 89.86
TOP 3 2 89.86 C4 C3 89.86
BOT 2 4 88.41 C3 C5 88.41
TOP 4 2 88.41 C5 C3 88.41
BOT 3 4 92.39 C4 C5 92.39
TOP 4 3 92.39 C5 C4 92.39
AVG 0 C1 * 92.66
AVG 1 C2 * 93.48
AVG 2 C3 * 92.57
AVG 3 C4 * 91.21
AVG 4 C5 * 90.22
TOT TOT * 92.03
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
C2 ATGAGGACTACATTAGAAGAGCAGCTTTCAGACAAACTGCAGATGATGGA
C3 ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
C4 ATGACGACTACATTAGAAGCCGAGCTTTCAGACAAGTTACAGATGATGGA
C5 ATGCCGACTACATTAGAAGCCCAGCTTTCAGACAAGCTACAGATGATGGA
***. **************. *************. *.***********
C1 CGAGACCACGGATAAGGTCCAGGGGTCGTCGAAGCAGAAGGATGATAGCA
C2 CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCAGAAGGAAGATAGCA
C3 CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCTGAAGGAAGATAGCA
C4 CGAGACCACAGACAACGTCCAGGAGCTGGTGAAGCAGGAGGAAGACAGCA
C5 CGAGATCACAGATAACGTCCAAGAGCCGGCGGAGCAGAAGGAAGAAAGCA
*** * ***.** ** **.**.*.* * *.***:*.****:** ****
C1 GTATAGCCGCAAGTTCAGATGCCAAGACAGCGTCCCCTTCTTCGAGCGAT
C2 GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
C3 GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
C4 GTATAGCCGCAAGCTCCGATGCCCAGACAGCAACCCCTTCTTCCAGCGAT
C5 GTATAGCCGCCAGTTCCGATATTAAGACAGCGTCCACTTCTTCCAGCGAT
**********.** **.***. ..******.:**.******* *.***
C1 AGTTCGACCAAAGTCGCCGCACCGGAGTCCGAATTTTACAATAAGGCACA
C2 AGTGCGACCAAAGTCGCCGCACCTGAGATCGAATTTTACAACAAGGCTCA
C3 AGTGCGACCAAAGTCGCCGCACCGGAGATCGAATTTTACAACAAGGCTCA
C4 AGTGCTTCCAAAGTTGCAGCACCGGAGCCCGAGTTTTACAATAAAGCTCA
C5 AGTACGACCAAAACTGACGCACCGGAGCCCGAATTTTACAATAAGGCCCA
*** * :*****. *..***** *** ***.******** **.** **
C1 AAAATATTGGTCTGAGGTACCGGCGACTGTTAACGGGATGCTCGGCGGCC
C2 GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
C3 GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
C4 GAAGTACTGGTCGGAGATTCCGGCTACTGTCAACGGGATGCTTGGCGGCC
C5 GAAGTACTGGTCGGAGATTCCGGCCACTGTCAACGGGATGCTCGGCGGCC
.**.** ***** ***.*:***** ***** ** ******** *******
C1 TGGGCTACATTAGTGCCATAGATATACAGGGATCGAATGTGTTCCTGCGC
C2 TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
C3 TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
C4 TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCTTGCGC
C5 TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCCTGCGC
********** ** *****.*****:************. **** *****
C1 GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C2 GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C3 GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C4 GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
C5 GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
**************************************************
C1 TGGTCGGGTGACTCGGAATCTCCTGATCCCCCGCTTCAGCTGCGTGGATC
C2 CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
C3 CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
C4 CGGTCGGGTGACTCGGAATCTCCTGATCCCACGTTTCAGCTGCGTGGATC
C5 CGGTCGGGTGACTCGCAATCTCCTGATACCCCGCTTCAGCTGCGTAGATC
************** *********** **.** ***********.****
C1 TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACT
C2 TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
C3 TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
C4 TCGTCGAGCAGGATCCTGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
C5 TCGTCGAGCAGGATGCCGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
* ************ * ** ******** ********************
C1 TCGGAAGACGGAAGCCGTGGAAAGGTGGGACAGATCTATAACGTGGGATT
C2 TCGGAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
C3 TCGAAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
C4 TCGGAAGACGTGAGCCGTGGAAAGGTGGGCCACATCTACAACGTCGGATT
C5 TCGGAAGAAGTGAGCCGTGGAAAGGTGGGCCAGATCTACAACGTCGGATT
***.*.**.* .*****************.** .**** ***** *****
C1 GCAGAAGTTTACGCCTACGCAACAGTACGACCTCGTTTGGACCCAGTGGG
C2 GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
C3 GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
C4 GCAAAAGTTCACGCCTTCGCAGCAGTATGACCTCGTTTGGAGCCAATGGG
C5 GCAAAAGTTCACGCCTTCGCAGCAGTACGACCTCGTTTGGAGCCAATGGG
***.***** ******:****.***** ************* ***.****
C1 TCCTGGGCCATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGACGCATA
C2 TGCTGGGACATCTCACAGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
C3 TGCTGGGACATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
C4 TGCTGGGTCATCTCACAGACCGCGACCTGGTCTCGTTCTTTCGTCGCATC
C5 TGCTAGGCCATCTCACGGATCGCGATCTGGTCTCGTTCTTTCGTCGGATC
* **.** ********.** ***** ***************** ** **.
C1 AAGCAGGGACTGGCGCCCGGCGCCTTCTTGTGTCTGAAGGAGAACGTGAG
C2 AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
C3 AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
C4 AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTCTGAAGGAAAACGTGAG
C5 AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTATGAAGGAGAACGTGAG
********************.* ****** ***.*******.********
C1 CAGCTCGAAGAAGACAGTGGAAGATAGGAACGACTCGTCGGTAACGAGGC
C2 CAGCTCGAAGAAGACAGTGGAGGATAAGAATGACTCGTCAGTTACGAGGC
C3 CAGCTCGAGGAAGACAGTGGAGGATAAGAATGACTCGTCGGTTACGAGGC
C4 CAGCTCGAAGAAGGCGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
C5 CAGCTCCAAAAAGACGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
****** *..***.*.*****.** *.*.* ***** ** **:** ****
C1 CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
C2 CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
C3 CTCTGGACAGCTATGAACACTTCCTAAAAGAAACCGGATTTCGCATTGTA
C4 CTCTGGATAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTG
C5 CCCTTGACAGTTATGAGCACTTTCTAAAGGAGGCTGGATTTCGCATTGTG
* ** ** ** *****.***** *****.**..* **************.
C1 CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTCTTTCCAGTGTACAT
C2 CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
C3 CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
C4 CGCAAGGTCAAACAACAAAACTTTCCCAAGGGACTTTTTCCAGTGTACAT
C5 CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTTTTTCCAGTATACAT
***********.*********************** ********.*****
C1 GATAGCCTGCAAACCCGTCTCCAAGGAA
C2 GATCGCCTGCAAACCCGTCTCCAAGGAA
C3 GATCGCCTGCAAACCCGTCTCCAAGGAA
C4 GATCGCCTGCAAACCTGTCTCTAAGGAA
C5 GATCGCCTGCAAACCCGTCTCTAAGGAA
***.*********** ***** ******
>C1
ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
CGAGACCACGGATAAGGTCCAGGGGTCGTCGAAGCAGAAGGATGATAGCA
GTATAGCCGCAAGTTCAGATGCCAAGACAGCGTCCCCTTCTTCGAGCGAT
AGTTCGACCAAAGTCGCCGCACCGGAGTCCGAATTTTACAATAAGGCACA
AAAATATTGGTCTGAGGTACCGGCGACTGTTAACGGGATGCTCGGCGGCC
TGGGCTACATTAGTGCCATAGATATACAGGGATCGAATGTGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
TGGTCGGGTGACTCGGAATCTCCTGATCCCCCGCTTCAGCTGCGTGGATC
TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACT
TCGGAAGACGGAAGCCGTGGAAAGGTGGGACAGATCTATAACGTGGGATT
GCAGAAGTTTACGCCTACGCAACAGTACGACCTCGTTTGGACCCAGTGGG
TCCTGGGCCATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGACGCATA
AAGCAGGGACTGGCGCCCGGCGCCTTCTTGTGTCTGAAGGAGAACGTGAG
CAGCTCGAAGAAGACAGTGGAAGATAGGAACGACTCGTCGGTAACGAGGC
CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTCTTTCCAGTGTACAT
GATAGCCTGCAAACCCGTCTCCAAGGAA
>C2
ATGAGGACTACATTAGAAGAGCAGCTTTCAGACAAACTGCAGATGATGGA
CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCAGAAGGAAGATAGCA
GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
AGTGCGACCAAAGTCGCCGCACCTGAGATCGAATTTTACAACAAGGCTCA
GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
TCGGAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
TGCTGGGACATCTCACAGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
CAGCTCGAAGAAGACAGTGGAGGATAAGAATGACTCGTCAGTTACGAGGC
CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
GATCGCCTGCAAACCCGTCTCCAAGGAA
>C3
ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA
CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCTGAAGGAAGATAGCA
GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC
AGTGCGACCAAAGTCGCCGCACCGGAGATCGAATTTTACAACAAGGCTCA
GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC
TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC
TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC
TCGAAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT
GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG
TGCTGGGACATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC
AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG
CAGCTCGAGGAAGACAGTGGAGGATAAGAATGACTCGTCGGTTACGAGGC
CTCTGGACAGCTATGAACACTTCCTAAAAGAAACCGGATTTCGCATTGTA
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT
GATCGCCTGCAAACCCGTCTCCAAGGAA
>C4
ATGACGACTACATTAGAAGCCGAGCTTTCAGACAAGTTACAGATGATGGA
CGAGACCACAGACAACGTCCAGGAGCTGGTGAAGCAGGAGGAAGACAGCA
GTATAGCCGCAAGCTCCGATGCCCAGACAGCAACCCCTTCTTCCAGCGAT
AGTGCTTCCAAAGTTGCAGCACCGGAGCCCGAGTTTTACAATAAAGCTCA
GAAGTACTGGTCGGAGATTCCGGCTACTGTCAACGGGATGCTTGGCGGCC
TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCTTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGGAATCTCCTGATCCCACGTTTCAGCTGCGTGGATC
TCGTCGAGCAGGATCCTGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
TCGGAAGACGTGAGCCGTGGAAAGGTGGGCCACATCTACAACGTCGGATT
GCAAAAGTTCACGCCTTCGCAGCAGTATGACCTCGTTTGGAGCCAATGGG
TGCTGGGTCATCTCACAGACCGCGACCTGGTCTCGTTCTTTCGTCGCATC
AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTCTGAAGGAAAACGTGAG
CAGCTCGAAGAAGGCGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
CTCTGGATAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTG
CGCAAGGTCAAACAACAAAACTTTCCCAAGGGACTTTTTCCAGTGTACAT
GATCGCCTGCAAACCTGTCTCTAAGGAA
>C5
ATGCCGACTACATTAGAAGCCCAGCTTTCAGACAAGCTACAGATGATGGA
CGAGATCACAGATAACGTCCAAGAGCCGGCGGAGCAGAAGGAAGAAAGCA
GTATAGCCGCCAGTTCCGATATTAAGACAGCGTCCACTTCTTCCAGCGAT
AGTACGACCAAAACTGACGCACCGGAGCCCGAATTTTACAATAAGGCCCA
GAAGTACTGGTCGGAGATTCCGGCCACTGTCAACGGGATGCTCGGCGGCC
TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCCTGCGC
GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT
CGGTCGGGTGACTCGCAATCTCCTGATACCCCGCTTCAGCTGCGTAGATC
TCGTCGAGCAGGATGCCGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC
TCGGAAGAAGTGAGCCGTGGAAAGGTGGGCCAGATCTACAACGTCGGATT
GCAAAAGTTCACGCCTTCGCAGCAGTACGACCTCGTTTGGAGCCAATGGG
TGCTAGGCCATCTCACGGATCGCGATCTGGTCTCGTTCTTTCGTCGGATC
AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTATGAAGGAGAACGTGAG
CAGCTCCAAAAAGACGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC
CCCTTGACAGTTATGAGCACTTTCTAAAGGAGGCTGGATTTCGCATTGTG
CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTTTTTCCAGTATACAT
GATCGCCTGCAAACCCGTCTCTAAGGAA
>C1
MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C2
MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C3
MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C4
MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
>C5
MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
RKVKQQNFPKGLFPVYMIACKPVSKE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 828 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480001790
Setting output file names to "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 642927972
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0932072150
Seed = 2123701979
Swapseed = 1480001790
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 26 unique site patterns
Division 2 has 21 unique site patterns
Division 3 has 58 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2233.857759 -- -25.624409
Chain 2 -- -2415.725506 -- -25.624409
Chain 3 -- -2401.309176 -- -25.624409
Chain 4 -- -2401.309176 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2328.173420 -- -25.624409
Chain 2 -- -2398.861297 -- -25.624409
Chain 3 -- -2401.414162 -- -25.624409
Chain 4 -- -2395.378409 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2233.858] (-2415.726) (-2401.309) (-2401.309) * [-2328.173] (-2398.861) (-2401.414) (-2395.378)
500 -- (-2016.898) (-2014.266) (-2016.801) [-2007.418] * (-2023.532) (-2003.155) (-2015.889) [-2000.336] -- 0:00:00
1000 -- (-2015.603) (-2003.631) [-2010.540] (-1999.406) * (-2008.499) (-2001.347) (-2012.440) [-1991.860] -- 0:00:00
1500 -- (-2006.889) (-1998.559) (-2010.316) [-1990.750] * (-2008.355) (-1993.617) (-2004.631) [-1991.443] -- 0:11:05
2000 -- (-2009.848) (-1996.411) (-2007.560) [-1986.422] * (-2001.242) (-1991.584) [-1994.817] (-1988.417) -- 0:08:19
2500 -- (-1990.323) [-1985.413] (-1989.841) (-1991.495) * (-2010.531) (-1983.318) (-1989.849) [-1978.468] -- 0:06:39
3000 -- [-1984.139] (-1987.708) (-1982.429) (-1988.165) * (-1995.159) (-1980.142) (-1987.305) [-1977.741] -- 0:05:32
3500 -- (-1979.092) (-1986.753) [-1983.388] (-1982.093) * (-1980.613) (-1982.046) (-1976.651) [-1979.341] -- 0:04:44
4000 -- (-1977.429) (-1983.760) [-1979.892] (-1974.930) * (-1984.848) (-1981.476) [-1975.280] (-1975.912) -- 0:04:09
4500 -- [-1973.281] (-1980.271) (-1976.513) (-1977.759) * (-1993.605) (-1975.702) (-1972.766) [-1971.049] -- 0:03:41
5000 -- [-1974.705] (-1980.605) (-1985.931) (-1973.244) * (-1983.699) (-1978.863) (-1975.176) [-1976.068] -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-1977.308) (-1978.880) (-1976.632) [-1975.835] * (-1976.837) (-1984.705) [-1973.929] (-1971.473) -- 0:03:00
6000 -- (-1977.834) [-1972.290] (-1974.796) (-1979.020) * (-1976.572) (-1978.697) (-1974.306) [-1973.888] -- 0:05:31
6500 -- (-1978.628) (-1976.580) (-1979.153) [-1974.273] * (-1982.618) (-1972.565) [-1974.069] (-1977.620) -- 0:05:05
7000 -- [-1983.058] (-1979.512) (-1977.878) (-1980.486) * (-1980.027) [-1975.688] (-1973.252) (-1980.666) -- 0:04:43
7500 -- [-1980.388] (-1981.353) (-1973.646) (-1978.969) * (-1973.640) (-1976.724) [-1971.628] (-1981.001) -- 0:04:24
8000 -- (-1977.496) (-1979.127) (-1972.541) [-1970.910] * (-1975.013) [-1981.468] (-1978.410) (-1974.417) -- 0:04:08
8500 -- [-1981.177] (-1985.196) (-1972.000) (-1980.649) * (-1988.152) (-1975.187) (-1976.255) [-1976.462] -- 0:03:53
9000 -- (-1973.920) [-1986.646] (-1977.695) (-1979.250) * (-1977.931) (-1976.796) (-1980.547) [-1976.161] -- 0:03:40
9500 -- (-1977.048) (-1984.465) (-1977.517) [-1974.808] * (-1975.707) [-1981.176] (-1977.628) (-1971.293) -- 0:03:28
10000 -- (-1978.950) (-1982.272) [-1972.735] (-1976.942) * [-1977.016] (-1975.567) (-1984.479) (-1973.341) -- 0:03:18
Average standard deviation of split frequencies: 0.000000
10500 -- [-1976.406] (-1983.633) (-1976.362) (-1974.529) * (-1972.819) (-1978.064) (-1985.605) [-1976.990] -- 0:03:08
11000 -- (-1980.793) (-1980.840) (-1980.554) [-1975.117] * [-1971.500] (-1972.959) (-1985.752) (-1974.696) -- 0:04:29
11500 -- [-1979.820] (-1981.210) (-1976.832) (-1980.075) * (-1974.589) (-1972.590) [-1977.470] (-1972.023) -- 0:04:17
12000 -- (-1978.506) (-1973.318) (-1975.156) [-1979.649] * (-1974.071) (-1977.085) (-1975.635) [-1976.053] -- 0:04:07
12500 -- (-1981.957) (-1976.755) [-1973.803] (-1975.278) * (-1974.923) [-1976.044] (-1975.592) (-1973.557) -- 0:03:57
13000 -- (-1975.638) (-1975.013) [-1976.547] (-1975.237) * (-1973.498) (-1974.410) (-1976.489) [-1978.990] -- 0:03:47
13500 -- (-1987.381) [-1975.269] (-1975.667) (-1980.327) * (-1983.234) (-1974.149) (-1983.027) [-1979.564] -- 0:03:39
14000 -- (-1981.163) [-1973.666] (-1974.811) (-1978.449) * (-1977.291) (-1973.338) (-1982.663) [-1972.829] -- 0:03:31
14500 -- (-1973.652) [-1974.807] (-1973.276) (-1980.607) * [-1975.561] (-1977.159) (-1979.185) (-1984.729) -- 0:03:23
15000 -- [-1974.143] (-1972.804) (-1975.641) (-1975.615) * (-1975.545) (-1981.210) [-1980.532] (-1975.132) -- 0:03:17
Average standard deviation of split frequencies: 0.000000
15500 -- (-1975.307) (-1975.845) (-1980.657) [-1974.053] * (-1978.588) [-1974.081] (-1985.818) (-1977.782) -- 0:04:14
16000 -- (-1979.651) [-1979.488] (-1978.603) (-1975.798) * (-1976.199) (-1974.711) (-1980.428) [-1975.646] -- 0:04:06
16500 -- (-1978.424) [-1979.070] (-1978.657) (-1975.696) * [-1977.209] (-1970.084) (-1979.924) (-1974.210) -- 0:03:58
17000 -- (-1980.455) [-1973.346] (-1975.385) (-1976.156) * (-1982.003) (-1980.224) [-1979.302] (-1978.076) -- 0:03:51
17500 -- (-1980.462) (-1978.807) [-1972.562] (-1973.378) * (-1980.069) [-1986.658] (-1982.291) (-1973.767) -- 0:03:44
18000 -- (-1977.314) (-1976.294) [-1975.759] (-1973.868) * (-1978.109) (-1972.911) (-1975.102) [-1974.562] -- 0:03:38
18500 -- (-1976.239) (-1985.895) [-1977.853] (-1976.733) * [-1979.302] (-1980.006) (-1977.540) (-1980.864) -- 0:03:32
19000 -- (-1979.829) (-1977.271) (-1973.900) [-1974.831] * [-1979.077] (-1985.401) (-1982.255) (-1980.360) -- 0:03:26
19500 -- (-1979.712) (-1979.931) [-1980.127] (-1978.235) * (-1975.454) (-1976.875) [-1978.002] (-1983.136) -- 0:03:21
20000 -- [-1980.790] (-1982.438) (-1986.001) (-1978.767) * (-1973.915) (-1974.440) (-1974.093) [-1977.006] -- 0:03:16
Average standard deviation of split frequencies: 0.000000
20500 -- (-1975.217) [-1973.842] (-1977.937) (-1977.519) * (-1979.108) [-1975.837] (-1975.057) (-1976.186) -- 0:03:58
21000 -- (-1982.982) (-1975.717) [-1977.377] (-1975.060) * (-1979.513) [-1977.590] (-1980.247) (-1983.060) -- 0:03:53
21500 -- (-1977.429) [-1973.595] (-1977.441) (-1977.025) * (-1979.713) (-1971.827) [-1974.446] (-1983.897) -- 0:03:47
22000 -- (-1978.699) (-1980.758) [-1974.969] (-1978.711) * (-1975.621) (-1982.911) (-1975.656) [-1974.439] -- 0:03:42
22500 -- [-1972.707] (-1980.044) (-1978.328) (-1973.558) * (-1977.901) [-1980.465] (-1977.369) (-1980.597) -- 0:03:37
23000 -- [-1978.958] (-1977.371) (-1974.805) (-1977.340) * [-1974.582] (-1977.219) (-1979.444) (-1980.228) -- 0:03:32
23500 -- (-1981.341) (-1975.851) (-1977.301) [-1978.412] * (-1976.254) (-1986.386) [-1980.131] (-1978.194) -- 0:03:27
24000 -- (-1977.748) [-1974.572] (-1974.670) (-1983.036) * [-1975.415] (-1983.659) (-1976.809) (-1982.764) -- 0:03:23
24500 -- (-1978.619) (-1979.874) [-1971.108] (-1981.767) * (-1974.939) [-1975.758] (-1980.176) (-1975.299) -- 0:03:19
25000 -- [-1972.559] (-1980.997) (-1976.472) (-1975.065) * (-1974.830) (-1979.457) (-1982.093) [-1979.850] -- 0:03:54
Average standard deviation of split frequencies: 0.000000
25500 -- (-1977.548) [-1975.222] (-1975.080) (-1972.707) * (-1972.354) (-1975.757) [-1977.038] (-1978.880) -- 0:03:49
26000 -- (-1974.002) [-1974.386] (-1976.150) (-1972.284) * [-1970.924] (-1978.581) (-1973.039) (-1983.756) -- 0:03:44
26500 -- (-1975.326) [-1971.158] (-1982.563) (-1975.254) * (-1975.513) [-1977.574] (-1973.084) (-1980.376) -- 0:03:40
27000 -- [-1972.016] (-1973.797) (-1982.874) (-1973.578) * (-1974.057) (-1983.342) (-1985.654) [-1976.134] -- 0:03:36
27500 -- (-1975.130) [-1983.341] (-1983.905) (-1977.154) * (-1973.629) [-1980.039] (-1975.255) (-1978.000) -- 0:03:32
28000 -- (-1972.866) [-1977.883] (-1978.368) (-1976.399) * (-1977.606) (-1975.092) [-1974.570] (-1975.704) -- 0:03:28
28500 -- [-1974.926] (-1977.823) (-1979.379) (-1978.337) * (-1978.922) (-1974.593) (-1979.063) [-1971.521] -- 0:03:24
29000 -- [-1977.761] (-1973.503) (-1978.197) (-1979.129) * (-1971.873) [-1977.744] (-1981.640) (-1975.528) -- 0:03:20
29500 -- (-1977.379) (-1983.051) [-1975.594] (-1976.408) * (-1977.791) [-1974.816] (-1981.418) (-1973.632) -- 0:03:17
30000 -- [-1980.363] (-1982.038) (-1978.843) (-1976.518) * [-1979.855] (-1983.461) (-1982.297) (-1974.994) -- 0:03:46
Average standard deviation of split frequencies: 0.000000
30500 -- (-1979.807) (-1978.965) [-1978.041] (-1979.308) * [-1977.662] (-1978.138) (-1975.973) (-1974.764) -- 0:03:42
31000 -- (-1973.304) (-1977.836) [-1976.453] (-1978.144) * [-1973.320] (-1981.528) (-1977.828) (-1978.498) -- 0:03:38
31500 -- (-1972.782) (-1982.716) (-1976.643) [-1976.247] * (-1972.945) (-1979.849) [-1980.738] (-1985.666) -- 0:03:35
32000 -- [-1975.447] (-1983.036) (-1977.111) (-1978.607) * [-1972.756] (-1979.372) (-1975.403) (-1984.525) -- 0:03:31
32500 -- (-1978.927) [-1980.623] (-1974.007) (-1974.956) * (-1979.757) (-1981.390) (-1977.314) [-1976.844] -- 0:03:28
33000 -- (-1983.157) [-1979.734] (-1973.006) (-1975.754) * (-1978.169) (-1981.984) (-1979.159) [-1975.121] -- 0:03:25
33500 -- (-1978.455) (-1975.898) (-1981.778) [-1975.301] * [-1976.648] (-1984.504) (-1974.020) (-1977.929) -- 0:03:21
34000 -- (-1976.240) (-1978.882) [-1975.428] (-1980.263) * (-1981.085) (-1985.630) [-1975.949] (-1976.312) -- 0:03:18
34500 -- [-1976.985] (-1978.525) (-1978.847) (-1973.765) * [-1980.615] (-1978.828) (-1974.362) (-1975.037) -- 0:03:15
35000 -- (-1974.215) (-1977.594) [-1973.738] (-1971.764) * (-1980.922) (-1985.735) [-1974.272] (-1973.924) -- 0:03:40
Average standard deviation of split frequencies: 0.000000
35500 -- (-1974.647) (-1975.495) [-1974.599] (-1972.742) * (-1983.685) (-1974.120) (-1974.633) [-1972.427] -- 0:03:37
36000 -- (-1976.416) [-1972.658] (-1972.679) (-1975.531) * (-1983.569) (-1979.507) [-1976.879] (-1978.494) -- 0:03:34
36500 -- (-1982.827) [-1976.521] (-1976.025) (-1974.363) * (-1977.462) (-1982.053) [-1975.693] (-1979.741) -- 0:03:31
37000 -- (-1982.427) (-1984.663) [-1975.610] (-1974.462) * (-1977.473) (-1976.978) [-1981.429] (-1978.795) -- 0:03:28
37500 -- [-1976.585] (-1977.943) (-1977.841) (-1974.829) * (-1987.409) [-1974.536] (-1980.393) (-1977.295) -- 0:03:25
38000 -- (-1977.297) (-1974.839) (-1979.401) [-1972.795] * [-1985.414] (-1976.304) (-1983.551) (-1978.444) -- 0:03:22
38500 -- [-1973.865] (-1979.252) (-1977.446) (-1973.507) * [-1977.717] (-1976.358) (-1981.410) (-1974.240) -- 0:03:19
39000 -- (-1975.686) [-1981.662] (-1977.626) (-1977.012) * (-1971.965) (-1975.413) [-1976.472] (-1975.820) -- 0:03:17
39500 -- (-1975.618) (-1976.866) [-1977.751] (-1974.703) * (-1977.941) (-1979.517) [-1977.869] (-1976.256) -- 0:03:38
40000 -- [-1972.697] (-1980.423) (-1977.421) (-1974.486) * (-1976.471) [-1980.552] (-1971.018) (-1975.593) -- 0:03:36
Average standard deviation of split frequencies: 0.000000
40500 -- (-1977.254) [-1973.789] (-1974.799) (-1976.145) * (-1974.821) (-1977.571) [-1976.048] (-1977.998) -- 0:03:33
41000 -- (-1977.490) [-1975.593] (-1982.944) (-1976.387) * (-1971.715) (-1975.535) (-1973.232) [-1977.310] -- 0:03:30
41500 -- [-1974.900] (-1981.060) (-1973.839) (-1977.988) * (-1980.109) [-1977.411] (-1973.780) (-1975.499) -- 0:03:27
42000 -- (-1976.501) (-1992.699) [-1977.918] (-1973.373) * (-1986.844) [-1973.439] (-1975.586) (-1981.535) -- 0:03:25
42500 -- (-1976.132) [-1982.219] (-1976.869) (-1988.546) * (-1977.642) [-1976.136] (-1973.874) (-1980.589) -- 0:03:22
43000 -- (-1980.418) (-1975.207) [-1973.945] (-1990.250) * (-1980.828) [-1973.041] (-1976.517) (-1973.396) -- 0:03:20
43500 -- (-1979.732) (-1972.937) [-1973.424] (-1977.151) * (-1975.824) [-1978.389] (-1977.023) (-1975.714) -- 0:03:17
44000 -- (-1980.316) (-1975.737) [-1973.632] (-1972.613) * [-1976.299] (-1980.621) (-1973.054) (-1976.854) -- 0:03:15
44500 -- [-1974.344] (-1977.191) (-1985.377) (-1980.320) * (-1976.284) (-1974.464) (-1974.847) [-1977.041] -- 0:03:34
45000 -- (-1975.234) [-1978.546] (-1980.768) (-1980.012) * (-1976.202) (-1971.001) (-1976.291) [-1972.118] -- 0:03:32
Average standard deviation of split frequencies: 0.000000
45500 -- (-1984.006) [-1975.784] (-1976.350) (-1977.424) * (-1975.279) [-1977.314] (-1975.435) (-1979.970) -- 0:03:29
46000 -- (-1975.774) (-1976.850) (-1975.542) [-1980.394] * (-1973.263) (-1974.960) [-1976.946] (-1977.317) -- 0:03:27
46500 -- [-1978.104] (-1975.701) (-1979.885) (-1982.382) * (-1975.678) (-1982.004) (-1979.813) [-1983.056] -- 0:03:25
47000 -- (-1983.229) (-1976.070) (-1973.998) [-1980.175] * (-1975.357) (-1974.345) (-1977.829) [-1979.665] -- 0:03:22
47500 -- (-1975.201) (-1982.331) [-1979.942] (-1978.195) * (-1979.802) [-1977.944] (-1977.469) (-1974.871) -- 0:03:20
48000 -- (-1976.611) [-1974.460] (-1973.693) (-1976.780) * (-1974.659) (-1978.904) (-1978.633) [-1976.160] -- 0:03:18
48500 -- (-1972.978) [-1976.265] (-1978.100) (-1979.378) * (-1975.114) [-1981.021] (-1981.399) (-1977.626) -- 0:03:16
49000 -- [-1976.726] (-1980.574) (-1975.570) (-1978.729) * [-1976.499] (-1984.625) (-1978.265) (-1972.372) -- 0:03:14
49500 -- (-1980.339) (-1983.565) (-1974.045) [-1976.600] * [-1977.794] (-1974.316) (-1980.754) (-1975.710) -- 0:03:31
50000 -- (-1976.769) (-1979.503) [-1976.743] (-1982.348) * [-1975.179] (-1978.751) (-1981.600) (-1976.255) -- 0:03:29
Average standard deviation of split frequencies: 0.000000
50500 -- [-1981.153] (-1985.698) (-1975.461) (-1981.095) * (-1980.074) [-1977.430] (-1973.915) (-1975.269) -- 0:03:26
51000 -- [-1977.697] (-1982.919) (-1982.759) (-1977.922) * (-1979.379) (-1982.970) [-1972.357] (-1976.552) -- 0:03:24
51500 -- [-1973.784] (-1981.044) (-1976.366) (-1983.693) * (-1975.904) (-1986.619) [-1974.476] (-1976.360) -- 0:03:22
52000 -- [-1975.818] (-1976.761) (-1982.716) (-1976.044) * [-1980.780] (-1990.008) (-1977.711) (-1977.374) -- 0:03:20
52500 -- (-1973.748) (-1982.226) (-1982.491) [-1973.093] * (-1977.029) (-1979.710) (-1973.652) [-1976.938] -- 0:03:18
53000 -- (-1977.676) [-1981.114] (-1978.527) (-1980.705) * [-1975.880] (-1980.016) (-1975.119) (-1984.573) -- 0:03:16
53500 -- [-1973.009] (-1982.407) (-1981.001) (-1977.410) * (-1979.397) (-1978.604) (-1983.034) [-1979.916] -- 0:03:14
54000 -- (-1973.379) (-1975.156) [-1976.916] (-1974.878) * [-1975.398] (-1979.367) (-1977.553) (-1983.099) -- 0:03:30
54500 -- (-1977.978) (-1976.487) (-1978.926) [-1972.754] * (-1974.990) [-1980.919] (-1974.657) (-1983.118) -- 0:03:28
55000 -- (-1978.509) [-1977.634] (-1977.942) (-1975.475) * [-1971.882] (-1980.882) (-1976.751) (-1983.087) -- 0:03:26
Average standard deviation of split frequencies: 0.000000
55500 -- [-1977.006] (-1973.426) (-1979.755) (-1972.117) * (-1972.691) (-1974.134) [-1976.064] (-1985.766) -- 0:03:24
56000 -- (-1977.106) (-1978.774) (-1976.012) [-1979.376] * (-1976.391) (-1976.466) (-1980.670) [-1985.633] -- 0:03:22
56500 -- (-1975.526) (-1973.162) (-1972.621) [-1976.189] * [-1974.823] (-1980.086) (-1989.537) (-1981.032) -- 0:03:20
57000 -- (-1976.787) (-1979.424) [-1974.658] (-1982.439) * (-1973.843) (-1976.178) [-1979.588] (-1979.574) -- 0:03:18
57500 -- (-1978.565) (-1972.158) (-1977.816) [-1981.423] * (-1974.520) (-1972.709) (-1978.293) [-1978.330] -- 0:03:16
58000 -- [-1983.747] (-1977.714) (-1974.664) (-1974.768) * [-1973.494] (-1974.994) (-1976.472) (-1982.744) -- 0:03:14
58500 -- (-1976.904) (-1975.625) [-1984.160] (-1977.920) * (-1979.498) (-1976.377) (-1979.466) [-1974.611] -- 0:03:13
59000 -- (-1981.269) (-1977.936) [-1975.298] (-1974.913) * (-1975.293) [-1975.631] (-1980.008) (-1977.497) -- 0:03:27
59500 -- (-1975.836) (-1974.255) [-1973.265] (-1974.546) * [-1977.234] (-1978.856) (-1982.988) (-1977.300) -- 0:03:25
60000 -- (-1972.476) (-1978.769) [-1972.649] (-1973.029) * (-1975.120) [-1974.523] (-1977.381) (-1977.636) -- 0:03:23
Average standard deviation of split frequencies: 0.000000
60500 -- (-1974.274) (-1979.988) [-1975.329] (-1979.225) * (-1978.223) [-1984.301] (-1976.019) (-1976.416) -- 0:03:21
61000 -- (-1970.270) (-1973.999) [-1977.102] (-1982.600) * (-1972.729) [-1976.288] (-1973.809) (-1984.131) -- 0:03:20
61500 -- (-1977.246) (-1973.972) (-1978.715) [-1977.441] * (-1971.208) [-1975.467] (-1981.200) (-1975.864) -- 0:03:18
62000 -- [-1979.514] (-1975.640) (-1974.018) (-1979.279) * (-1973.652) (-1976.777) [-1979.429] (-1973.328) -- 0:03:16
62500 -- (-1983.007) (-1976.979) [-1970.259] (-1977.049) * (-1976.572) [-1974.303] (-1977.685) (-1982.819) -- 0:03:15
63000 -- (-1982.893) (-1974.207) (-1972.672) [-1971.946] * (-1974.340) [-1977.458] (-1976.525) (-1981.135) -- 0:03:13
63500 -- (-1977.842) (-1975.429) (-1975.067) [-1976.882] * (-1979.192) [-1978.849] (-1978.397) (-1983.791) -- 0:03:26
64000 -- (-1980.339) (-1974.233) [-1975.564] (-1978.393) * [-1969.977] (-1980.706) (-1980.174) (-1976.754) -- 0:03:24
64500 -- (-1978.116) (-1979.663) (-1980.925) [-1975.547] * [-1972.301] (-1976.314) (-1975.132) (-1974.777) -- 0:03:23
65000 -- (-1979.835) (-1974.845) [-1977.041] (-1973.864) * (-1976.774) (-1975.987) [-1977.659] (-1981.228) -- 0:03:21
Average standard deviation of split frequencies: 0.000000
65500 -- [-1975.755] (-1981.554) (-1980.017) (-1973.857) * (-1977.357) (-1978.990) (-1979.355) [-1976.586] -- 0:03:19
66000 -- (-1978.604) (-1978.224) [-1976.451] (-1981.287) * (-1974.759) (-1977.470) (-1977.368) [-1987.575] -- 0:03:18
66500 -- [-1973.011] (-1979.970) (-1983.689) (-1983.612) * (-1976.481) [-1971.940] (-1980.439) (-1978.424) -- 0:03:16
67000 -- [-1974.612] (-1970.119) (-1981.057) (-1986.041) * (-1975.066) [-1973.932] (-1979.114) (-1984.959) -- 0:03:14
67500 -- (-1973.700) [-1973.521] (-1986.850) (-1978.684) * (-1970.516) (-1976.419) [-1974.014] (-1980.739) -- 0:03:13
68000 -- (-1986.939) (-1974.305) (-1982.275) [-1977.244] * (-1970.923) (-1976.154) [-1973.096] (-1978.317) -- 0:03:25
68500 -- (-1980.233) (-1976.271) (-1980.503) [-1982.451] * (-1977.654) (-1972.597) [-1977.977] (-1973.119) -- 0:03:23
69000 -- (-1974.715) (-1977.250) [-1976.317] (-1980.104) * [-1979.736] (-1974.719) (-1975.540) (-1976.369) -- 0:03:22
69500 -- (-1977.095) (-1975.279) (-1975.355) [-1977.955] * [-1981.291] (-1980.750) (-1974.669) (-1974.392) -- 0:03:20
70000 -- [-1974.083] (-1974.615) (-1971.027) (-1984.986) * (-1973.335) [-1977.035] (-1976.822) (-1976.423) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
70500 -- [-1970.869] (-1979.803) (-1974.845) (-1980.562) * (-1972.531) (-1971.265) [-1974.385] (-1973.120) -- 0:03:17
71000 -- (-1974.155) [-1978.893] (-1976.263) (-1984.284) * (-1976.646) (-1977.146) [-1975.004] (-1983.020) -- 0:03:16
71500 -- [-1972.162] (-1971.971) (-1975.316) (-1984.274) * [-1974.756] (-1973.940) (-1978.677) (-1975.707) -- 0:03:14
72000 -- (-1971.277) (-1975.708) (-1978.932) [-1978.501] * (-1985.357) (-1975.985) (-1980.368) [-1979.466] -- 0:03:13
72500 -- [-1973.047] (-1980.501) (-1973.080) (-1978.339) * (-1979.594) (-1979.412) (-1977.418) [-1978.820] -- 0:03:11
73000 -- [-1973.514] (-1977.512) (-1977.824) (-1976.444) * (-1974.786) [-1978.027] (-1977.056) (-1977.264) -- 0:03:23
73500 -- [-1973.983] (-1973.661) (-1975.387) (-1976.700) * (-1980.791) [-1974.353] (-1977.615) (-1976.162) -- 0:03:21
74000 -- (-1986.364) (-1977.003) (-1976.911) [-1972.794] * (-1975.211) [-1978.630] (-1980.329) (-1985.877) -- 0:03:20
74500 -- [-1975.049] (-1976.799) (-1977.615) (-1976.287) * (-1982.685) [-1974.859] (-1982.515) (-1990.656) -- 0:03:18
75000 -- (-1979.164) [-1974.365] (-1977.174) (-1979.110) * (-1987.503) (-1980.016) [-1978.141] (-1989.574) -- 0:03:17
Average standard deviation of split frequencies: 0.000000
75500 -- (-1976.074) (-1975.565) (-1974.534) [-1974.858] * (-1976.904) [-1975.553] (-1977.220) (-1983.456) -- 0:03:15
76000 -- (-1975.342) (-1973.823) [-1974.963] (-1979.814) * (-1979.941) (-1978.824) (-1975.822) [-1974.332] -- 0:03:14
76500 -- (-1985.224) [-1976.518] (-1974.547) (-1976.810) * (-1983.983) (-1973.288) (-1973.282) [-1974.948] -- 0:03:13
77000 -- (-1976.281) (-1980.422) [-1977.016] (-1982.721) * (-1982.589) (-1982.509) [-1976.686] (-1971.145) -- 0:03:11
77500 -- [-1975.484] (-1979.608) (-1972.102) (-1982.337) * (-1977.396) [-1975.087] (-1979.128) (-1979.501) -- 0:03:22
78000 -- (-1975.622) (-1977.226) (-1975.647) [-1973.312] * (-1980.148) (-1976.366) [-1981.209] (-1980.479) -- 0:03:20
78500 -- (-1978.799) (-1976.465) [-1972.844] (-1977.596) * (-1979.902) (-1978.395) [-1975.406] (-1985.621) -- 0:03:19
79000 -- (-1970.965) (-1973.269) [-1979.180] (-1978.030) * (-1976.812) [-1984.530] (-1976.218) (-1985.528) -- 0:03:18
79500 -- (-1977.005) (-1973.004) (-1977.754) [-1976.653] * (-1978.171) (-1986.972) [-1978.613] (-1973.484) -- 0:03:16
80000 -- (-1976.933) (-1976.253) [-1976.425] (-1974.797) * [-1976.570] (-1988.482) (-1985.587) (-1974.745) -- 0:03:15
Average standard deviation of split frequencies: 0.000000
80500 -- [-1979.827] (-1975.201) (-1977.513) (-1973.269) * (-1978.413) (-1985.040) [-1975.649] (-1981.065) -- 0:03:14
81000 -- (-1983.180) (-1974.090) (-1972.247) [-1971.945] * (-1982.031) (-1985.277) (-1974.171) [-1977.036] -- 0:03:12
81500 -- [-1978.104] (-1971.875) (-1977.578) (-1975.934) * (-1975.358) (-1984.758) [-1975.644] (-1981.688) -- 0:03:22
82000 -- (-1980.109) (-1978.088) (-1979.651) [-1975.419] * (-1973.766) (-1981.724) (-1978.905) [-1975.971] -- 0:03:21
82500 -- [-1980.936] (-1977.936) (-1987.824) (-1977.296) * [-1976.861] (-1982.656) (-1977.952) (-1976.354) -- 0:03:20
83000 -- (-1978.366) (-1977.333) (-1981.549) [-1976.838] * (-1976.659) [-1977.196] (-1983.753) (-1981.652) -- 0:03:18
83500 -- [-1978.899] (-1978.400) (-1981.989) (-1970.672) * (-1980.770) (-1986.199) [-1977.388] (-1982.125) -- 0:03:17
84000 -- [-1975.836] (-1980.609) (-1981.243) (-1976.568) * (-1978.552) [-1979.052] (-1979.256) (-1977.945) -- 0:03:16
84500 -- [-1975.310] (-1980.975) (-1975.971) (-1982.663) * (-1980.114) (-1977.876) (-1973.657) [-1974.142] -- 0:03:15
85000 -- (-1973.727) (-1981.307) [-1972.301] (-1976.916) * (-1985.018) (-1979.829) [-1978.620] (-1976.716) -- 0:03:13
Average standard deviation of split frequencies: 0.000000
85500 -- (-1978.128) (-1977.145) [-1972.867] (-1977.561) * [-1975.609] (-1980.858) (-1976.043) (-1974.170) -- 0:03:12
86000 -- (-1973.768) (-1974.876) [-1977.935] (-1978.357) * [-1975.605] (-1976.289) (-1976.092) (-1979.474) -- 0:03:11
86500 -- (-1980.065) (-1984.960) (-1976.186) [-1975.884] * (-1975.488) (-1975.566) [-1972.452] (-1978.431) -- 0:03:20
87000 -- (-1978.546) (-1980.736) (-1974.802) [-1973.727] * (-1986.135) [-1981.616] (-1977.128) (-1980.734) -- 0:03:19
87500 -- (-1979.925) (-1974.505) [-1973.967] (-1973.470) * [-1972.330] (-1976.190) (-1978.227) (-1985.575) -- 0:03:18
88000 -- [-1978.073] (-1976.820) (-1977.967) (-1974.434) * [-1972.862] (-1980.775) (-1978.481) (-1976.685) -- 0:03:16
88500 -- (-1977.078) (-1981.374) (-1978.485) [-1973.639] * [-1974.251] (-1973.862) (-1980.765) (-1978.400) -- 0:03:15
89000 -- (-1977.729) (-1974.954) (-1978.409) [-1968.743] * [-1978.234] (-1975.936) (-1980.074) (-1979.859) -- 0:03:14
89500 -- (-1984.037) [-1977.057] (-1995.768) (-1971.404) * (-1976.458) [-1974.368] (-1982.733) (-1973.965) -- 0:03:13
90000 -- [-1976.060] (-1981.257) (-1979.232) (-1976.433) * (-1981.073) [-1974.236] (-1975.103) (-1979.329) -- 0:03:12
Average standard deviation of split frequencies: 0.000000
90500 -- (-1973.736) [-1975.912] (-1982.364) (-1988.286) * [-1979.245] (-1978.775) (-1976.355) (-1979.327) -- 0:03:10
91000 -- (-1973.307) (-1977.232) (-1982.324) [-1979.268] * (-1977.319) [-1978.972] (-1981.669) (-1976.094) -- 0:03:09
91500 -- (-1977.702) (-1974.737) (-1980.413) [-1977.829] * (-1981.962) (-1974.289) [-1977.422] (-1971.893) -- 0:03:18
92000 -- (-1976.701) (-1977.712) (-1979.009) [-1976.357] * (-1980.023) (-1983.438) (-1974.935) [-1973.028] -- 0:03:17
92500 -- (-1984.003) (-1978.547) (-1989.220) [-1977.352] * [-1973.074] (-1979.089) (-1978.674) (-1978.240) -- 0:03:16
93000 -- [-1978.600] (-1973.087) (-1983.923) (-1973.357) * (-1975.667) [-1978.243] (-1982.094) (-1980.313) -- 0:03:15
93500 -- (-1977.972) (-1979.180) [-1975.506] (-1978.582) * (-1974.356) (-1977.258) (-1978.268) [-1974.294] -- 0:03:13
94000 -- (-1980.749) (-1976.096) [-1978.844] (-1977.803) * (-1975.813) (-1974.974) (-1977.126) [-1971.387] -- 0:03:12
94500 -- [-1977.228] (-1971.204) (-1981.073) (-1978.269) * [-1981.938] (-1974.323) (-1980.369) (-1977.432) -- 0:03:11
95000 -- [-1981.209] (-1978.709) (-1978.119) (-1973.849) * [-1980.509] (-1976.612) (-1984.656) (-1977.305) -- 0:03:10
Average standard deviation of split frequencies: 0.000000
95500 -- [-1975.254] (-1970.674) (-1979.455) (-1990.866) * (-1981.248) (-1975.605) [-1978.253] (-1977.988) -- 0:03:09
96000 -- (-1971.420) (-1977.156) (-1984.069) [-1982.701] * (-1979.438) (-1973.540) [-1976.039] (-1978.048) -- 0:03:17
96500 -- [-1976.212] (-1972.218) (-1987.379) (-1974.339) * [-1975.759] (-1978.614) (-1980.857) (-1974.795) -- 0:03:16
97000 -- (-1974.448) (-1977.546) [-1978.173] (-1980.817) * (-1979.643) (-1975.690) (-1974.932) [-1980.104] -- 0:03:15
97500 -- (-1976.043) [-1974.942] (-1986.475) (-1975.587) * (-1981.555) [-1972.835] (-1976.894) (-1977.215) -- 0:03:14
98000 -- (-1984.479) (-1980.340) [-1976.070] (-1981.748) * (-1977.188) [-1975.274] (-1975.552) (-1974.289) -- 0:03:13
98500 -- (-1972.749) [-1979.879] (-1976.420) (-1981.232) * (-1976.623) (-1974.524) [-1970.253] (-1969.356) -- 0:03:12
99000 -- (-1975.002) (-1980.392) [-1972.047] (-1979.232) * (-1979.321) [-1974.952] (-1972.480) (-1972.074) -- 0:03:11
99500 -- [-1972.099] (-1986.276) (-1973.671) (-1980.434) * (-1973.201) (-1978.812) [-1973.517] (-1974.669) -- 0:03:10
100000 -- (-1975.314) (-1981.421) [-1974.387] (-1981.687) * [-1976.431] (-1975.662) (-1974.768) (-1977.249) -- 0:03:09
Average standard deviation of split frequencies: 0.000000
100500 -- [-1984.021] (-1976.996) (-1974.381) (-1975.248) * (-1976.562) (-1978.501) [-1977.765] (-1978.143) -- 0:03:07
101000 -- (-1975.796) (-1982.177) (-1975.333) [-1972.968] * [-1972.894] (-1974.947) (-1977.544) (-1984.227) -- 0:03:15
101500 -- (-1974.075) (-1979.248) [-1977.351] (-1978.704) * (-1975.786) [-1978.331] (-1980.112) (-1982.240) -- 0:03:14
102000 -- [-1973.623] (-1978.706) (-1971.475) (-1977.517) * (-1975.978) (-1980.220) [-1974.902] (-1979.843) -- 0:03:13
102500 -- [-1976.891] (-1981.953) (-1980.914) (-1974.348) * (-1972.661) [-1971.737] (-1981.824) (-1977.437) -- 0:03:12
103000 -- (-1981.265) (-1991.623) (-1979.972) [-1972.504] * (-1985.447) (-1975.501) [-1973.811] (-1986.665) -- 0:03:11
103500 -- (-1979.281) (-1979.324) [-1978.584] (-1976.596) * (-1979.335) (-1978.232) [-1971.704] (-1978.317) -- 0:03:10
104000 -- (-1972.304) (-1980.047) [-1979.601] (-1971.748) * [-1973.652] (-1979.720) (-1977.160) (-1979.049) -- 0:03:09
104500 -- (-1975.482) (-1975.931) (-1975.308) [-1974.946] * (-1979.819) [-1976.436] (-1978.962) (-1974.409) -- 0:03:08
105000 -- (-1977.949) [-1976.859] (-1972.430) (-1973.314) * [-1976.414] (-1982.893) (-1975.378) (-1980.671) -- 0:03:07
Average standard deviation of split frequencies: 0.000000
105500 -- (-1973.874) (-1976.150) [-1977.357] (-1976.275) * (-1979.656) [-1973.212] (-1975.256) (-1976.265) -- 0:03:15
106000 -- [-1974.870] (-1971.956) (-1979.070) (-1975.991) * [-1978.686] (-1975.866) (-1981.041) (-1976.005) -- 0:03:13
106500 -- (-1982.679) (-1971.488) [-1977.316] (-1982.732) * (-1980.687) [-1971.690] (-1978.094) (-1973.719) -- 0:03:12
107000 -- (-1986.510) [-1972.227] (-1973.264) (-1978.012) * (-1985.248) [-1975.062] (-1976.018) (-1977.176) -- 0:03:11
107500 -- (-1983.684) (-1981.295) [-1973.531] (-1983.040) * (-1985.144) [-1976.873] (-1974.666) (-1979.511) -- 0:03:10
108000 -- (-1982.752) [-1979.519] (-1978.208) (-1978.143) * (-1981.124) [-1975.408] (-1971.912) (-1973.471) -- 0:03:09
108500 -- (-1981.455) (-1973.595) [-1976.633] (-1984.661) * (-1982.567) (-1975.140) (-1977.487) [-1975.687] -- 0:03:08
109000 -- [-1976.332] (-1974.147) (-1974.993) (-1973.819) * (-1982.125) [-1977.618] (-1974.149) (-1975.701) -- 0:03:08
109500 -- (-1975.852) (-1973.611) [-1974.402] (-1975.834) * [-1974.063] (-1977.710) (-1984.169) (-1979.695) -- 0:03:07
110000 -- (-1979.209) [-1976.642] (-1978.895) (-1977.307) * (-1976.956) (-1984.116) (-1978.469) [-1976.651] -- 0:03:06
Average standard deviation of split frequencies: 0.000000
110500 -- (-1976.882) (-1978.297) (-1972.373) [-1977.853] * [-1978.834] (-1983.236) (-1983.875) (-1981.747) -- 0:03:13
111000 -- [-1976.076] (-1973.836) (-1979.582) (-1973.418) * [-1975.551] (-1975.582) (-1981.491) (-1977.517) -- 0:03:12
111500 -- [-1979.606] (-1976.134) (-1977.347) (-1981.799) * (-1978.238) [-1978.480] (-1975.870) (-1982.307) -- 0:03:11
112000 -- (-1986.213) (-1972.321) [-1978.098] (-1974.308) * (-1982.472) (-1983.046) [-1976.460] (-1978.375) -- 0:03:10
112500 -- (-1976.572) [-1981.285] (-1979.075) (-1982.134) * [-1975.451] (-1982.788) (-1975.566) (-1970.993) -- 0:03:09
113000 -- (-1976.199) (-1977.419) (-1975.431) [-1987.004] * (-1976.812) (-1972.693) (-1980.605) [-1975.797] -- 0:03:08
113500 -- (-1976.153) [-1982.839] (-1979.195) (-1976.250) * (-1975.759) [-1977.622] (-1977.173) (-1974.369) -- 0:03:07
114000 -- (-1976.517) [-1973.995] (-1990.909) (-1983.402) * (-1973.310) (-1981.775) (-1981.511) [-1973.573] -- 0:03:06
114500 -- [-1980.092] (-1974.682) (-1976.400) (-1986.256) * [-1973.833] (-1978.767) (-1974.526) (-1983.759) -- 0:03:05
115000 -- (-1978.472) [-1974.999] (-1983.075) (-1976.504) * (-1975.748) [-1973.523] (-1981.160) (-1975.848) -- 0:03:04
Average standard deviation of split frequencies: 0.000000
115500 -- (-1979.670) (-1974.871) [-1973.479] (-1974.730) * (-1978.546) (-1976.329) (-1979.887) [-1977.912] -- 0:03:11
116000 -- (-1978.670) [-1980.881] (-1979.882) (-1973.330) * (-1974.993) (-1975.292) (-1976.403) [-1982.197] -- 0:03:10
116500 -- (-1980.397) [-1980.348] (-1982.051) (-1972.563) * [-1977.408] (-1981.353) (-1985.718) (-1982.534) -- 0:03:09
117000 -- [-1978.395] (-1977.729) (-1990.618) (-1986.116) * (-1980.970) [-1976.571] (-1978.391) (-1975.543) -- 0:03:08
117500 -- (-1977.634) (-1971.907) [-1973.348] (-1980.585) * [-1976.521] (-1975.687) (-1975.574) (-1978.549) -- 0:03:07
118000 -- (-1977.339) (-1975.719) [-1979.619] (-1977.835) * (-1976.252) (-1982.186) [-1976.684] (-1983.967) -- 0:03:06
118500 -- (-1977.860) (-1972.519) [-1973.701] (-1978.178) * (-1976.360) (-1982.968) [-1975.005] (-1977.398) -- 0:03:05
119000 -- (-1984.218) (-1976.432) (-1976.078) [-1975.055] * (-1971.808) (-1982.755) [-1976.756] (-1980.654) -- 0:03:05
119500 -- (-1978.650) [-1978.490] (-1978.869) (-1976.168) * [-1981.194] (-1975.036) (-1980.388) (-1982.773) -- 0:03:04
120000 -- (-1974.969) [-1976.069] (-1977.125) (-1978.318) * (-1973.746) (-1983.415) [-1973.956] (-1978.510) -- 0:03:03
Average standard deviation of split frequencies: 0.000000
120500 -- (-1977.578) [-1974.910] (-1978.152) (-1978.756) * (-1975.909) (-1976.281) [-1971.054] (-1974.593) -- 0:03:09
121000 -- [-1978.840] (-1976.338) (-1979.445) (-1980.400) * (-1979.861) (-1973.741) [-1975.819] (-1976.783) -- 0:03:08
121500 -- (-1981.180) (-1975.031) [-1975.073] (-1973.764) * (-1983.344) (-1978.987) [-1978.151] (-1977.210) -- 0:03:07
122000 -- (-1973.999) (-1977.684) (-1983.485) [-1976.633] * (-1980.689) (-1975.367) (-1977.328) [-1973.847] -- 0:03:07
122500 -- [-1976.125] (-1971.245) (-1980.611) (-1973.043) * (-1979.472) [-1983.612] (-1978.453) (-1975.426) -- 0:03:06
123000 -- (-1976.045) (-1978.856) (-1979.066) [-1976.759] * (-1979.601) [-1975.870] (-1987.053) (-1974.055) -- 0:03:05
123500 -- (-1973.441) (-1975.673) [-1974.559] (-1971.864) * (-1975.505) [-1974.388] (-1973.136) (-1980.927) -- 0:03:04
124000 -- (-1975.568) (-1988.883) (-1978.829) [-1971.710] * (-1984.692) (-1975.450) (-1973.604) [-1976.595] -- 0:03:03
124500 -- (-1980.926) (-1981.490) [-1982.691] (-1981.153) * (-1974.308) [-1972.999] (-1973.596) (-1976.811) -- 0:03:02
125000 -- [-1979.530] (-1974.003) (-1976.658) (-1977.151) * (-1975.986) (-1974.697) [-1976.885] (-1981.191) -- 0:03:09
Average standard deviation of split frequencies: 0.000000
125500 -- (-1974.008) (-1977.090) (-1979.116) [-1981.313] * (-1976.340) [-1971.684] (-1977.528) (-1975.408) -- 0:03:08
126000 -- (-1977.871) (-1975.367) [-1977.589] (-1976.916) * (-1979.293) (-1974.689) [-1978.095] (-1979.530) -- 0:03:07
126500 -- (-1977.712) (-1974.524) [-1973.800] (-1983.754) * [-1982.867] (-1974.819) (-1975.096) (-1974.531) -- 0:03:06
127000 -- (-1974.917) (-1976.466) [-1971.811] (-1978.659) * [-1974.051] (-1975.676) (-1978.237) (-1975.750) -- 0:03:05
127500 -- (-1974.622) [-1976.647] (-1975.866) (-1976.945) * (-1984.860) (-1976.242) (-1975.695) [-1975.544] -- 0:03:04
128000 -- [-1970.523] (-1981.544) (-1972.852) (-1972.416) * (-1984.686) [-1975.485] (-1979.747) (-1982.038) -- 0:03:03
128500 -- (-1974.351) (-1980.281) (-1973.230) [-1975.594] * [-1975.927] (-1976.731) (-1977.200) (-1972.529) -- 0:03:03
129000 -- (-1976.412) (-1977.779) (-1977.814) [-1979.620] * [-1978.299] (-1979.457) (-1975.073) (-1973.827) -- 0:03:02
129500 -- (-1978.866) [-1978.653] (-1976.043) (-1978.191) * [-1984.049] (-1981.378) (-1979.338) (-1976.528) -- 0:03:01
130000 -- (-1977.018) [-1982.134] (-1979.967) (-1978.196) * (-1986.084) (-1977.330) (-1979.208) [-1977.268] -- 0:03:07
Average standard deviation of split frequencies: 0.000000
130500 -- (-1974.723) [-1979.123] (-1972.946) (-1974.424) * (-1980.009) [-1982.178] (-1980.892) (-1975.202) -- 0:03:06
131000 -- (-1975.866) (-1982.111) [-1975.462] (-1980.147) * (-1980.365) [-1983.078] (-1980.904) (-1984.943) -- 0:03:05
131500 -- (-1984.569) (-1980.577) [-1977.323] (-1982.742) * (-1980.458) [-1982.144] (-1982.636) (-1974.085) -- 0:03:04
132000 -- [-1975.732] (-1976.902) (-1971.590) (-1977.510) * [-1973.221] (-1976.391) (-1984.612) (-1975.339) -- 0:03:04
132500 -- (-1974.410) (-1976.764) (-1975.552) [-1975.261] * (-1975.237) (-1978.875) (-1986.053) [-1978.234] -- 0:03:03
133000 -- (-1979.282) (-1977.720) (-1978.610) [-1980.379] * [-1979.115] (-1977.152) (-1981.212) (-1975.379) -- 0:03:02
133500 -- (-1984.365) (-1974.272) [-1974.104] (-1975.025) * (-1977.768) (-1978.909) [-1981.289] (-1972.532) -- 0:03:01
134000 -- [-1977.137] (-1973.117) (-1976.457) (-1978.981) * (-1977.265) [-1974.080] (-1980.345) (-1975.180) -- 0:03:00
134500 -- (-1978.496) [-1976.570] (-1979.214) (-1976.180) * (-1979.796) [-1975.050] (-1977.761) (-1978.674) -- 0:03:06
135000 -- (-1971.957) (-1981.319) [-1977.710] (-1976.135) * (-1977.946) [-1973.806] (-1979.827) (-1971.655) -- 0:03:05
Average standard deviation of split frequencies: 0.000000
135500 -- [-1974.713] (-1978.098) (-1977.981) (-1972.508) * (-1976.496) (-1971.901) (-1977.724) [-1979.654] -- 0:03:05
136000 -- (-1974.712) (-1976.069) (-1985.054) [-1980.543] * (-1977.871) [-1977.564] (-1986.460) (-1977.061) -- 0:03:04
136500 -- (-1975.630) (-1977.788) [-1978.237] (-1975.574) * (-1977.988) [-1972.691] (-1979.577) (-1973.132) -- 0:03:03
137000 -- (-1984.245) [-1982.293] (-1981.639) (-1976.367) * (-1977.975) (-1973.815) (-1978.000) [-1978.792] -- 0:03:02
137500 -- (-1987.823) (-1979.730) [-1973.619] (-1977.933) * (-1977.743) (-1973.650) (-1974.988) [-1985.906] -- 0:03:01
138000 -- (-1985.491) (-1981.894) (-1979.583) [-1975.497] * (-1980.486) [-1977.010] (-1980.456) (-1979.914) -- 0:03:01
138500 -- [-1974.802] (-1983.125) (-1974.560) (-1972.947) * (-1981.210) [-1972.404] (-1976.101) (-1977.888) -- 0:03:00
139000 -- (-1977.127) [-1980.451] (-1980.597) (-1975.534) * (-1978.675) (-1976.069) [-1973.843] (-1979.746) -- 0:02:59
139500 -- (-1971.608) (-1975.842) [-1972.372] (-1973.113) * (-1979.636) (-1972.020) (-1977.557) [-1979.835] -- 0:03:05
140000 -- (-1978.595) (-1981.450) [-1971.525] (-1981.087) * [-1973.620] (-1981.612) (-1977.788) (-1980.593) -- 0:03:04
Average standard deviation of split frequencies: 0.000000
140500 -- (-1975.350) (-1974.055) [-1978.688] (-1981.059) * (-1974.040) (-1978.432) (-1971.607) [-1975.881] -- 0:03:03
141000 -- (-1975.878) [-1978.359] (-1979.477) (-1980.179) * (-1982.011) (-1977.915) [-1973.459] (-1982.623) -- 0:03:02
141500 -- (-1980.987) (-1982.082) [-1978.330] (-1981.622) * (-1977.160) (-1974.301) [-1978.787] (-1981.848) -- 0:03:02
142000 -- [-1974.823] (-1978.122) (-1980.902) (-1977.358) * [-1975.786] (-1973.124) (-1977.564) (-1980.901) -- 0:03:01
142500 -- [-1978.943] (-1975.381) (-1980.290) (-1972.873) * (-1973.571) [-1973.961] (-1974.956) (-1978.765) -- 0:03:00
143000 -- [-1978.874] (-1978.441) (-1979.182) (-1983.490) * [-1977.081] (-1979.456) (-1972.322) (-1980.480) -- 0:02:59
143500 -- (-1978.968) (-1976.058) (-1977.390) [-1981.222] * (-1977.256) (-1980.544) (-1979.983) [-1978.709] -- 0:02:59
144000 -- (-1980.154) (-1977.904) [-1975.129] (-1976.699) * [-1975.152] (-1982.811) (-1981.605) (-1973.223) -- 0:02:58
144500 -- (-1976.207) [-1978.278] (-1979.164) (-1976.747) * (-1974.463) [-1976.810] (-1971.656) (-1977.378) -- 0:03:03
145000 -- (-1976.151) (-1981.901) [-1982.742] (-1974.230) * (-1976.674) (-1976.541) (-1972.776) [-1977.718] -- 0:03:02
Average standard deviation of split frequencies: 0.000000
145500 -- (-1988.125) [-1978.093] (-1985.272) (-1977.868) * [-1976.091] (-1980.549) (-1975.512) (-1975.934) -- 0:03:02
146000 -- (-1975.574) (-1982.406) (-1976.661) [-1978.547] * [-1974.780] (-1975.756) (-1975.623) (-1977.778) -- 0:03:01
146500 -- (-1970.133) (-1976.708) [-1975.403] (-1979.012) * [-1972.742] (-1974.735) (-1975.320) (-1979.266) -- 0:03:00
147000 -- (-1983.784) (-1978.737) [-1973.885] (-1974.397) * (-1972.655) (-1973.941) (-1981.744) [-1974.681] -- 0:02:59
147500 -- (-1985.742) (-1974.139) [-1972.962] (-1977.202) * [-1972.589] (-1984.174) (-1996.302) (-1974.673) -- 0:02:59
148000 -- (-1984.082) [-1974.188] (-1975.956) (-1976.086) * (-1971.355) (-1980.724) (-1977.720) [-1973.363] -- 0:02:58
148500 -- (-1979.939) [-1976.926] (-1975.688) (-1979.504) * (-1975.541) (-1979.021) [-1980.760] (-1976.532) -- 0:02:57
149000 -- (-1978.385) [-1975.384] (-1976.186) (-1980.752) * (-1981.198) [-1974.970] (-1978.382) (-1979.380) -- 0:03:02
149500 -- (-1976.260) [-1981.790] (-1976.605) (-1986.133) * (-1979.047) (-1973.990) [-1973.346] (-1977.090) -- 0:03:02
150000 -- [-1977.112] (-1976.072) (-1976.339) (-1977.990) * (-1976.643) [-1970.965] (-1979.753) (-1977.432) -- 0:03:01
Average standard deviation of split frequencies: 0.000000
150500 -- (-1980.355) (-1978.384) [-1976.206] (-1980.370) * (-1973.340) [-1980.335] (-1976.597) (-1978.813) -- 0:03:00
151000 -- [-1978.363] (-1981.315) (-1974.662) (-1978.154) * [-1976.062] (-1984.230) (-1978.016) (-1978.598) -- 0:02:59
151500 -- [-1982.812] (-1978.414) (-1971.465) (-1978.564) * [-1974.650] (-1977.207) (-1975.308) (-1981.232) -- 0:02:59
152000 -- (-1976.510) (-1981.803) [-1971.695] (-1973.999) * (-1972.761) [-1974.647] (-1979.826) (-1980.300) -- 0:02:58
152500 -- (-1980.210) (-1978.051) [-1977.840] (-1983.986) * (-1977.937) (-1976.005) (-1978.285) [-1984.836] -- 0:02:57
153000 -- (-1978.601) (-1975.409) [-1978.999] (-1976.035) * (-1975.635) (-1979.738) [-1973.629] (-1975.624) -- 0:02:57
153500 -- (-1980.829) (-1977.909) [-1974.764] (-1978.847) * (-1980.906) [-1977.087] (-1974.321) (-1974.549) -- 0:02:56
154000 -- (-1979.102) [-1978.192] (-1983.651) (-1977.321) * (-1982.864) [-1971.686] (-1976.915) (-1985.747) -- 0:03:01
154500 -- (-1974.855) (-1977.505) (-1980.144) [-1977.997] * (-1979.206) [-1976.531] (-1974.273) (-1974.951) -- 0:03:00
155000 -- [-1975.866] (-1981.511) (-1984.225) (-1977.115) * (-1974.293) (-1972.775) (-1979.614) [-1973.893] -- 0:02:59
Average standard deviation of split frequencies: 0.000000
155500 -- [-1980.555] (-1978.490) (-1986.926) (-1978.160) * (-1974.339) [-1974.820] (-1982.268) (-1985.393) -- 0:02:59
156000 -- (-1971.662) (-1975.599) (-1980.702) [-1980.264] * [-1972.965] (-1980.772) (-1978.697) (-1977.517) -- 0:02:58
156500 -- (-1970.414) [-1975.512] (-1976.952) (-1973.980) * (-1973.442) (-1980.372) (-1978.407) [-1978.779] -- 0:02:57
157000 -- (-1977.370) (-1977.294) (-1977.177) [-1976.884] * [-1973.887] (-1973.512) (-1982.299) (-1985.348) -- 0:02:57
157500 -- [-1979.587] (-1973.797) (-1976.690) (-1979.664) * (-1981.002) [-1978.528] (-1981.649) (-1978.668) -- 0:02:56
158000 -- (-1976.138) [-1976.768] (-1978.955) (-1983.315) * (-1981.073) (-1979.202) (-1976.723) [-1973.299] -- 0:02:55
158500 -- (-1977.435) (-1975.103) [-1975.325] (-1980.289) * (-1979.789) (-1986.354) (-1975.974) [-1974.273] -- 0:02:55
159000 -- (-1987.536) (-1978.046) (-1979.634) [-1981.553] * (-1984.675) [-1973.402] (-1979.988) (-1980.764) -- 0:02:59
159500 -- (-1979.128) [-1979.816] (-1976.593) (-1983.022) * [-1986.910] (-1971.920) (-1986.416) (-1978.937) -- 0:02:59
160000 -- (-1974.683) [-1973.918] (-1976.031) (-1979.345) * (-1987.546) (-1977.336) (-1986.762) [-1973.791] -- 0:02:58
Average standard deviation of split frequencies: 0.000000
160500 -- (-1974.305) (-1979.117) [-1973.150] (-1977.938) * [-1985.241] (-1989.723) (-1979.521) (-1980.281) -- 0:02:57
161000 -- [-1979.513] (-1981.417) (-1977.948) (-1979.898) * (-1983.382) (-1982.212) [-1980.575] (-1974.518) -- 0:02:57
161500 -- [-1980.047] (-1975.792) (-1978.048) (-1980.286) * (-1981.573) (-1982.738) (-1974.379) [-1974.544] -- 0:02:56
162000 -- (-1982.617) [-1976.467] (-1979.675) (-1977.803) * (-1977.652) (-1979.912) (-1972.869) [-1980.507] -- 0:02:55
162500 -- (-1975.059) [-1980.531] (-1973.408) (-1975.313) * (-1977.035) (-1976.171) (-1974.118) [-1976.662] -- 0:02:55
163000 -- (-1973.745) (-1974.664) [-1977.883] (-1973.824) * (-1974.453) (-1982.655) (-1974.837) [-1975.461] -- 0:02:54
163500 -- (-1978.389) [-1973.460] (-1977.918) (-1977.118) * (-1979.969) (-1973.622) (-1973.349) [-1981.090] -- 0:02:53
164000 -- [-1974.692] (-1973.986) (-1977.788) (-1978.320) * (-1976.772) (-1975.637) [-1980.844] (-1987.125) -- 0:02:58
164500 -- (-1976.433) [-1974.095] (-1973.917) (-1982.908) * (-1982.345) (-1976.326) [-1983.082] (-1976.952) -- 0:02:57
165000 -- [-1973.599] (-1977.485) (-1978.006) (-1975.166) * (-1971.411) (-1976.619) (-1986.300) [-1978.594] -- 0:02:57
Average standard deviation of split frequencies: 0.000000
165500 -- (-1977.289) [-1974.749] (-1973.351) (-1974.822) * (-1978.570) [-1978.162] (-1982.994) (-1985.377) -- 0:02:56
166000 -- [-1975.026] (-1976.102) (-1971.647) (-1980.629) * (-1980.623) (-1978.899) (-1976.508) [-1977.677] -- 0:02:55
166500 -- (-1981.966) [-1973.577] (-1974.236) (-1975.529) * (-1982.205) (-1985.286) [-1975.276] (-1977.200) -- 0:02:55
167000 -- (-1976.088) [-1974.631] (-1976.477) (-1977.380) * (-1982.502) [-1974.128] (-1976.325) (-1982.143) -- 0:02:54
167500 -- (-1972.479) (-1978.192) [-1971.911] (-1977.514) * [-1970.758] (-1974.030) (-1977.568) (-1973.925) -- 0:02:53
168000 -- (-1973.935) [-1976.014] (-1972.593) (-1982.616) * (-1979.792) (-1973.806) [-1976.996] (-1975.056) -- 0:02:53
168500 -- (-1980.346) (-1978.793) (-1980.356) [-1979.758] * (-1971.540) (-1976.214) (-1977.815) [-1978.695] -- 0:02:57
169000 -- (-1970.878) (-1976.287) [-1975.728] (-1972.206) * (-1979.325) [-1978.479] (-1978.779) (-1978.892) -- 0:02:57
169500 -- (-1974.044) (-1980.856) [-1972.474] (-1978.851) * (-1975.174) (-1981.064) [-1979.616] (-1986.978) -- 0:02:56
170000 -- (-1975.069) [-1979.676] (-1977.321) (-1981.482) * (-1976.332) (-1982.899) (-1976.513) [-1976.152] -- 0:02:55
Average standard deviation of split frequencies: 0.000000
170500 -- (-1977.666) (-1982.615) (-1976.997) [-1976.970] * [-1976.849] (-1974.807) (-1977.548) (-1977.934) -- 0:02:55
171000 -- [-1971.923] (-1985.961) (-1973.539) (-1977.865) * [-1975.374] (-1982.972) (-1980.227) (-1979.558) -- 0:02:54
171500 -- (-1980.639) (-1984.918) (-1975.661) [-1979.933] * (-1981.340) (-1980.662) (-1978.595) [-1978.472] -- 0:02:53
172000 -- (-1977.570) (-1980.928) [-1973.663] (-1974.787) * (-1983.462) (-1979.585) [-1972.375] (-1983.654) -- 0:02:53
172500 -- (-1984.205) [-1976.776] (-1981.309) (-1974.600) * [-1978.171] (-1976.575) (-1975.611) (-1980.697) -- 0:02:52
173000 -- (-1980.785) [-1972.372] (-1981.864) (-1980.793) * (-1974.757) (-1978.489) [-1976.580] (-1977.130) -- 0:02:52
173500 -- (-1977.824) [-1975.763] (-1981.056) (-1983.039) * [-1972.823] (-1981.304) (-1974.916) (-1971.685) -- 0:02:56
174000 -- (-1977.903) (-1973.213) [-1978.645] (-1976.467) * (-1976.341) (-1980.210) (-1976.784) [-1976.860] -- 0:02:55
174500 -- [-1983.387] (-1977.405) (-1974.187) (-1985.486) * (-1979.054) (-1983.333) [-1976.582] (-1980.038) -- 0:02:55
175000 -- (-1985.326) (-1984.564) [-1976.448] (-1979.585) * (-1981.090) (-1989.209) (-1984.155) [-1978.083] -- 0:02:54
Average standard deviation of split frequencies: 0.000000
175500 -- (-1979.618) [-1975.402] (-1984.087) (-1975.264) * (-1978.552) [-1972.153] (-1978.718) (-1980.237) -- 0:02:53
176000 -- (-1973.903) [-1974.376] (-1976.295) (-1983.701) * [-1979.021] (-1977.024) (-1984.006) (-1977.688) -- 0:02:53
176500 -- (-1974.105) [-1976.884] (-1977.094) (-1983.366) * (-1976.845) (-1976.280) [-1975.302] (-1978.541) -- 0:02:52
177000 -- (-1976.986) (-1983.054) (-1979.545) [-1980.999] * (-1988.559) [-1983.886] (-1971.823) (-1980.237) -- 0:02:52
177500 -- [-1978.393] (-1975.565) (-1976.470) (-1979.209) * (-1975.486) [-1978.123] (-1975.035) (-1981.211) -- 0:02:51
178000 -- (-1979.912) (-1974.414) [-1973.629] (-1984.742) * [-1976.696] (-1978.351) (-1975.056) (-1977.471) -- 0:02:55
178500 -- (-1979.519) (-1974.026) (-1974.716) [-1986.689] * (-1979.111) [-1976.941] (-1976.886) (-1975.731) -- 0:02:54
179000 -- (-1977.834) [-1974.969] (-1974.646) (-1977.346) * (-1972.874) [-1971.355] (-1972.548) (-1975.405) -- 0:02:54
179500 -- (-1973.025) (-1974.900) [-1976.444] (-1979.028) * (-1977.037) (-1977.481) (-1982.749) [-1976.494] -- 0:02:53
180000 -- (-1975.450) (-1978.422) (-1977.734) [-1972.815] * (-1978.786) (-1980.984) (-1973.680) [-1972.827] -- 0:02:53
Average standard deviation of split frequencies: 0.000000
180500 -- (-1977.788) (-1984.830) [-1981.812] (-1976.765) * (-1978.006) (-1983.634) (-1972.387) [-1975.110] -- 0:02:52
181000 -- (-1978.788) (-1977.802) [-1978.630] (-1979.479) * (-1982.036) (-1971.550) [-1974.025] (-1982.140) -- 0:02:51
181500 -- (-1975.187) (-1985.887) (-1977.072) [-1980.076] * (-1971.995) [-1973.518] (-1971.875) (-1976.323) -- 0:02:51
182000 -- (-1975.464) [-1986.847] (-1982.974) (-1984.402) * (-1972.851) (-1985.186) (-1976.767) [-1974.561] -- 0:02:50
182500 -- (-1977.068) (-1976.957) (-1980.182) [-1975.627] * (-1973.549) (-1975.798) [-1976.901] (-1978.643) -- 0:02:50
183000 -- (-1975.909) (-1977.581) [-1985.154] (-1981.697) * (-1975.512) (-1975.281) [-1974.168] (-1978.571) -- 0:02:54
183500 -- (-1978.988) [-1984.868] (-1981.791) (-1978.875) * (-1976.717) (-1975.758) (-1975.693) [-1973.376] -- 0:02:53
184000 -- (-1972.639) (-1978.592) (-1990.898) [-1979.574] * (-1975.184) [-1980.348] (-1979.343) (-1975.716) -- 0:02:52
184500 -- (-1976.013) (-1983.568) [-1980.708] (-1979.122) * (-1974.593) (-1977.670) (-1979.238) [-1979.104] -- 0:02:52
185000 -- (-1977.085) [-1979.540] (-1982.800) (-1977.444) * [-1972.083] (-1976.759) (-1976.515) (-1973.071) -- 0:02:51
Average standard deviation of split frequencies: 0.000000
185500 -- [-1981.506] (-1975.762) (-1976.103) (-1978.428) * (-1981.095) (-1978.753) [-1975.270] (-1981.569) -- 0:02:51
186000 -- [-1974.358] (-1974.989) (-1976.789) (-1971.140) * [-1977.205] (-1976.359) (-1976.396) (-1972.235) -- 0:02:50
186500 -- (-1980.565) (-1971.592) (-1975.294) [-1979.352] * [-1972.669] (-1978.144) (-1974.481) (-1976.363) -- 0:02:50
187000 -- (-1974.134) [-1973.779] (-1980.063) (-1976.735) * (-1972.930) (-1978.685) [-1977.495] (-1979.335) -- 0:02:49
187500 -- (-1981.410) (-1986.223) (-1980.892) [-1977.305] * [-1972.307] (-1975.327) (-1982.031) (-1971.607) -- 0:02:49
188000 -- [-1974.455] (-1983.203) (-1979.070) (-1981.932) * (-1974.632) (-1983.517) (-1977.864) [-1971.878] -- 0:02:52
188500 -- (-1978.682) (-1974.921) (-1976.317) [-1983.869] * [-1975.916] (-1973.433) (-1978.919) (-1978.022) -- 0:02:52
189000 -- (-1975.528) (-1980.098) [-1973.002] (-1979.435) * (-1976.191) (-1978.829) [-1976.770] (-1979.123) -- 0:02:51
189500 -- [-1974.969] (-1980.011) (-1971.558) (-1978.219) * (-1977.967) (-1977.612) [-1977.911] (-1976.187) -- 0:02:51
190000 -- (-1977.512) (-1975.966) [-1973.920] (-1975.930) * (-1971.765) (-1980.382) [-1973.124] (-1978.753) -- 0:02:50
Average standard deviation of split frequencies: 0.000000
190500 -- (-1986.113) (-1977.743) [-1976.167] (-1973.935) * [-1974.528] (-1984.801) (-1970.120) (-1979.143) -- 0:02:49
191000 -- (-1977.820) [-1975.609] (-1981.539) (-1977.890) * (-1974.307) (-1975.719) [-1974.833] (-1984.626) -- 0:02:49
191500 -- (-1980.314) (-1979.299) (-1972.742) [-1977.743] * (-1979.695) (-1978.504) [-1980.226] (-1981.976) -- 0:02:48
192000 -- (-1979.299) (-1977.191) [-1973.116] (-1978.620) * (-1973.699) [-1978.143] (-1980.264) (-1981.822) -- 0:02:48
192500 -- (-1982.156) (-1975.641) [-1974.628] (-1981.061) * (-1975.933) [-1975.543] (-1979.301) (-1981.576) -- 0:02:51
193000 -- (-1975.996) (-1978.345) (-1974.690) [-1972.630] * (-1978.269) (-1972.688) [-1975.121] (-1989.531) -- 0:02:51
193500 -- [-1974.613] (-1978.223) (-1977.929) (-1973.752) * (-1976.479) [-1975.074] (-1974.904) (-1977.357) -- 0:02:50
194000 -- (-1981.222) (-1976.892) [-1979.718] (-1974.009) * [-1978.473] (-1979.916) (-1975.129) (-1980.298) -- 0:02:50
194500 -- [-1980.631] (-1980.086) (-1975.803) (-1977.911) * [-1975.477] (-1978.479) (-1979.671) (-1976.959) -- 0:02:49
195000 -- [-1978.628] (-1979.222) (-1978.671) (-1976.857) * (-1974.957) [-1971.603] (-1978.174) (-1981.062) -- 0:02:49
Average standard deviation of split frequencies: 0.000000
195500 -- (-1978.516) (-1974.061) (-1985.903) [-1975.303] * [-1977.612] (-1975.667) (-1974.405) (-1980.576) -- 0:02:48
196000 -- (-1972.758) (-1976.495) (-1978.857) [-1976.460] * (-1979.228) (-1974.539) (-1973.917) [-1976.342] -- 0:02:48
196500 -- (-1974.885) [-1980.960] (-1980.267) (-1974.553) * (-1976.419) (-1974.080) (-1979.427) [-1975.463] -- 0:02:47
197000 -- [-1974.436] (-1976.683) (-1978.314) (-1982.674) * (-1976.387) (-1976.144) (-1972.260) [-1978.081] -- 0:02:51
197500 -- (-1976.578) [-1977.771] (-1980.218) (-1979.877) * [-1973.967] (-1978.116) (-1979.038) (-1974.360) -- 0:02:50
198000 -- (-1976.817) (-1981.598) (-1974.340) [-1973.343] * (-1973.121) (-1979.229) (-1978.363) [-1975.688] -- 0:02:50
198500 -- (-1977.088) (-1971.447) (-1974.818) [-1972.005] * (-1975.573) (-1976.939) (-1983.835) [-1981.831] -- 0:02:49
199000 -- (-1969.968) [-1973.227] (-1979.791) (-1977.484) * [-1972.315] (-1972.026) (-1979.140) (-1975.707) -- 0:02:49
199500 -- (-1976.444) [-1974.284] (-1977.785) (-1981.422) * (-1976.191) (-1974.016) (-1972.398) [-1976.763] -- 0:02:48
200000 -- (-1981.826) (-1973.063) (-1983.629) [-1979.156] * [-1977.753] (-1975.686) (-1973.988) (-1976.062) -- 0:02:48
Average standard deviation of split frequencies: 0.000000
200500 -- (-1981.444) [-1972.566] (-1974.535) (-1980.882) * (-1979.057) [-1977.164] (-1976.096) (-1981.901) -- 0:02:47
201000 -- (-1979.288) (-1977.740) (-1973.168) [-1971.887] * (-1977.033) (-1974.857) [-1976.548] (-1978.164) -- 0:02:46
201500 -- (-1972.407) (-1978.021) (-1974.183) [-1977.247] * (-1975.776) (-1973.444) (-1974.505) [-1977.263] -- 0:02:50
202000 -- [-1973.322] (-1973.764) (-1986.011) (-1981.227) * (-1971.915) (-1980.742) (-1979.495) [-1976.680] -- 0:02:49
202500 -- (-1975.701) (-1977.497) [-1981.388] (-1976.174) * (-1977.710) (-1979.109) (-1985.709) [-1976.188] -- 0:02:49
203000 -- (-1975.219) (-1978.926) (-1989.633) [-1975.946] * (-1978.550) [-1973.507] (-1977.954) (-1982.952) -- 0:02:48
203500 -- (-1974.323) (-1971.295) (-1976.163) [-1979.579] * [-1974.442] (-1978.380) (-1975.422) (-1985.313) -- 0:02:48
204000 -- (-1982.099) (-1972.811) [-1973.095] (-1975.440) * (-1972.821) [-1977.487] (-1975.563) (-1982.389) -- 0:02:47
204500 -- (-1985.986) (-1975.593) (-1973.833) [-1979.569] * [-1976.999] (-1970.887) (-1975.914) (-1980.719) -- 0:02:47
205000 -- (-1981.853) [-1975.620] (-1972.218) (-1980.159) * (-1977.087) (-1974.473) (-1979.445) [-1980.781] -- 0:02:46
Average standard deviation of split frequencies: 0.000000
205500 -- (-1974.541) [-1977.595] (-1979.637) (-1973.756) * (-1977.373) (-1977.411) (-1980.352) [-1969.524] -- 0:02:46
206000 -- (-1975.987) [-1974.949] (-1980.646) (-1972.426) * (-1975.750) [-1973.850] (-1979.562) (-1978.139) -- 0:02:45
206500 -- (-1973.470) (-1977.158) [-1984.782] (-1976.153) * (-1982.445) (-1976.483) [-1970.948] (-1980.542) -- 0:02:49
207000 -- (-1973.423) [-1973.822] (-1977.264) (-1971.273) * (-1973.796) (-1972.085) (-1980.413) [-1974.452] -- 0:02:48
207500 -- (-1974.001) (-1976.024) (-1976.732) [-1978.169] * [-1973.922] (-1976.976) (-1978.241) (-1979.498) -- 0:02:48
208000 -- (-1974.713) [-1974.985] (-1981.494) (-1979.793) * (-1974.991) (-1980.643) [-1975.832] (-1977.147) -- 0:02:47
208500 -- [-1971.050] (-1973.094) (-1976.892) (-1980.214) * [-1975.798] (-1979.432) (-1979.271) (-1975.820) -- 0:02:47
209000 -- (-1971.906) (-1975.378) (-1978.510) [-1981.911] * (-1973.121) (-1978.670) [-1978.108] (-1977.064) -- 0:02:46
209500 -- [-1975.279] (-1983.137) (-1976.861) (-1979.453) * (-1978.091) (-1976.886) [-1975.063] (-1972.402) -- 0:02:46
210000 -- (-1972.378) (-1977.463) (-1976.679) [-1972.184] * [-1978.788] (-1979.918) (-1984.063) (-1975.568) -- 0:02:45
Average standard deviation of split frequencies: 0.000000
210500 -- (-1977.527) [-1972.867] (-1972.769) (-1971.837) * (-1970.557) [-1979.298] (-1978.239) (-1974.711) -- 0:02:45
211000 -- (-1985.584) (-1972.658) [-1971.163] (-1975.626) * (-1981.410) (-1978.424) (-1980.242) [-1978.013] -- 0:02:44
211500 -- (-1983.765) (-1978.282) [-1976.002] (-1976.139) * [-1977.158] (-1977.305) (-1979.584) (-1982.882) -- 0:02:47
212000 -- (-1974.533) [-1977.014] (-1980.144) (-1981.471) * [-1976.381] (-1982.188) (-1980.285) (-1981.478) -- 0:02:47
212500 -- (-1976.314) [-1979.733] (-1987.198) (-1973.290) * [-1977.621] (-1973.629) (-1974.147) (-1978.008) -- 0:02:46
213000 -- (-1976.257) (-1978.439) [-1973.208] (-1980.250) * (-1978.361) (-1973.946) [-1972.516] (-1975.227) -- 0:02:46
213500 -- (-1972.362) (-1975.410) (-1978.279) [-1976.541] * (-1978.223) (-1975.240) [-1980.040] (-1985.000) -- 0:02:45
214000 -- (-1979.489) (-1971.179) [-1979.189] (-1977.494) * (-1974.472) [-1973.586] (-1979.542) (-1977.185) -- 0:02:45
214500 -- (-1972.501) (-1977.636) [-1972.380] (-1974.563) * [-1976.534] (-1971.779) (-1977.801) (-1979.578) -- 0:02:44
215000 -- (-1974.126) [-1976.895] (-1972.471) (-1972.204) * (-1974.634) [-1979.808] (-1972.326) (-1974.753) -- 0:02:44
Average standard deviation of split frequencies: 0.000000
215500 -- [-1979.186] (-1969.528) (-1974.570) (-1976.412) * (-1979.092) (-1977.014) [-1971.227] (-1979.077) -- 0:02:43
216000 -- (-1973.343) (-1977.209) [-1974.624] (-1971.500) * [-1977.056] (-1978.692) (-1976.853) (-1977.870) -- 0:02:46
216500 -- (-1975.111) (-1970.425) (-1975.757) [-1972.642] * (-1981.407) (-1983.090) [-1975.845] (-1981.311) -- 0:02:46
217000 -- [-1976.975] (-1974.084) (-1978.921) (-1974.318) * (-1974.844) (-1980.437) [-1976.358] (-1978.131) -- 0:02:45
217500 -- [-1972.139] (-1982.733) (-1979.602) (-1973.357) * (-1971.858) (-1981.344) (-1975.769) [-1981.505] -- 0:02:45
218000 -- [-1978.499] (-1973.982) (-1978.189) (-1973.501) * (-1983.799) (-1983.222) [-1972.244] (-1985.912) -- 0:02:45
218500 -- (-1977.018) [-1974.448] (-1980.512) (-1984.231) * (-1982.479) (-1982.720) [-1977.473] (-1984.285) -- 0:02:44
219000 -- (-1971.582) (-1976.018) (-1977.152) [-1977.653] * [-1981.001] (-1982.400) (-1975.753) (-1980.269) -- 0:02:44
219500 -- (-1979.185) [-1972.076] (-1983.146) (-1975.663) * (-1980.693) (-1975.751) (-1975.799) [-1974.442] -- 0:02:43
220000 -- (-1983.209) [-1973.546] (-1980.790) (-1980.459) * (-1977.990) (-1976.234) [-1976.001] (-1978.376) -- 0:02:43
Average standard deviation of split frequencies: 0.000000
220500 -- (-1976.249) (-1976.070) [-1975.969] (-1985.698) * (-1973.810) [-1980.802] (-1973.773) (-1976.994) -- 0:02:42
221000 -- (-1982.942) (-1983.824) (-1976.028) [-1973.408] * (-1981.222) [-1980.902] (-1979.844) (-1977.503) -- 0:02:45
221500 -- (-1986.163) [-1977.884] (-1981.048) (-1973.564) * (-1975.332) [-1974.252] (-1975.201) (-1980.080) -- 0:02:45
222000 -- (-1974.048) (-1976.600) [-1971.088] (-1976.694) * [-1974.896] (-1976.151) (-1973.328) (-1973.324) -- 0:02:44
222500 -- [-1973.631] (-1972.891) (-1976.638) (-1977.660) * (-1973.388) (-1973.172) [-1981.546] (-1977.474) -- 0:02:44
223000 -- [-1974.335] (-1978.298) (-1986.492) (-1980.319) * (-1974.658) (-1978.731) [-1975.984] (-1982.468) -- 0:02:43
223500 -- [-1973.197] (-1974.339) (-1978.829) (-1975.644) * (-1975.259) (-1979.830) [-1976.691] (-1978.237) -- 0:02:43
224000 -- [-1971.912] (-1976.950) (-1973.256) (-1982.704) * (-1977.602) (-1975.187) [-1977.265] (-1982.808) -- 0:02:42
224500 -- [-1974.199] (-1979.405) (-1977.765) (-1977.298) * (-1974.949) [-1974.498] (-1972.595) (-1977.386) -- 0:02:42
225000 -- (-1979.004) (-1981.257) [-1976.405] (-1979.437) * (-1977.321) (-1981.522) (-1974.966) [-1986.344] -- 0:02:41
Average standard deviation of split frequencies: 0.000000
225500 -- (-1974.281) [-1978.501] (-1980.163) (-1977.648) * [-1978.983] (-1975.477) (-1977.878) (-1970.828) -- 0:02:41
226000 -- (-1971.249) (-1978.153) (-1976.758) [-1973.942] * [-1973.226] (-1973.991) (-1971.144) (-1976.064) -- 0:02:44
226500 -- (-1979.581) (-1974.036) [-1975.786] (-1985.773) * [-1973.285] (-1977.218) (-1976.421) (-1976.785) -- 0:02:43
227000 -- (-1979.868) [-1973.131] (-1976.666) (-1978.679) * (-1972.156) (-1978.300) (-1975.292) [-1973.651] -- 0:02:43
227500 -- [-1975.521] (-1975.172) (-1971.525) (-1984.784) * (-1973.178) (-1984.837) (-1982.366) [-1978.696] -- 0:02:42
228000 -- [-1973.003] (-1975.983) (-1974.580) (-1980.771) * (-1975.160) [-1982.153] (-1978.050) (-1988.428) -- 0:02:42
228500 -- (-1977.089) (-1979.681) [-1976.486] (-1984.117) * (-1978.179) [-1981.396] (-1977.419) (-1980.668) -- 0:02:42
229000 -- [-1976.237] (-1981.940) (-1981.279) (-1977.711) * (-1979.834) [-1975.860] (-1984.164) (-1975.023) -- 0:02:41
229500 -- (-1975.860) (-1978.831) [-1979.896] (-1982.180) * [-1971.625] (-1979.894) (-1975.597) (-1978.124) -- 0:02:41
230000 -- [-1975.087] (-1978.227) (-1975.990) (-1975.744) * (-1976.133) (-1979.793) (-1979.135) [-1976.217] -- 0:02:40
Average standard deviation of split frequencies: 0.000000
230500 -- (-1981.545) (-1974.227) [-1972.918] (-1979.504) * (-1978.886) (-1969.897) [-1972.621] (-1980.789) -- 0:02:43
231000 -- (-1979.066) (-1973.252) [-1972.199] (-1975.382) * (-1976.120) (-1971.540) [-1973.778] (-1970.101) -- 0:02:43
231500 -- [-1975.642] (-1979.876) (-1973.109) (-1979.197) * (-1984.046) (-1979.650) [-1974.936] (-1972.821) -- 0:02:42
232000 -- (-1978.429) [-1972.032] (-1982.791) (-1979.677) * (-1980.604) (-1978.533) [-1970.365] (-1983.190) -- 0:02:42
232500 -- (-1980.715) (-1977.953) [-1975.931] (-1977.755) * (-1977.125) (-1977.281) [-1973.361] (-1981.815) -- 0:02:41
233000 -- [-1983.086] (-1984.178) (-1974.733) (-1977.419) * (-1979.192) [-1976.045] (-1973.366) (-1976.275) -- 0:02:41
233500 -- (-1985.222) (-1975.382) (-1975.928) [-1970.659] * (-1978.876) [-1973.979] (-1979.557) (-1973.238) -- 0:02:40
234000 -- (-1977.373) [-1978.647] (-1977.671) (-1972.395) * (-1974.667) (-1973.124) [-1972.678] (-1981.282) -- 0:02:40
234500 -- (-1979.292) (-1977.940) (-1978.354) [-1981.028] * (-1978.010) [-1974.413] (-1979.064) (-1977.496) -- 0:02:39
235000 -- [-1975.442] (-1974.830) (-1976.678) (-1976.222) * (-1982.181) (-1976.895) (-1986.339) [-1978.436] -- 0:02:39
Average standard deviation of split frequencies: 0.000000
235500 -- [-1975.710] (-1977.360) (-1971.122) (-1979.797) * [-1975.254] (-1981.110) (-1979.865) (-1973.904) -- 0:02:42
236000 -- (-1975.471) (-1981.124) [-1976.344] (-1981.470) * [-1977.184] (-1977.391) (-1982.329) (-1983.025) -- 0:02:41
236500 -- [-1974.271] (-1972.833) (-1981.691) (-1974.912) * (-1976.448) (-1972.818) (-1983.182) [-1979.604] -- 0:02:41
237000 -- (-1981.686) (-1973.429) [-1976.082] (-1977.825) * (-1977.007) [-1975.221] (-1976.229) (-1978.663) -- 0:02:40
237500 -- (-1972.362) (-1973.593) [-1973.589] (-1975.202) * (-1980.744) (-1974.706) [-1973.033] (-1979.644) -- 0:02:40
238000 -- (-1977.944) (-1979.192) [-1981.988] (-1976.081) * [-1976.381] (-1970.663) (-1975.555) (-1976.731) -- 0:02:40
238500 -- (-1974.533) (-1976.678) [-1977.130] (-1975.394) * [-1974.167] (-1972.752) (-1979.972) (-1979.210) -- 0:02:39
239000 -- [-1973.988] (-1977.284) (-1976.989) (-1978.060) * (-1974.544) (-1975.731) (-1974.923) [-1974.889] -- 0:02:39
239500 -- (-1973.188) (-1980.877) (-1973.337) [-1974.476] * (-1975.537) (-1976.744) (-1975.599) [-1978.991] -- 0:02:38
240000 -- [-1971.975] (-1976.187) (-1977.251) (-1975.699) * (-1973.252) (-1981.954) [-1974.335] (-1978.305) -- 0:02:41
Average standard deviation of split frequencies: 0.000000
240500 -- (-1976.305) (-1982.060) [-1980.396] (-1977.748) * (-1980.029) (-1976.170) (-1982.714) [-1977.129] -- 0:02:41
241000 -- (-1977.701) [-1974.544] (-1976.094) (-1985.183) * (-1981.354) [-1973.209] (-1972.738) (-1976.047) -- 0:02:40
241500 -- (-1978.606) [-1971.016] (-1975.279) (-1978.630) * (-1979.305) [-1973.370] (-1973.032) (-1974.256) -- 0:02:40
242000 -- (-1981.345) [-1980.264] (-1979.560) (-1980.836) * (-1971.015) (-1974.790) [-1973.583] (-1976.800) -- 0:02:39
242500 -- (-1980.012) [-1975.690] (-1982.360) (-1982.857) * (-1977.267) (-1976.695) [-1973.832] (-1979.054) -- 0:02:39
243000 -- [-1976.608] (-1977.263) (-1976.352) (-1989.302) * (-1980.267) [-1972.601] (-1970.873) (-1973.912) -- 0:02:38
243500 -- [-1982.357] (-1975.396) (-1979.368) (-1979.894) * [-1978.285] (-1973.143) (-1972.115) (-1978.140) -- 0:02:38
244000 -- (-1972.163) (-1978.820) (-1977.432) [-1975.305] * [-1976.121] (-1975.174) (-1982.914) (-1972.062) -- 0:02:38
244500 -- [-1971.445] (-1982.473) (-1981.948) (-1982.890) * (-1979.220) (-1975.099) [-1972.965] (-1978.073) -- 0:02:37
245000 -- (-1978.298) (-1974.574) (-1974.488) [-1975.526] * (-1981.437) [-1975.398] (-1979.636) (-1975.579) -- 0:02:40
Average standard deviation of split frequencies: 0.000000
245500 -- [-1975.715] (-1978.208) (-1977.835) (-1970.825) * (-1972.040) [-1972.466] (-1976.584) (-1983.112) -- 0:02:39
246000 -- (-1977.817) [-1984.645] (-1977.717) (-1987.657) * (-1976.077) (-1974.113) [-1974.235] (-1976.891) -- 0:02:39
246500 -- (-1978.706) (-1979.967) [-1978.047] (-1971.750) * (-1977.489) (-1975.547) [-1975.300] (-1980.375) -- 0:02:38
247000 -- (-1975.880) (-1978.174) [-1976.277] (-1973.485) * (-1971.981) (-1979.445) (-1972.881) [-1984.757] -- 0:02:38
247500 -- (-1975.900) (-1976.283) [-1973.369] (-1973.006) * (-1972.345) (-1981.093) (-1976.578) [-1978.410] -- 0:02:38
248000 -- (-1975.582) (-1976.861) (-1972.427) [-1973.699] * (-1973.345) (-1978.711) [-1975.780] (-1978.243) -- 0:02:37
248500 -- [-1971.081] (-1973.305) (-1974.874) (-1977.543) * [-1977.111] (-1978.156) (-1985.517) (-1981.672) -- 0:02:37
249000 -- [-1972.677] (-1970.887) (-1972.576) (-1975.691) * [-1972.043] (-1976.024) (-1976.362) (-1973.302) -- 0:02:36
249500 -- (-1975.731) (-1973.204) [-1973.286] (-1975.554) * (-1981.766) (-1976.993) [-1974.379] (-1975.345) -- 0:02:36
250000 -- (-1978.724) (-1979.115) [-1985.467] (-1978.720) * (-1977.419) [-1975.751] (-1977.214) (-1983.921) -- 0:02:39
Average standard deviation of split frequencies: 0.000000
250500 -- (-1976.151) [-1975.677] (-1978.158) (-1970.990) * (-1974.437) (-1974.985) (-1974.203) [-1978.174] -- 0:02:38
251000 -- (-1973.869) (-1977.972) (-1977.790) [-1973.401] * (-1971.647) [-1977.987] (-1976.725) (-1977.194) -- 0:02:38
251500 -- (-1978.720) (-1975.163) [-1977.065] (-1979.909) * [-1978.460] (-1976.996) (-1975.228) (-1975.397) -- 0:02:37
252000 -- (-1973.802) [-1973.688] (-1973.098) (-1975.501) * (-1973.769) (-1975.422) [-1974.877] (-1974.862) -- 0:02:37
252500 -- (-1974.483) (-1971.010) [-1973.181] (-1976.610) * [-1980.030] (-1977.252) (-1971.764) (-1979.356) -- 0:02:36
253000 -- [-1975.459] (-1977.327) (-1972.828) (-1975.985) * (-1979.313) [-1981.420] (-1973.645) (-1982.846) -- 0:02:36
253500 -- (-1973.662) (-1973.565) [-1973.419] (-1972.232) * (-1983.511) [-1981.486] (-1975.234) (-1972.125) -- 0:02:36
254000 -- (-1975.294) (-1979.585) [-1973.084] (-1976.818) * [-1974.465] (-1978.673) (-1980.091) (-1974.699) -- 0:02:35
254500 -- [-1978.204] (-1977.011) (-1977.694) (-1976.763) * (-1974.676) [-1975.632] (-1975.300) (-1975.934) -- 0:02:35
255000 -- (-1975.887) (-1980.713) (-1975.746) [-1975.219] * (-1975.615) (-1970.797) (-1977.431) [-1973.452] -- 0:02:37
Average standard deviation of split frequencies: 0.000000
255500 -- [-1973.716] (-1973.706) (-1985.604) (-1972.569) * [-1978.028] (-1981.957) (-1979.398) (-1978.480) -- 0:02:37
256000 -- (-1972.849) [-1971.015] (-1976.563) (-1980.701) * (-1973.572) (-1979.781) (-1980.847) [-1976.730] -- 0:02:36
256500 -- [-1973.503] (-1979.399) (-1973.283) (-1978.031) * [-1973.187] (-1973.381) (-1983.504) (-1975.319) -- 0:02:36
257000 -- [-1972.179] (-1978.918) (-1978.525) (-1976.655) * (-1975.407) (-1974.066) (-1979.245) [-1976.300] -- 0:02:36
257500 -- [-1977.101] (-1976.488) (-1976.943) (-1978.264) * (-1980.363) [-1982.585] (-1981.316) (-1973.914) -- 0:02:35
258000 -- (-1979.279) [-1976.522] (-1976.696) (-1975.494) * (-1980.571) [-1974.706] (-1976.474) (-1980.511) -- 0:02:35
258500 -- [-1979.604] (-1985.667) (-1973.879) (-1974.083) * (-1975.126) [-1977.506] (-1977.167) (-1984.680) -- 0:02:34
259000 -- (-1978.576) (-1978.613) [-1970.808] (-1982.483) * [-1979.257] (-1981.508) (-1987.951) (-1982.153) -- 0:02:34
259500 -- [-1977.680] (-1977.969) (-1972.765) (-1979.127) * [-1978.642] (-1978.610) (-1982.445) (-1975.382) -- 0:02:36
260000 -- [-1975.109] (-1978.079) (-1975.235) (-1980.454) * (-1977.078) (-1975.296) (-1982.629) [-1974.659] -- 0:02:36
Average standard deviation of split frequencies: 0.000000
260500 -- (-1981.741) [-1978.427] (-1983.611) (-1980.946) * (-1975.092) [-1971.936] (-1975.879) (-1975.556) -- 0:02:36
261000 -- (-1975.408) (-1979.016) [-1975.924] (-1981.908) * (-1979.091) [-1972.966] (-1983.680) (-1978.218) -- 0:02:35
261500 -- (-1980.180) [-1978.471] (-1975.866) (-1975.891) * (-1975.300) (-1980.542) (-1975.351) [-1980.518] -- 0:02:35
262000 -- (-1983.624) (-1974.121) [-1980.053] (-1973.244) * (-1983.086) (-1974.777) [-1976.532] (-1978.492) -- 0:02:34
262500 -- (-1990.086) [-1973.782] (-1980.876) (-1979.400) * (-1977.899) (-1975.806) (-1971.740) [-1980.371] -- 0:02:34
263000 -- [-1984.076] (-1980.343) (-1974.600) (-1980.316) * [-1972.392] (-1975.708) (-1983.869) (-1974.371) -- 0:02:34
263500 -- (-1982.230) [-1977.465] (-1973.434) (-1982.009) * [-1979.010] (-1975.759) (-1986.918) (-1978.894) -- 0:02:33
264000 -- (-1977.011) (-1977.715) [-1970.920] (-1979.575) * (-1977.210) [-1978.781] (-1975.872) (-1980.098) -- 0:02:33
264500 -- (-1981.767) [-1981.861] (-1973.857) (-1976.239) * [-1978.015] (-1980.636) (-1974.910) (-1974.259) -- 0:02:35
265000 -- (-1975.708) (-1978.564) (-1977.215) [-1976.931] * (-1989.041) (-1978.990) [-1975.915] (-1976.524) -- 0:02:35
Average standard deviation of split frequencies: 0.000000
265500 -- [-1974.257] (-1976.909) (-1982.216) (-1977.291) * (-1980.289) (-1980.759) (-1970.605) [-1981.430] -- 0:02:34
266000 -- (-1978.253) (-1976.334) [-1976.281] (-1987.856) * (-1983.185) (-1980.201) [-1974.463] (-1983.934) -- 0:02:34
266500 -- (-1972.913) (-1979.392) [-1972.808] (-1979.676) * (-1980.484) [-1976.164] (-1975.564) (-1979.984) -- 0:02:34
267000 -- (-1977.114) (-1979.296) [-1975.135] (-1977.513) * (-1981.829) (-1982.511) [-1975.250] (-1981.502) -- 0:02:33
267500 -- [-1970.960] (-1971.821) (-1982.781) (-1976.409) * (-1977.493) (-1979.612) [-1976.905] (-1983.390) -- 0:02:33
268000 -- (-1971.427) (-1975.326) (-1973.660) [-1972.472] * (-1975.300) [-1976.460] (-1983.236) (-1975.350) -- 0:02:32
268500 -- (-1980.895) (-1978.595) [-1974.442] (-1972.940) * (-1980.068) (-1978.821) (-1973.491) [-1976.149] -- 0:02:32
269000 -- (-1973.260) (-1984.334) (-1976.647) [-1975.208] * [-1987.385] (-1979.928) (-1969.901) (-1971.666) -- 0:02:34
269500 -- (-1976.646) (-1973.525) [-1978.551] (-1984.714) * (-1974.279) (-1979.736) [-1970.433] (-1982.995) -- 0:02:34
270000 -- (-1985.282) [-1977.488] (-1973.880) (-1978.581) * (-1975.100) [-1979.269] (-1975.929) (-1983.820) -- 0:02:34
Average standard deviation of split frequencies: 0.000000
270500 -- (-1985.407) (-1979.534) (-1978.514) [-1973.797] * [-1976.125] (-1974.447) (-1981.449) (-1974.159) -- 0:02:33
271000 -- (-1984.979) (-1979.853) (-1975.667) [-1978.297] * (-1981.252) (-1978.333) (-1975.794) [-1973.064] -- 0:02:33
271500 -- (-1971.851) (-1976.372) (-1980.225) [-1979.783] * (-1983.098) (-1980.062) [-1972.693] (-1973.270) -- 0:02:32
272000 -- (-1972.721) [-1975.625] (-1974.079) (-1976.005) * (-1982.073) (-1971.165) (-1971.121) [-1980.265] -- 0:02:32
272500 -- [-1977.906] (-1974.971) (-1979.197) (-1976.526) * (-1979.511) (-1977.615) [-1975.950] (-1977.373) -- 0:02:32
273000 -- (-1979.249) (-1975.118) (-1975.783) [-1978.166] * [-1972.092] (-1980.023) (-1978.076) (-1976.735) -- 0:02:31
273500 -- (-1979.394) (-1977.011) (-1983.141) [-1981.076] * (-1975.323) [-1973.068] (-1976.645) (-1976.907) -- 0:02:31
274000 -- (-1972.865) [-1977.255] (-1983.211) (-1973.373) * [-1976.813] (-1971.670) (-1980.419) (-1982.502) -- 0:02:33
274500 -- (-1975.717) [-1983.640] (-1986.275) (-1975.035) * (-1976.207) (-1975.821) [-1974.863] (-1986.135) -- 0:02:33
275000 -- (-1979.893) (-1972.719) [-1978.752] (-1977.226) * (-1974.648) (-1979.027) (-1975.749) [-1977.720] -- 0:02:32
Average standard deviation of split frequencies: 0.000000
275500 -- [-1972.984] (-1981.539) (-1978.122) (-1974.954) * (-1971.581) [-1975.367] (-1976.016) (-1979.037) -- 0:02:32
276000 -- (-1979.476) (-1983.958) (-1971.853) [-1978.617] * [-1973.303] (-1978.303) (-1977.753) (-1975.593) -- 0:02:32
276500 -- (-1984.391) (-1981.337) [-1972.990] (-1975.198) * (-1981.769) (-1979.145) [-1974.095] (-1975.127) -- 0:02:31
277000 -- (-1974.083) [-1978.825] (-1975.860) (-1972.447) * (-1978.611) (-1982.721) (-1977.340) [-1979.045] -- 0:02:31
277500 -- (-1976.902) (-1973.314) (-1985.682) [-1977.844] * (-1974.836) (-1978.758) [-1974.506] (-1985.500) -- 0:02:31
278000 -- (-1972.828) (-1976.118) [-1979.477] (-1976.496) * (-1978.719) [-1980.698] (-1976.979) (-1981.631) -- 0:02:30
278500 -- (-1977.257) [-1977.838] (-1975.056) (-1975.926) * (-1976.812) [-1971.371] (-1972.516) (-1978.643) -- 0:02:32
279000 -- (-1977.209) (-1977.252) (-1973.823) [-1975.585] * (-1979.359) (-1972.767) (-1976.642) [-1975.338] -- 0:02:32
279500 -- (-1977.414) (-1974.957) (-1972.191) [-1973.858] * (-1976.273) (-1975.006) [-1973.805] (-1978.265) -- 0:02:32
280000 -- (-1979.080) (-1975.807) [-1972.088] (-1977.445) * (-1976.498) (-1972.895) (-1977.627) [-1973.105] -- 0:02:31
Average standard deviation of split frequencies: 0.000000
280500 -- (-1983.300) (-1976.788) (-1976.684) [-1971.459] * (-1981.515) (-1972.363) [-1973.726] (-1976.263) -- 0:02:31
281000 -- (-1983.935) (-1974.872) (-1974.161) [-1973.529] * (-1979.080) (-1975.098) (-1983.041) [-1973.885] -- 0:02:30
281500 -- (-1980.043) (-1978.172) (-1972.879) [-1978.570] * (-1973.733) (-1972.258) (-1982.170) [-1974.607] -- 0:02:30
282000 -- (-1980.021) (-1978.012) [-1975.907] (-1979.507) * (-1983.436) (-1972.213) (-1983.266) [-1983.813] -- 0:02:30
282500 -- (-1987.671) [-1974.243] (-1976.950) (-1975.122) * (-1978.219) [-1977.740] (-1981.457) (-1987.227) -- 0:02:29
283000 -- (-1976.792) [-1975.177] (-1977.304) (-1976.392) * [-1971.789] (-1978.299) (-1974.536) (-1980.409) -- 0:02:29
283500 -- [-1972.970] (-1975.252) (-1984.486) (-1979.238) * (-1979.797) (-1980.615) (-1976.102) [-1979.759] -- 0:02:31
284000 -- (-1980.069) [-1974.309] (-1974.774) (-1971.797) * [-1974.710] (-1976.995) (-1971.640) (-1980.720) -- 0:02:31
284500 -- (-1969.480) [-1975.680] (-1984.276) (-1975.921) * [-1978.004] (-1978.641) (-1972.857) (-1988.120) -- 0:02:30
285000 -- (-1974.654) (-1975.264) (-1980.242) [-1974.851] * (-1970.302) (-1974.348) [-1975.504] (-1982.062) -- 0:02:30
Average standard deviation of split frequencies: 0.000000
285500 -- (-1976.158) [-1977.999] (-1982.465) (-1982.783) * [-1974.605] (-1978.146) (-1979.649) (-1977.294) -- 0:02:30
286000 -- (-1980.196) (-1975.069) (-1983.637) [-1971.840] * (-1975.558) (-1980.540) (-1978.707) [-1977.371] -- 0:02:29
286500 -- [-1976.542] (-1977.269) (-1990.182) (-1980.094) * (-1977.144) (-1976.513) [-1974.825] (-1975.434) -- 0:02:29
287000 -- (-1974.831) (-1976.189) (-1981.976) [-1976.811] * [-1970.334] (-1973.615) (-1978.197) (-1972.345) -- 0:02:29
287500 -- (-1976.687) [-1974.822] (-1981.830) (-1979.566) * (-1977.206) (-1985.424) [-1976.172] (-1975.471) -- 0:02:28
288000 -- [-1977.232] (-1978.721) (-1981.318) (-1979.152) * [-1972.682] (-1978.872) (-1974.808) (-1974.250) -- 0:02:28
288500 -- (-1976.476) [-1977.849] (-1979.639) (-1975.685) * (-1974.467) [-1972.761] (-1978.132) (-1976.877) -- 0:02:30
289000 -- [-1978.074] (-1977.007) (-1980.106) (-1977.767) * [-1977.986] (-1976.364) (-1975.117) (-1981.479) -- 0:02:30
289500 -- (-1984.675) (-1981.678) (-1977.433) [-1975.104] * [-1979.293] (-1973.353) (-1971.641) (-1974.064) -- 0:02:29
290000 -- (-1982.031) (-1977.965) [-1977.916] (-1981.738) * (-1983.860) [-1972.604] (-1976.877) (-1974.114) -- 0:02:29
Average standard deviation of split frequencies: 0.000000
290500 -- [-1981.758] (-1984.124) (-1977.302) (-1978.821) * (-1978.666) [-1973.683] (-1991.339) (-1980.219) -- 0:02:28
291000 -- (-1982.571) (-1975.583) (-1974.841) [-1975.692] * (-1978.003) (-1984.330) [-1981.410] (-1978.929) -- 0:02:28
291500 -- [-1979.203] (-1975.147) (-1973.444) (-1979.980) * (-1976.396) (-1977.947) (-1981.246) [-1981.896] -- 0:02:28
292000 -- (-1980.537) (-1980.007) (-1977.715) [-1979.115] * (-1979.060) (-1973.076) (-1977.205) [-1973.837] -- 0:02:27
292500 -- (-1973.807) (-1983.175) [-1983.935] (-1977.371) * (-1972.734) (-1979.803) (-1975.581) [-1975.233] -- 0:02:27
293000 -- (-1983.008) (-1977.370) (-1980.173) [-1976.764] * (-1980.199) (-1983.082) [-1979.236] (-1974.013) -- 0:02:29
293500 -- [-1976.090] (-1982.353) (-1985.696) (-1980.022) * (-1982.201) (-1975.716) (-1975.911) [-1975.027] -- 0:02:29
294000 -- [-1979.654] (-1979.455) (-1980.170) (-1978.738) * (-1976.990) (-1974.801) (-1979.333) [-1973.854] -- 0:02:28
294500 -- (-1983.152) (-1983.653) [-1975.004] (-1984.148) * (-1985.363) (-1975.555) (-1973.057) [-1973.449] -- 0:02:28
295000 -- (-1979.543) (-1975.380) (-1977.311) [-1974.714] * (-1976.547) (-1976.034) [-1976.679] (-1974.327) -- 0:02:28
Average standard deviation of split frequencies: 0.000000
295500 -- (-1971.214) (-1978.365) [-1974.762] (-1979.808) * (-1976.637) (-1979.754) (-1982.748) [-1975.962] -- 0:02:27
296000 -- (-1977.787) [-1975.325] (-1978.097) (-1985.078) * [-1974.191] (-1986.818) (-1974.940) (-1974.966) -- 0:02:27
296500 -- (-1977.022) (-1971.176) [-1979.099] (-1985.911) * [-1973.077] (-1980.323) (-1974.760) (-1976.592) -- 0:02:27
297000 -- [-1976.904] (-1975.163) (-1981.604) (-1978.095) * (-1977.199) (-1979.100) [-1979.817] (-1976.080) -- 0:02:26
297500 -- (-1980.098) (-1976.123) [-1975.647] (-1972.168) * (-1981.129) (-1974.255) (-1980.387) [-1976.648] -- 0:02:26
298000 -- (-1975.702) (-1981.875) (-1976.113) [-1983.597] * (-1976.424) (-1973.804) [-1974.226] (-1974.449) -- 0:02:28
298500 -- (-1974.906) (-1975.350) [-1979.960] (-1977.293) * (-1979.907) (-1977.707) [-1977.953] (-1975.392) -- 0:02:28
299000 -- [-1974.884] (-1981.084) (-1976.544) (-1974.816) * (-1975.185) [-1978.585] (-1976.939) (-1975.404) -- 0:02:27
299500 -- (-1976.628) (-1985.191) [-1974.724] (-1979.877) * (-1976.272) [-1981.705] (-1975.340) (-1985.417) -- 0:02:27
300000 -- (-1977.844) (-1980.878) [-1982.966] (-1970.264) * (-1972.510) (-1974.140) [-1977.118] (-1988.238) -- 0:02:27
Average standard deviation of split frequencies: 0.000000
300500 -- (-1977.322) (-1979.738) (-1978.168) [-1974.432] * (-1980.764) (-1976.148) [-1974.365] (-1985.067) -- 0:02:26
301000 -- [-1973.952] (-1982.311) (-1974.326) (-1975.583) * (-1978.168) (-1978.225) [-1974.730] (-1990.116) -- 0:02:26
301500 -- (-1984.906) [-1976.687] (-1973.351) (-1982.244) * (-1980.145) [-1975.986] (-1981.048) (-1984.690) -- 0:02:25
302000 -- (-1977.778) (-1977.612) [-1971.448] (-1977.002) * (-1978.486) (-1974.425) [-1978.704] (-1981.187) -- 0:02:25
302500 -- [-1974.759] (-1982.490) (-1975.080) (-1977.812) * (-1974.131) (-1983.349) (-1977.953) [-1973.796] -- 0:02:27
303000 -- (-1981.163) (-1978.875) (-1981.003) [-1982.151] * (-1987.105) (-1974.581) [-1973.770] (-1973.501) -- 0:02:27
303500 -- (-1979.334) [-1976.679] (-1974.208) (-1979.525) * (-1976.513) (-1976.790) [-1972.167] (-1980.009) -- 0:02:26
304000 -- (-1982.004) (-1977.574) [-1974.624] (-1974.802) * (-1975.670) (-1988.984) [-1974.277] (-1983.599) -- 0:02:26
304500 -- (-1972.824) [-1975.588] (-1975.540) (-1973.538) * [-1973.503] (-1979.455) (-1973.279) (-1976.603) -- 0:02:26
305000 -- (-1976.698) (-1979.993) [-1973.113] (-1981.987) * (-1980.853) (-1976.019) [-1976.052] (-1977.431) -- 0:02:25
Average standard deviation of split frequencies: 0.000000
305500 -- [-1977.719] (-1978.047) (-1975.504) (-1974.196) * [-1973.157] (-1980.111) (-1976.914) (-1978.122) -- 0:02:25
306000 -- (-1977.786) (-1978.988) (-1980.329) [-1974.057] * (-1971.940) (-1977.007) [-1971.564] (-1978.445) -- 0:02:25
306500 -- [-1984.206] (-1984.138) (-1979.908) (-1980.323) * (-1979.639) (-1977.838) (-1976.402) [-1977.310] -- 0:02:24
307000 -- [-1982.115] (-1976.613) (-1980.167) (-1978.022) * (-1975.412) (-1979.271) (-1978.286) [-1974.604] -- 0:02:24
307500 -- [-1975.985] (-1973.143) (-1982.914) (-1975.812) * [-1974.422] (-1976.487) (-1971.739) (-1977.303) -- 0:02:26
308000 -- [-1971.722] (-1973.518) (-1986.909) (-1977.289) * (-1976.851) (-1973.550) (-1976.680) [-1971.634] -- 0:02:26
308500 -- (-1976.064) (-1977.300) (-1984.682) [-1978.663] * (-1975.686) [-1977.883] (-1975.287) (-1978.830) -- 0:02:25
309000 -- (-1972.839) [-1981.418] (-1982.498) (-1978.173) * (-1974.447) (-1973.815) (-1971.839) [-1973.815] -- 0:02:25
309500 -- (-1975.779) [-1974.437] (-1985.104) (-1980.496) * (-1973.329) [-1975.944] (-1973.198) (-1976.277) -- 0:02:25
310000 -- (-1979.120) [-1973.659] (-1983.447) (-1977.131) * [-1973.519] (-1975.696) (-1974.248) (-1975.799) -- 0:02:24
Average standard deviation of split frequencies: 0.000000
310500 -- [-1977.646] (-1973.783) (-1983.580) (-1981.502) * (-1982.788) (-1975.346) (-1973.853) [-1973.394] -- 0:02:24
311000 -- (-1975.929) (-1976.901) (-1978.490) [-1982.098] * (-1985.368) (-1980.785) [-1971.868] (-1974.908) -- 0:02:24
311500 -- (-1989.100) [-1975.645] (-1982.929) (-1982.519) * (-1981.716) [-1983.028] (-1974.660) (-1980.812) -- 0:02:23
312000 -- (-1978.971) [-1973.036] (-1974.554) (-1980.844) * [-1978.978] (-1977.744) (-1974.741) (-1977.398) -- 0:02:25
312500 -- (-1980.323) (-1982.462) (-1975.542) [-1982.279] * (-1982.140) [-1976.647] (-1975.087) (-1975.923) -- 0:02:25
313000 -- (-1980.694) [-1974.884] (-1977.154) (-1984.632) * (-1982.164) [-1977.626] (-1980.679) (-1973.810) -- 0:02:24
313500 -- (-1977.439) [-1973.542] (-1973.842) (-1979.036) * (-1978.579) [-1980.002] (-1982.612) (-1979.181) -- 0:02:24
314000 -- (-1984.506) (-1973.176) (-1976.307) [-1978.871] * (-1970.144) (-1981.093) (-1978.116) [-1971.388] -- 0:02:24
314500 -- (-1986.823) (-1978.542) (-1980.102) [-1975.305] * (-1972.105) (-1980.026) (-1971.823) [-1976.353] -- 0:02:23
315000 -- (-1984.598) (-1977.719) (-1980.522) [-1974.817] * [-1973.498] (-1980.239) (-1972.684) (-1974.382) -- 0:02:23
Average standard deviation of split frequencies: 0.000000
315500 -- (-1978.932) (-1979.584) [-1978.264] (-1975.340) * [-1975.314] (-1974.155) (-1979.979) (-1971.328) -- 0:02:23
316000 -- (-1971.628) [-1973.916] (-1979.917) (-1977.738) * (-1974.031) (-1976.174) (-1977.879) [-1970.756] -- 0:02:22
316500 -- [-1975.854] (-1973.811) (-1978.563) (-1980.768) * [-1975.116] (-1971.760) (-1976.024) (-1971.967) -- 0:02:22
317000 -- (-1983.794) [-1974.049] (-1976.303) (-1977.833) * (-1983.248) (-1979.224) [-1973.076] (-1972.881) -- 0:02:24
317500 -- (-1975.503) (-1980.783) (-1974.409) [-1973.533] * (-1985.866) (-1978.355) (-1971.084) [-1973.444] -- 0:02:24
318000 -- (-1978.007) (-1975.354) (-1979.516) [-1974.038] * (-1980.663) (-1975.421) [-1970.607] (-1974.157) -- 0:02:23
318500 -- (-1979.151) (-1977.311) [-1978.684] (-1976.720) * (-1973.328) (-1973.845) [-1975.080] (-1973.466) -- 0:02:23
319000 -- (-1973.293) (-1975.301) [-1974.838] (-1975.351) * (-1977.222) [-1978.047] (-1973.386) (-1979.424) -- 0:02:23
319500 -- (-1973.675) (-1978.678) [-1980.218] (-1975.160) * [-1983.128] (-1977.811) (-1976.606) (-1974.975) -- 0:02:22
320000 -- (-1973.935) (-1979.781) (-1974.758) [-1977.493] * (-1978.138) (-1976.576) [-1978.437] (-1977.674) -- 0:02:22
Average standard deviation of split frequencies: 0.000000
320500 -- (-1971.728) (-1977.747) [-1973.621] (-1978.820) * (-1978.276) (-1977.249) (-1975.043) [-1975.019] -- 0:02:22
321000 -- (-1981.596) [-1972.033] (-1974.204) (-1983.144) * [-1974.306] (-1990.494) (-1973.126) (-1978.075) -- 0:02:21
321500 -- [-1974.847] (-1977.174) (-1974.399) (-1982.769) * (-1978.094) [-1976.961] (-1979.531) (-1977.461) -- 0:02:21
322000 -- [-1973.156] (-1975.567) (-1977.510) (-1979.273) * [-1975.966] (-1975.890) (-1973.539) (-1978.170) -- 0:02:23
322500 -- (-1975.055) (-1976.734) [-1973.450] (-1977.069) * (-1982.437) [-1972.774] (-1984.180) (-1977.063) -- 0:02:22
323000 -- (-1977.440) (-1979.584) [-1977.158] (-1982.911) * (-1979.641) (-1979.354) (-1981.345) [-1976.860] -- 0:02:22
323500 -- [-1975.732] (-1977.431) (-1983.195) (-1981.031) * [-1975.620] (-1970.150) (-1979.864) (-1972.963) -- 0:02:22
324000 -- (-1975.586) [-1980.398] (-1980.081) (-1979.219) * (-1980.142) [-1976.883] (-1988.511) (-1975.858) -- 0:02:21
324500 -- (-1976.019) [-1974.792] (-1981.981) (-1979.281) * [-1980.112] (-1977.529) (-1978.804) (-1975.875) -- 0:02:21
325000 -- (-1982.580) (-1980.960) (-1977.752) [-1973.151] * [-1987.780] (-1976.304) (-1992.775) (-1976.911) -- 0:02:21
Average standard deviation of split frequencies: 0.000000
325500 -- [-1976.741] (-1988.520) (-1972.118) (-1975.990) * (-1985.797) (-1986.305) (-1979.775) [-1971.719] -- 0:02:20
326000 -- (-1975.048) (-1981.079) (-1982.811) [-1976.983] * [-1978.148] (-1982.201) (-1976.959) (-1978.466) -- 0:02:20
326500 -- (-1972.595) [-1977.885] (-1979.684) (-1978.984) * (-1980.408) [-1974.136] (-1978.414) (-1978.482) -- 0:02:22
327000 -- (-1986.395) (-1983.606) [-1978.036] (-1980.414) * (-1986.833) (-1976.198) (-1980.030) [-1975.989] -- 0:02:22
327500 -- (-1972.414) (-1979.124) (-1974.450) [-1975.357] * (-1981.251) [-1971.368] (-1977.583) (-1975.534) -- 0:02:21
328000 -- (-1974.466) [-1980.832] (-1979.051) (-1980.696) * (-1989.113) (-1975.229) (-1986.278) [-1972.726] -- 0:02:21
328500 -- [-1984.875] (-1977.793) (-1979.052) (-1975.747) * (-1978.235) (-1985.290) (-1984.472) [-1975.105] -- 0:02:21
329000 -- (-1971.820) [-1977.492] (-1976.033) (-1979.896) * [-1970.055] (-1975.341) (-1988.349) (-1976.432) -- 0:02:20
329500 -- (-1975.751) [-1985.915] (-1979.168) (-1980.353) * [-1972.907] (-1981.405) (-1988.983) (-1977.797) -- 0:02:20
330000 -- (-1991.467) [-1976.623] (-1975.252) (-1980.891) * (-1977.621) (-1976.105) (-1981.293) [-1978.403] -- 0:02:20
Average standard deviation of split frequencies: 0.000000
330500 -- (-1974.012) (-1977.067) (-1974.554) [-1976.222] * [-1979.459] (-1978.048) (-1976.666) (-1984.162) -- 0:02:19
331000 -- (-1976.775) [-1976.071] (-1974.208) (-1980.894) * (-1976.845) [-1979.507] (-1978.629) (-1980.398) -- 0:02:19
331500 -- (-1977.307) (-1977.402) [-1982.862] (-1976.799) * (-1975.489) (-1977.069) [-1977.839] (-1978.779) -- 0:02:21
332000 -- (-1980.419) [-1973.409] (-1972.765) (-1975.286) * (-1977.500) [-1980.084] (-1974.382) (-1979.938) -- 0:02:20
332500 -- [-1977.798] (-1974.631) (-1979.033) (-1975.343) * [-1979.459] (-1979.003) (-1971.531) (-1979.065) -- 0:02:20
333000 -- (-1978.066) (-1983.530) (-1981.643) [-1977.956] * (-1975.533) [-1983.156] (-1976.767) (-1980.875) -- 0:02:20
333500 -- (-1991.721) (-1985.245) [-1980.262] (-1977.065) * (-1971.517) (-1982.246) (-1974.389) [-1977.555] -- 0:02:19
334000 -- [-1978.301] (-1980.508) (-1973.230) (-1981.100) * (-1978.786) (-1981.399) [-1973.658] (-1986.086) -- 0:02:19
334500 -- (-1982.294) (-1976.192) [-1973.075] (-1976.988) * (-1977.330) [-1971.190] (-1973.469) (-1978.674) -- 0:02:19
335000 -- (-1975.526) [-1980.211] (-1974.557) (-1971.335) * (-1981.143) (-1971.443) [-1982.769] (-1978.603) -- 0:02:18
Average standard deviation of split frequencies: 0.000000
335500 -- (-1974.748) (-1977.068) (-1972.258) [-1972.702] * (-1972.634) (-1976.907) [-1976.697] (-1973.006) -- 0:02:18
336000 -- (-1976.320) (-1974.743) [-1975.323] (-1971.619) * [-1975.109] (-1975.585) (-1978.704) (-1976.985) -- 0:02:20
336500 -- (-1976.143) [-1978.383] (-1976.551) (-1979.774) * (-1979.497) (-1977.080) [-1977.201] (-1979.133) -- 0:02:19
337000 -- (-1977.293) [-1978.986] (-1976.993) (-1978.665) * [-1977.527] (-1980.167) (-1980.369) (-1990.411) -- 0:02:19
337500 -- (-1979.507) (-1974.871) (-1977.224) [-1978.126] * [-1977.514] (-1976.061) (-1976.973) (-1983.065) -- 0:02:19
338000 -- (-1992.589) (-1975.692) [-1976.705] (-1978.296) * (-1974.799) (-1978.116) [-1976.158] (-1981.971) -- 0:02:19
338500 -- (-1980.733) [-1971.579] (-1980.715) (-1980.713) * (-1978.350) [-1973.805] (-1974.375) (-1982.163) -- 0:02:18
339000 -- [-1977.619] (-1976.230) (-1975.700) (-1984.210) * (-1979.288) [-1976.006] (-1975.447) (-1976.415) -- 0:02:18
339500 -- [-1974.976] (-1973.537) (-1979.266) (-1985.045) * (-1979.410) [-1977.558] (-1985.938) (-1976.383) -- 0:02:20
340000 -- (-1976.052) (-1981.576) [-1975.268] (-1988.466) * (-1973.424) [-1977.010] (-1975.692) (-1976.551) -- 0:02:19
Average standard deviation of split frequencies: 0.000000
340500 -- [-1977.207] (-1980.107) (-1981.895) (-1977.811) * (-1975.575) (-1974.894) [-1973.622] (-1980.299) -- 0:02:19
341000 -- [-1980.204] (-1972.945) (-1982.199) (-1977.008) * (-1974.352) [-1974.626] (-1973.733) (-1976.674) -- 0:02:19
341500 -- (-1982.950) (-1977.402) [-1977.243] (-1985.910) * [-1979.151] (-1978.934) (-1974.467) (-1978.309) -- 0:02:18
342000 -- (-1981.219) (-1972.419) [-1975.101] (-1982.462) * (-1978.625) (-1975.000) [-1979.243] (-1980.026) -- 0:02:18
342500 -- (-1981.169) [-1976.249] (-1979.673) (-1980.251) * (-1982.035) (-1977.293) (-1975.150) [-1983.064] -- 0:02:18
343000 -- [-1979.680] (-1975.808) (-1977.703) (-1977.668) * (-1977.122) (-1979.245) (-1974.866) [-1973.698] -- 0:02:17
343500 -- [-1977.288] (-1981.328) (-1977.140) (-1978.069) * [-1973.364] (-1973.434) (-1976.751) (-1980.635) -- 0:02:17
344000 -- (-1972.728) (-1977.914) (-1974.070) [-1977.153] * [-1974.711] (-1976.041) (-1974.813) (-1975.914) -- 0:02:19
344500 -- [-1982.844] (-1982.346) (-1976.999) (-1979.917) * (-1975.827) (-1977.198) [-1979.764] (-1979.453) -- 0:02:18
345000 -- (-1981.813) (-1972.720) (-1977.804) [-1978.614] * (-1977.094) (-1980.123) (-1979.634) [-1973.148] -- 0:02:18
Average standard deviation of split frequencies: 0.000000
345500 -- (-1979.460) (-1980.433) [-1972.492] (-1981.430) * (-1975.665) [-1977.050] (-1980.841) (-1970.367) -- 0:02:18
346000 -- (-1977.967) [-1976.127] (-1977.775) (-1979.810) * (-1978.617) (-1974.127) [-1978.745] (-1987.137) -- 0:02:17
346500 -- (-1976.995) (-1975.337) (-1978.413) [-1978.454] * [-1977.611] (-1970.188) (-1980.380) (-1972.819) -- 0:02:17
347000 -- (-1971.602) (-1974.985) [-1972.967] (-1980.850) * (-1980.085) [-1970.466] (-1980.926) (-1972.420) -- 0:02:17
347500 -- (-1974.362) [-1973.842] (-1980.146) (-1971.446) * (-1977.891) (-1975.929) [-1975.725] (-1976.056) -- 0:02:17
348000 -- (-1975.906) (-1977.949) (-1974.110) [-1975.602] * (-1974.215) [-1976.049] (-1975.483) (-1979.388) -- 0:02:16
348500 -- (-1977.165) [-1972.222] (-1973.476) (-1989.370) * (-1977.682) [-1977.728] (-1978.282) (-1975.529) -- 0:02:16
349000 -- (-1976.531) [-1972.756] (-1977.316) (-1977.534) * (-1975.092) [-1977.284] (-1986.000) (-1980.029) -- 0:02:18
349500 -- (-1979.718) [-1976.505] (-1974.087) (-1973.688) * (-1975.194) (-1985.056) (-1975.638) [-1979.206] -- 0:02:17
350000 -- (-1978.540) (-1979.176) (-1975.094) [-1973.798] * (-1972.845) (-1978.755) [-1979.264] (-1981.468) -- 0:02:17
Average standard deviation of split frequencies: 0.000000
350500 -- (-1981.131) (-1977.275) (-1982.830) [-1975.793] * (-1975.001) (-1977.428) [-1977.968] (-1972.931) -- 0:02:17
351000 -- (-1973.519) (-1971.926) (-1977.846) [-1973.661] * (-1977.818) (-1974.391) (-1981.305) [-1973.103] -- 0:02:16
351500 -- (-1985.197) (-1985.911) [-1976.881] (-1974.159) * [-1980.477] (-1977.653) (-1975.485) (-1977.475) -- 0:02:16
352000 -- (-1975.123) (-1987.435) [-1975.047] (-1976.010) * (-1972.148) [-1973.433] (-1976.636) (-1975.015) -- 0:02:16
352500 -- [-1976.757] (-1973.058) (-1978.494) (-1976.594) * (-1974.257) (-1976.377) (-1981.328) [-1972.973] -- 0:02:15
353000 -- (-1976.712) (-1980.080) [-1976.224] (-1983.096) * (-1976.116) (-1978.537) (-1981.142) [-1974.034] -- 0:02:15
353500 -- [-1972.966] (-1978.480) (-1971.526) (-1976.465) * [-1981.345] (-1979.984) (-1980.291) (-1976.205) -- 0:02:17
354000 -- (-1981.765) (-1976.287) (-1976.246) [-1974.508] * (-1974.488) (-1976.756) [-1974.263] (-1974.644) -- 0:02:16
354500 -- (-1979.410) [-1973.739] (-1976.208) (-1982.500) * [-1973.673] (-1974.075) (-1976.122) (-1977.808) -- 0:02:16
355000 -- [-1979.254] (-1977.897) (-1980.163) (-1976.737) * [-1975.045] (-1977.679) (-1975.081) (-1974.201) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
355500 -- [-1977.784] (-1978.214) (-1972.068) (-1980.032) * [-1975.879] (-1982.879) (-1976.539) (-1971.744) -- 0:02:15
356000 -- (-1979.609) (-1980.255) (-1979.962) [-1971.961] * (-1986.489) (-1985.920) [-1975.208] (-1973.485) -- 0:02:15
356500 -- (-1980.734) (-1975.372) [-1979.934] (-1977.895) * [-1984.211] (-1986.583) (-1974.500) (-1975.953) -- 0:02:15
357000 -- (-1975.799) (-1975.814) (-1979.284) [-1981.552] * (-1977.392) (-1987.282) (-1975.849) [-1974.580] -- 0:02:15
357500 -- [-1974.618] (-1972.518) (-1975.278) (-1979.176) * (-1975.494) (-1980.414) (-1977.170) [-1977.706] -- 0:02:14
358000 -- (-1976.589) [-1970.946] (-1984.922) (-1981.844) * [-1983.597] (-1974.457) (-1980.483) (-1971.483) -- 0:02:14
358500 -- (-1978.887) [-1976.133] (-1982.347) (-1978.101) * (-1985.320) [-1973.401] (-1972.453) (-1980.869) -- 0:02:15
359000 -- (-1978.877) [-1983.231] (-1978.615) (-1978.652) * (-1971.513) (-1977.777) [-1975.214] (-1982.121) -- 0:02:15
359500 -- (-1976.108) [-1971.813] (-1979.221) (-1982.251) * [-1971.120] (-1973.383) (-1977.325) (-1979.360) -- 0:02:15
360000 -- (-1974.541) [-1978.248] (-1977.614) (-1976.170) * [-1974.357] (-1975.691) (-1969.519) (-1981.253) -- 0:02:15
Average standard deviation of split frequencies: 0.000000
360500 -- (-1982.081) (-1975.062) [-1976.626] (-1974.701) * (-1975.831) (-1981.224) (-1979.247) [-1974.761] -- 0:02:14
361000 -- (-1981.660) (-1974.533) (-1974.483) [-1977.267] * [-1976.985] (-1977.846) (-1974.723) (-1975.865) -- 0:02:14
361500 -- (-1977.928) (-1977.619) (-1973.188) [-1975.527] * (-1975.604) (-1978.977) [-1976.151] (-1975.298) -- 0:02:14
362000 -- (-1977.780) [-1975.494] (-1976.227) (-1982.449) * [-1974.585] (-1973.785) (-1975.762) (-1973.229) -- 0:02:15
362500 -- (-1973.966) (-1976.468) (-1981.594) [-1977.078] * (-1974.348) (-1974.537) [-1974.765] (-1977.918) -- 0:02:15
363000 -- (-1975.903) (-1979.094) (-1975.415) [-1980.038] * (-1972.349) (-1979.229) (-1976.448) [-1972.782] -- 0:02:15
363500 -- [-1969.771] (-1976.501) (-1976.593) (-1977.046) * (-1973.585) (-1981.574) [-1977.567] (-1977.675) -- 0:02:14
364000 -- [-1974.923] (-1977.103) (-1972.657) (-1983.736) * (-1976.163) (-1981.420) (-1975.662) [-1978.376] -- 0:02:14
364500 -- (-1975.691) [-1974.987] (-1973.098) (-1973.585) * [-1973.765] (-1980.034) (-1980.323) (-1977.554) -- 0:02:14
365000 -- (-1976.026) (-1975.859) (-1976.738) [-1976.061] * (-1981.685) (-1977.850) (-1977.176) [-1970.915] -- 0:02:13
Average standard deviation of split frequencies: 0.000000
365500 -- (-1974.006) (-1976.838) (-1979.108) [-1972.513] * (-1975.073) [-1977.272] (-1971.472) (-1974.050) -- 0:02:13
366000 -- (-1974.476) (-1977.042) (-1978.179) [-1974.160] * [-1977.248] (-1980.183) (-1977.040) (-1975.542) -- 0:02:13
366500 -- [-1980.344] (-1983.990) (-1982.565) (-1973.454) * (-1984.970) [-1977.002] (-1977.977) (-1972.907) -- 0:02:13
367000 -- (-1976.158) [-1975.078] (-1988.485) (-1977.786) * (-1980.257) (-1984.161) [-1972.144] (-1980.158) -- 0:02:14
367500 -- (-1980.248) (-1973.135) [-1973.690] (-1970.407) * [-1979.709] (-1979.897) (-1976.220) (-1979.675) -- 0:02:14
368000 -- [-1974.367] (-1971.647) (-1974.424) (-1980.994) * (-1979.692) [-1977.068] (-1975.913) (-1979.234) -- 0:02:13
368500 -- (-1983.357) (-1973.994) (-1976.795) [-1978.664] * (-1977.155) (-1972.154) (-1975.786) [-1972.484] -- 0:02:13
369000 -- [-1975.970] (-1973.348) (-1975.030) (-1982.005) * [-1972.219] (-1974.478) (-1979.948) (-1977.180) -- 0:02:13
369500 -- (-1980.521) (-1974.072) [-1976.976] (-1982.859) * (-1974.332) [-1974.019] (-1978.731) (-1983.470) -- 0:02:13
370000 -- (-1977.293) (-1976.591) [-1973.397] (-1978.417) * [-1979.585] (-1978.750) (-1982.078) (-1979.782) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
370500 -- (-1977.367) (-1978.874) (-1972.664) [-1977.817] * [-1975.921] (-1979.524) (-1976.698) (-1976.080) -- 0:02:12
371000 -- (-1976.053) [-1973.233] (-1977.815) (-1979.245) * (-1976.696) (-1974.540) [-1970.580] (-1974.261) -- 0:02:12
371500 -- [-1972.242] (-1978.544) (-1981.630) (-1979.316) * [-1975.976] (-1980.683) (-1974.975) (-1972.976) -- 0:02:11
372000 -- (-1974.191) (-1979.610) [-1977.964] (-1977.001) * (-1974.713) [-1974.361] (-1976.575) (-1977.819) -- 0:02:13
372500 -- [-1981.656] (-1979.810) (-1976.676) (-1976.620) * (-1977.581) [-1978.642] (-1978.060) (-1979.388) -- 0:02:13
373000 -- (-1976.139) (-1974.526) [-1970.686] (-1975.026) * (-1977.139) (-1975.479) (-1975.090) [-1977.066] -- 0:02:12
373500 -- (-1976.535) (-1977.051) (-1981.226) [-1978.901] * (-1979.252) (-1972.587) (-1977.563) [-1971.601] -- 0:02:12
374000 -- [-1979.340] (-1978.389) (-1976.895) (-1984.031) * [-1974.736] (-1976.430) (-1982.014) (-1980.765) -- 0:02:12
374500 -- (-1979.889) (-1975.446) (-1972.352) [-1975.961] * [-1971.281] (-1975.186) (-1984.751) (-1975.402) -- 0:02:11
375000 -- (-1975.500) (-1985.733) [-1976.116] (-1974.920) * [-1974.693] (-1974.504) (-1978.671) (-1981.001) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
375500 -- (-1977.041) (-1985.096) (-1977.071) [-1973.568] * (-1979.338) [-1975.308] (-1982.707) (-1977.482) -- 0:02:11
376000 -- (-1973.078) (-1978.807) [-1977.825] (-1977.088) * (-1973.401) (-1977.984) (-1976.453) [-1973.671] -- 0:02:11
376500 -- (-1971.969) [-1975.013] (-1977.165) (-1978.943) * (-1974.688) [-1977.123] (-1977.272) (-1975.719) -- 0:02:12
377000 -- (-1974.005) (-1985.820) [-1986.227] (-1980.820) * (-1973.491) (-1972.288) (-1981.810) [-1978.552] -- 0:02:12
377500 -- [-1977.877] (-1983.293) (-1974.204) (-1973.069) * [-1971.312] (-1978.199) (-1980.968) (-1974.835) -- 0:02:11
378000 -- (-1984.191) [-1979.738] (-1978.102) (-1976.440) * (-1975.508) (-1975.732) (-1977.500) [-1977.674] -- 0:02:11
378500 -- [-1976.466] (-1977.682) (-1979.688) (-1976.731) * [-1972.574] (-1981.399) (-1978.220) (-1975.210) -- 0:02:11
379000 -- (-1971.915) [-1977.313] (-1975.635) (-1982.405) * (-1975.218) [-1978.423] (-1982.492) (-1978.185) -- 0:02:11
379500 -- (-1972.720) (-1982.638) [-1975.840] (-1978.485) * (-1972.037) [-1978.841] (-1975.985) (-1979.165) -- 0:02:10
380000 -- (-1973.654) (-1978.983) (-1980.221) [-1972.806] * [-1973.121] (-1974.008) (-1978.317) (-1977.825) -- 0:02:10
Average standard deviation of split frequencies: 0.000000
380500 -- (-1984.806) (-1975.767) [-1980.715] (-1978.932) * (-1978.234) (-1975.631) (-1972.326) [-1975.087] -- 0:02:10
381000 -- (-1974.733) (-1973.730) (-1979.514) [-1971.976] * (-1975.178) [-1977.840] (-1970.936) (-1975.113) -- 0:02:09
381500 -- (-1982.277) (-1976.239) (-1982.025) [-1975.364] * (-1982.227) (-1981.222) [-1974.667] (-1975.425) -- 0:02:11
382000 -- (-1981.805) (-1975.913) [-1985.249] (-1975.717) * (-1976.063) (-1971.089) (-1975.610) [-1973.415] -- 0:02:11
382500 -- (-1981.347) (-1972.680) [-1976.888] (-1991.250) * (-1974.046) (-1977.986) (-1984.701) [-1971.911] -- 0:02:10
383000 -- (-1977.497) (-1976.382) [-1971.674] (-1979.945) * [-1973.644] (-1980.287) (-1977.781) (-1978.198) -- 0:02:10
383500 -- (-1984.071) (-1970.720) [-1971.983] (-1975.148) * (-1971.952) (-1983.003) (-1983.576) [-1973.468] -- 0:02:10
384000 -- (-1978.610) [-1976.682] (-1978.724) (-1974.607) * (-1979.113) (-1976.842) [-1982.320] (-1979.662) -- 0:02:09
384500 -- (-1981.149) (-1979.621) [-1974.076] (-1980.666) * (-1978.053) [-1974.588] (-1975.324) (-1974.947) -- 0:02:09
385000 -- (-1982.378) [-1971.245] (-1975.273) (-1978.115) * [-1977.580] (-1976.832) (-1983.348) (-1973.288) -- 0:02:09
Average standard deviation of split frequencies: 0.000000
385500 -- [-1986.155] (-1978.716) (-1979.936) (-1985.714) * (-1973.805) [-1976.155] (-1982.352) (-1974.766) -- 0:02:09
386000 -- (-1980.134) (-1983.009) (-1979.415) [-1976.231] * (-1981.632) (-1975.465) [-1974.772] (-1987.657) -- 0:02:08
386500 -- (-1979.234) [-1979.177] (-1973.168) (-1980.898) * (-1976.039) (-1981.095) [-1976.779] (-1972.282) -- 0:02:10
387000 -- (-1981.724) [-1975.955] (-1984.463) (-1974.848) * (-1975.259) (-1973.767) [-1979.762] (-1973.104) -- 0:02:09
387500 -- (-1977.983) (-1976.153) (-1977.985) [-1977.936] * (-1978.912) (-1974.942) (-1978.483) [-1974.698] -- 0:02:09
388000 -- [-1981.275] (-1976.114) (-1978.448) (-1981.472) * (-1980.984) (-1979.434) (-1985.190) [-1977.172] -- 0:02:09
388500 -- (-1980.491) (-1977.133) [-1979.074] (-1975.916) * (-1981.458) (-1980.793) (-1982.219) [-1974.012] -- 0:02:09
389000 -- (-1976.131) [-1974.885] (-1979.427) (-1979.022) * (-1978.517) (-1983.853) (-1981.286) [-1979.095] -- 0:02:08
389500 -- (-1975.360) [-1977.479] (-1988.746) (-1980.782) * (-1981.445) (-1985.342) (-1980.132) [-1977.429] -- 0:02:08
390000 -- (-1980.240) (-1978.777) (-1984.363) [-1978.578] * (-1975.921) (-1983.110) (-1979.973) [-1977.773] -- 0:02:08
Average standard deviation of split frequencies: 0.000000
390500 -- (-1982.533) [-1975.875] (-1988.026) (-1976.800) * [-1978.529] (-1983.198) (-1978.713) (-1978.939) -- 0:02:07
391000 -- (-1974.264) (-1975.479) (-1975.361) [-1972.436] * (-1976.103) (-1981.528) (-1981.454) [-1978.449] -- 0:02:09
391500 -- [-1973.737] (-1973.078) (-1982.167) (-1975.726) * (-1974.018) [-1972.675] (-1984.881) (-1970.862) -- 0:02:09
392000 -- (-1976.139) [-1974.608] (-1971.787) (-1970.419) * (-1978.633) (-1981.005) [-1974.751] (-1976.311) -- 0:02:08
392500 -- (-1974.793) [-1979.171] (-1980.530) (-1973.207) * (-1980.554) (-1978.990) (-1977.755) [-1971.891] -- 0:02:08
393000 -- (-1978.854) [-1972.272] (-1982.769) (-1977.053) * (-1973.530) (-1975.349) (-1974.214) [-1972.501] -- 0:02:08
393500 -- (-1976.751) (-1974.405) (-1978.942) [-1977.710] * (-1974.691) [-1972.046] (-1975.959) (-1976.191) -- 0:02:07
394000 -- [-1979.838] (-1978.009) (-1981.555) (-1974.550) * (-1975.528) (-1974.030) [-1973.882] (-1979.260) -- 0:02:07
394500 -- [-1981.699] (-1978.271) (-1983.198) (-1972.055) * (-1975.022) [-1978.781] (-1971.537) (-1973.647) -- 0:02:07
395000 -- (-1973.005) [-1974.261] (-1979.695) (-1984.303) * (-1978.728) (-1970.658) (-1974.310) [-1976.712] -- 0:02:07
Average standard deviation of split frequencies: 0.000000
395500 -- (-1977.956) (-1981.689) [-1984.426] (-1978.228) * [-1971.156] (-1976.880) (-1974.314) (-1984.064) -- 0:02:08
396000 -- [-1981.571] (-1975.274) (-1982.748) (-1972.845) * (-1969.712) (-1978.659) (-1975.568) [-1971.251] -- 0:02:08
396500 -- (-1978.749) (-1981.534) (-1978.728) [-1973.813] * (-1980.510) (-1979.558) (-1979.862) [-1971.393] -- 0:02:07
397000 -- (-1982.300) (-1982.546) (-1980.037) [-1977.181] * (-1977.993) (-1981.256) [-1975.792] (-1973.692) -- 0:02:07
397500 -- (-1979.107) [-1977.883] (-1979.453) (-1973.585) * (-1975.625) [-1977.574] (-1984.885) (-1985.047) -- 0:02:07
398000 -- (-1975.789) (-1980.083) (-1983.904) [-1977.873] * [-1974.230] (-1975.515) (-1973.465) (-1973.808) -- 0:02:07
398500 -- (-1976.046) (-1972.756) (-1975.155) [-1979.558] * (-1974.302) (-1982.379) [-1977.059] (-1979.673) -- 0:02:06
399000 -- [-1972.064] (-1982.516) (-1979.729) (-1969.822) * [-1970.431] (-1976.262) (-1973.163) (-1978.291) -- 0:02:06
399500 -- (-1973.634) (-1976.927) (-1980.409) [-1975.051] * (-1980.146) (-1977.127) [-1973.091] (-1981.075) -- 0:02:06
400000 -- (-1976.976) (-1986.236) [-1975.386] (-1979.862) * [-1975.294] (-1974.262) (-1977.403) (-1976.576) -- 0:02:06
Average standard deviation of split frequencies: 0.000000
400500 -- (-1974.601) (-1981.409) (-1975.217) [-1975.823] * (-1979.495) (-1986.348) [-1974.444] (-1985.442) -- 0:02:07
401000 -- (-1977.570) (-1979.387) (-1981.532) [-1985.454] * [-1976.485] (-1980.014) (-1978.278) (-1975.847) -- 0:02:06
401500 -- [-1971.456] (-1980.588) (-1979.960) (-1980.656) * (-1974.365) (-1989.872) [-1975.359] (-1977.593) -- 0:02:06
402000 -- [-1976.605] (-1976.064) (-1973.598) (-1980.611) * (-1979.902) [-1975.133] (-1977.910) (-1984.095) -- 0:02:06
402500 -- (-1972.859) (-1982.432) (-1975.856) [-1986.001] * [-1975.938] (-1974.119) (-1979.765) (-1981.129) -- 0:02:06
403000 -- (-1980.415) (-1990.144) [-1982.382] (-1979.955) * (-1972.868) [-1972.745] (-1974.421) (-1975.615) -- 0:02:05
403500 -- (-1977.526) [-1980.998] (-1983.808) (-1983.266) * (-1978.082) (-1974.856) (-1976.925) [-1973.899] -- 0:02:05
404000 -- (-1977.010) (-1977.366) (-1978.055) [-1978.873] * [-1974.544] (-1972.313) (-1978.991) (-1974.222) -- 0:02:05
404500 -- (-1977.498) [-1974.044] (-1981.126) (-1975.014) * (-1973.190) [-1974.866] (-1978.677) (-1985.428) -- 0:02:05
405000 -- (-1974.889) (-1974.006) [-1974.571] (-1978.595) * [-1983.826] (-1976.922) (-1976.698) (-1977.868) -- 0:02:06
Average standard deviation of split frequencies: 0.000000
405500 -- (-1975.979) (-1976.479) (-1976.208) [-1975.749] * (-1981.748) (-1975.420) (-1972.750) [-1977.851] -- 0:02:06
406000 -- [-1976.776] (-1972.323) (-1981.085) (-1973.128) * (-1978.524) (-1974.190) [-1973.379] (-1973.314) -- 0:02:05
406500 -- (-1983.237) [-1974.704] (-1979.184) (-1977.509) * [-1975.429] (-1974.669) (-1981.081) (-1974.863) -- 0:02:05
407000 -- [-1981.386] (-1980.607) (-1984.208) (-1978.127) * [-1973.234] (-1970.745) (-1981.501) (-1982.934) -- 0:02:05
407500 -- (-1982.086) (-1978.508) (-1978.860) [-1976.213] * (-1975.481) [-1974.801] (-1973.767) (-1985.796) -- 0:02:05
408000 -- (-1973.112) [-1976.353] (-1976.185) (-1983.005) * (-1980.272) [-1980.268] (-1978.438) (-1981.059) -- 0:02:04
408500 -- (-1974.283) (-1979.762) (-1981.126) [-1979.111] * (-1976.913) (-1970.744) (-1981.607) [-1984.772] -- 0:02:04
409000 -- [-1974.257] (-1978.128) (-1976.524) (-1978.063) * (-1977.083) (-1980.035) (-1978.044) [-1979.484] -- 0:02:04
409500 -- (-1975.557) (-1976.996) (-1978.323) [-1979.513] * (-1976.455) [-1969.240] (-1987.317) (-1981.731) -- 0:02:04
410000 -- (-1971.329) (-1977.766) (-1982.611) [-1981.322] * (-1979.006) [-1971.671] (-1984.926) (-1979.691) -- 0:02:05
Average standard deviation of split frequencies: 0.000000
410500 -- (-1977.564) (-1978.118) (-1984.011) [-1972.289] * (-1972.575) (-1981.917) [-1977.329] (-1989.328) -- 0:02:04
411000 -- [-1977.216] (-1973.232) (-1980.940) (-1982.482) * (-1975.482) (-1982.057) (-1976.681) [-1978.261] -- 0:02:04
411500 -- (-1976.639) [-1973.768] (-1980.513) (-1981.915) * [-1976.761] (-1974.574) (-1979.320) (-1982.426) -- 0:02:04
412000 -- (-1971.709) (-1980.589) [-1978.134] (-1986.420) * (-1981.370) (-1980.439) [-1979.560] (-1979.784) -- 0:02:04
412500 -- [-1979.476] (-1979.521) (-1986.750) (-1977.753) * (-1979.526) [-1974.318] (-1975.669) (-1986.902) -- 0:02:03
413000 -- (-1973.354) [-1973.718] (-1977.501) (-1982.711) * (-1975.802) [-1981.198] (-1974.429) (-1979.986) -- 0:02:03
413500 -- (-1977.693) (-1978.347) (-1980.548) [-1973.597] * (-1977.952) (-1984.508) [-1975.025] (-1974.293) -- 0:02:03
414000 -- [-1976.225] (-1975.269) (-1975.214) (-1982.349) * [-1974.266] (-1978.324) (-1976.874) (-1975.992) -- 0:02:03
414500 -- (-1974.625) [-1978.149] (-1979.966) (-1978.666) * (-1977.665) (-1971.894) [-1974.291] (-1980.672) -- 0:02:04
415000 -- (-1977.267) (-1981.413) [-1973.645] (-1978.067) * (-1978.873) (-1974.653) [-1974.698] (-1973.412) -- 0:02:04
Average standard deviation of split frequencies: 0.000000
415500 -- [-1973.148] (-1981.155) (-1981.881) (-1975.323) * (-1974.878) [-1976.409] (-1979.703) (-1976.961) -- 0:02:03
416000 -- (-1985.459) [-1976.785] (-1987.226) (-1979.100) * (-1974.682) (-1981.600) [-1975.009] (-1976.177) -- 0:02:03
416500 -- (-1984.861) (-1985.176) (-1976.489) [-1971.002] * [-1973.136] (-1985.681) (-1976.313) (-1976.368) -- 0:02:03
417000 -- [-1979.748] (-1980.856) (-1976.905) (-1974.772) * (-1978.162) (-1978.270) [-1973.053] (-1980.704) -- 0:02:03
417500 -- [-1971.199] (-1978.150) (-1976.026) (-1982.090) * (-1983.479) [-1970.946] (-1977.214) (-1975.420) -- 0:02:02
418000 -- [-1977.211] (-1972.550) (-1977.057) (-1981.627) * (-1981.669) (-1978.082) [-1975.217] (-1976.959) -- 0:02:02
418500 -- (-1979.140) [-1978.504] (-1978.340) (-1975.162) * [-1978.204] (-1982.179) (-1976.456) (-1977.367) -- 0:02:02
419000 -- (-1978.858) (-1975.541) [-1973.085] (-1985.860) * (-1975.138) [-1975.090] (-1980.157) (-1975.207) -- 0:02:02
419500 -- (-1972.191) (-1981.112) (-1980.336) [-1973.011] * (-1986.114) [-1976.073] (-1977.776) (-1984.376) -- 0:02:03
420000 -- (-1976.195) (-1978.839) [-1974.528] (-1972.593) * (-1974.457) [-1975.855] (-1975.384) (-1973.530) -- 0:02:02
Average standard deviation of split frequencies: 0.000000
420500 -- (-1978.083) (-1978.842) [-1974.809] (-1973.330) * (-1975.338) (-1978.718) [-1976.758] (-1977.732) -- 0:02:02
421000 -- [-1975.472] (-1979.168) (-1976.951) (-1979.132) * [-1975.810] (-1981.411) (-1974.520) (-1976.151) -- 0:02:02
421500 -- (-1978.772) [-1973.243] (-1981.755) (-1978.655) * (-1976.678) (-1975.939) (-1977.765) [-1972.085] -- 0:02:02
422000 -- (-1975.408) (-1977.966) (-1985.619) [-1974.573] * (-1973.530) (-1982.104) (-1973.823) [-1974.195] -- 0:02:01
422500 -- (-1983.877) [-1977.184] (-1978.774) (-1976.264) * (-1979.477) (-1981.001) [-1980.412] (-1979.716) -- 0:02:01
423000 -- [-1976.243] (-1980.446) (-1976.768) (-1983.566) * (-1980.341) (-1978.183) (-1976.650) [-1980.914] -- 0:02:01
423500 -- [-1975.294] (-1981.833) (-1983.965) (-1979.384) * (-1984.903) (-1983.273) (-1978.052) [-1972.892] -- 0:02:01
424000 -- (-1975.181) (-1973.007) (-1975.532) [-1986.272] * (-1983.255) (-1974.261) (-1974.958) [-1975.533] -- 0:02:02
424500 -- (-1981.141) (-1985.690) (-1973.175) [-1980.200] * (-1977.848) (-1971.753) [-1976.869] (-1978.097) -- 0:02:02
425000 -- (-1985.398) [-1974.597] (-1975.836) (-1984.315) * (-1972.881) (-1976.962) [-1976.919] (-1981.508) -- 0:02:01
Average standard deviation of split frequencies: 0.000000
425500 -- (-1975.293) [-1971.872] (-1978.299) (-1980.009) * [-1978.333] (-1975.586) (-1971.867) (-1978.655) -- 0:02:01
426000 -- (-1981.822) (-1976.148) (-1977.715) [-1977.547] * (-1973.750) [-1979.990] (-1982.457) (-1974.982) -- 0:02:01
426500 -- (-1985.203) (-1978.224) (-1975.799) [-1976.806] * [-1977.358] (-1983.291) (-1977.992) (-1970.625) -- 0:02:01
427000 -- (-1975.479) (-1977.420) [-1976.414] (-1972.453) * (-1975.618) (-1980.077) [-1978.624] (-1974.640) -- 0:02:00
427500 -- (-1977.070) (-1982.108) [-1975.213] (-1979.554) * (-1981.309) (-1973.366) (-1978.210) [-1975.534] -- 0:02:00
428000 -- (-1977.051) (-1976.746) [-1972.229] (-1974.405) * (-1974.697) (-1975.400) (-1979.770) [-1976.080] -- 0:02:00
428500 -- [-1978.391] (-1983.794) (-1979.028) (-1977.871) * (-1972.188) (-1977.964) [-1973.587] (-1976.310) -- 0:02:00
429000 -- [-1971.426] (-1983.679) (-1981.560) (-1984.855) * (-1972.341) [-1972.167] (-1979.405) (-1977.045) -- 0:02:01
429500 -- (-1974.286) [-1975.359] (-1973.561) (-1980.995) * (-1973.274) [-1976.505] (-1980.854) (-1978.269) -- 0:02:00
430000 -- [-1974.981] (-1977.785) (-1975.737) (-1972.283) * (-1974.610) (-1975.200) [-1970.953] (-1978.787) -- 0:02:00
Average standard deviation of split frequencies: 0.000000
430500 -- (-1987.682) (-1975.192) [-1975.331] (-1981.022) * (-1978.626) (-1972.603) (-1973.058) [-1978.640] -- 0:02:00
431000 -- (-1974.898) (-1976.267) (-1970.457) [-1975.493] * (-1978.384) (-1978.411) [-1975.556] (-1974.660) -- 0:02:00
431500 -- [-1976.958] (-1976.295) (-1972.934) (-1977.926) * (-1975.405) (-1975.968) [-1971.206] (-1977.139) -- 0:01:59
432000 -- [-1972.052] (-1975.523) (-1973.323) (-1979.167) * (-1976.336) (-1973.026) (-1974.857) [-1977.609] -- 0:01:59
432500 -- [-1975.989] (-1977.420) (-1977.774) (-1979.112) * (-1976.004) [-1976.215] (-1981.866) (-1976.724) -- 0:01:59
433000 -- (-1973.384) (-1977.941) (-1979.467) [-1978.136] * (-1976.654) (-1978.650) (-1977.669) [-1975.940] -- 0:01:59
433500 -- (-1973.368) (-1978.723) (-1985.248) [-1976.483] * (-1978.112) (-1983.082) [-1974.745] (-1974.924) -- 0:01:58
434000 -- [-1978.024] (-1975.242) (-1979.713) (-1971.341) * (-1975.354) (-1979.505) (-1972.798) [-1972.216] -- 0:01:59
434500 -- [-1976.393] (-1982.573) (-1983.892) (-1974.499) * [-1973.912] (-1975.429) (-1973.543) (-1972.369) -- 0:01:59
435000 -- [-1981.395] (-1978.946) (-1980.481) (-1974.219) * (-1974.600) (-1977.011) (-1977.465) [-1976.669] -- 0:01:59
Average standard deviation of split frequencies: 0.000000
435500 -- (-1974.466) (-1983.695) [-1983.056] (-1983.023) * [-1977.096] (-1983.583) (-1980.201) (-1975.333) -- 0:01:59
436000 -- (-1972.292) (-1979.489) (-1978.878) [-1972.863] * (-1980.968) (-1979.214) (-1987.047) [-1979.094] -- 0:01:59
436500 -- (-1977.293) (-1976.162) (-1976.872) [-1973.383] * [-1971.743] (-1978.010) (-1985.335) (-1974.952) -- 0:01:58
437000 -- (-1974.967) [-1974.558] (-1975.890) (-1975.351) * [-1977.515] (-1979.289) (-1982.562) (-1976.286) -- 0:01:58
437500 -- (-1979.404) (-1976.826) (-1974.324) [-1980.034] * (-1980.259) (-1984.397) [-1979.853] (-1974.256) -- 0:01:58
438000 -- (-1982.126) (-1984.100) (-1974.792) [-1976.668] * (-1975.683) (-1978.619) [-1977.712] (-1979.278) -- 0:01:58
438500 -- (-1977.617) [-1977.306] (-1973.829) (-1974.186) * (-1976.868) (-1982.827) [-1977.422] (-1982.228) -- 0:01:59
439000 -- [-1979.421] (-1974.669) (-1977.885) (-1978.059) * (-1983.295) (-1976.263) [-1974.346] (-1976.829) -- 0:01:58
439500 -- (-1974.307) (-1975.350) (-1978.099) [-1974.823] * [-1970.962] (-1971.650) (-1975.882) (-1978.974) -- 0:01:58
440000 -- [-1971.144] (-1977.414) (-1975.076) (-1977.851) * (-1971.260) [-1978.212] (-1970.581) (-1981.624) -- 0:01:58
Average standard deviation of split frequencies: 0.000000
440500 -- (-1976.409) (-1975.695) (-1979.641) [-1977.047] * (-1977.148) (-1976.120) (-1978.326) [-1984.262] -- 0:01:58
441000 -- (-1977.477) [-1977.140] (-1979.844) (-1975.243) * (-1977.291) (-1974.307) [-1973.864] (-1981.896) -- 0:01:57
441500 -- (-1976.502) (-1979.994) [-1972.654] (-1973.974) * (-1986.463) (-1977.376) [-1972.807] (-1982.188) -- 0:01:57
442000 -- [-1974.609] (-1976.221) (-1977.214) (-1977.628) * (-1976.077) (-1978.413) [-1977.795] (-1984.907) -- 0:01:57
442500 -- (-1979.011) (-1972.272) [-1977.849] (-1980.670) * [-1974.774] (-1976.643) (-1976.661) (-1978.418) -- 0:01:57
443000 -- (-1979.919) [-1972.517] (-1974.426) (-1979.864) * [-1977.208] (-1980.728) (-1974.143) (-1976.562) -- 0:01:56
443500 -- (-1982.219) [-1976.227] (-1975.775) (-1984.817) * (-1976.867) (-1975.208) [-1978.731] (-1979.051) -- 0:01:57
444000 -- (-1977.860) (-1972.852) (-1975.255) [-1978.153] * (-1974.663) (-1980.010) [-1974.382] (-1976.525) -- 0:01:57
444500 -- [-1977.146] (-1974.790) (-1978.716) (-1978.401) * [-1979.011] (-1977.839) (-1974.188) (-1979.380) -- 0:01:57
445000 -- (-1974.678) (-1973.985) (-1977.446) [-1975.677] * (-1973.541) (-1980.732) [-1979.876] (-1976.805) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
445500 -- (-1975.876) [-1981.346] (-1972.667) (-1978.547) * (-1972.301) (-1976.457) (-1976.049) [-1975.031] -- 0:01:56
446000 -- (-1974.741) [-1978.997] (-1976.084) (-1977.542) * [-1974.903] (-1974.033) (-1975.982) (-1979.488) -- 0:01:56
446500 -- (-1977.732) (-1977.805) [-1975.088] (-1975.442) * (-1980.019) (-1980.231) (-1975.677) [-1979.424] -- 0:01:56
447000 -- (-1977.064) [-1978.328] (-1977.330) (-1975.630) * (-1975.541) [-1975.784] (-1979.199) (-1981.142) -- 0:01:56
447500 -- (-1986.726) [-1974.478] (-1975.487) (-1977.736) * (-1973.089) (-1975.344) (-1989.388) [-1981.245] -- 0:01:56
448000 -- [-1982.437] (-1979.840) (-1986.348) (-1979.085) * (-1976.706) [-1973.162] (-1979.153) (-1972.545) -- 0:01:57
448500 -- (-1981.662) (-1979.518) (-1984.280) [-1973.499] * (-1980.916) [-1976.524] (-1975.473) (-1974.399) -- 0:01:56
449000 -- (-1976.342) [-1977.338] (-1983.225) (-1973.691) * [-1974.225] (-1987.245) (-1976.836) (-1971.911) -- 0:01:56
449500 -- (-1972.769) (-1976.411) (-1978.135) [-1974.863] * (-1977.133) (-1978.824) [-1974.379] (-1972.567) -- 0:01:56
450000 -- [-1976.988] (-1979.173) (-1978.450) (-1973.842) * [-1977.711] (-1972.216) (-1977.331) (-1975.141) -- 0:01:56
Average standard deviation of split frequencies: 0.000000
450500 -- (-1983.730) (-1989.804) [-1980.462] (-1980.200) * [-1974.937] (-1979.063) (-1976.123) (-1976.316) -- 0:01:55
451000 -- (-1977.104) (-1994.274) (-1975.347) [-1977.318] * (-1980.015) (-1972.202) [-1980.312] (-1980.416) -- 0:01:55
451500 -- (-1975.409) (-1977.593) [-1977.848] (-1977.018) * (-1976.371) (-1976.342) (-1977.824) [-1977.008] -- 0:01:55
452000 -- [-1978.371] (-1973.726) (-1973.981) (-1978.048) * (-1983.960) [-1974.865] (-1974.996) (-1977.190) -- 0:01:55
452500 -- (-1971.398) [-1972.766] (-1976.823) (-1972.287) * (-1978.927) (-1974.140) (-1973.538) [-1976.265] -- 0:01:54
453000 -- (-1980.817) [-1972.389] (-1974.179) (-1973.763) * (-1980.273) (-1975.231) [-1973.440] (-1976.127) -- 0:01:55
453500 -- [-1976.252] (-1973.286) (-1982.817) (-1976.864) * [-1980.573] (-1975.044) (-1976.628) (-1981.040) -- 0:01:55
454000 -- (-1981.888) (-1977.860) [-1976.350] (-1975.687) * (-1977.363) (-1976.539) [-1979.867] (-1979.155) -- 0:01:55
454500 -- [-1973.862] (-1976.552) (-1975.195) (-1982.754) * (-1981.320) (-1983.910) (-1975.687) [-1974.072] -- 0:01:55
455000 -- (-1983.142) [-1974.821] (-1976.760) (-1980.584) * (-1977.098) (-1977.331) (-1975.996) [-1972.351] -- 0:01:54
Average standard deviation of split frequencies: 0.000000
455500 -- (-1973.006) (-1975.977) [-1975.978] (-1995.029) * (-1980.801) [-1976.449] (-1975.750) (-1981.967) -- 0:01:54
456000 -- (-1977.211) (-1982.381) [-1977.983] (-1977.687) * [-1979.135] (-1978.386) (-1980.761) (-1981.826) -- 0:01:54
456500 -- [-1974.755] (-1977.904) (-1977.715) (-1982.752) * (-1979.400) [-1977.508] (-1980.074) (-1974.759) -- 0:01:54
457000 -- (-1976.777) [-1976.390] (-1976.768) (-1975.577) * (-1977.359) [-1971.651] (-1979.538) (-1972.912) -- 0:01:54
457500 -- [-1977.213] (-1978.595) (-1977.195) (-1979.805) * (-1975.137) [-1972.819] (-1979.532) (-1981.896) -- 0:01:55
458000 -- (-1978.461) (-1975.184) (-1983.859) [-1974.528] * (-1979.338) (-1978.927) [-1980.294] (-1980.575) -- 0:01:54
458500 -- [-1982.245] (-1977.613) (-1979.536) (-1981.163) * (-1979.255) (-1975.699) [-1973.316] (-1973.485) -- 0:01:54
459000 -- (-1983.771) (-1982.978) [-1976.850] (-1977.702) * (-1978.856) (-1974.095) (-1977.375) [-1976.516] -- 0:01:54
459500 -- (-1975.637) (-1977.137) [-1974.484] (-1984.913) * (-1977.835) [-1973.461] (-1976.373) (-1979.419) -- 0:01:54
460000 -- (-1970.573) (-1979.678) (-1977.743) [-1972.320] * (-1978.676) [-1977.572] (-1973.290) (-1975.181) -- 0:01:53
Average standard deviation of split frequencies: 0.000000
460500 -- (-1976.820) (-1981.726) (-1977.461) [-1979.092] * (-1979.486) (-1980.456) [-1975.227] (-1973.547) -- 0:01:53
461000 -- (-1973.881) (-1980.434) (-1981.844) [-1978.099] * (-1988.293) (-1978.969) (-1974.867) [-1975.448] -- 0:01:53
461500 -- [-1980.401] (-1987.296) (-1979.507) (-1975.232) * [-1978.987] (-1985.738) (-1975.715) (-1975.102) -- 0:01:53
462000 -- (-1977.355) [-1981.715] (-1984.481) (-1976.707) * (-1975.897) (-1981.805) [-1972.116] (-1983.838) -- 0:01:52
462500 -- (-1979.579) (-1976.941) (-1977.531) [-1974.594] * (-1978.400) (-1978.439) [-1976.841] (-1973.266) -- 0:01:53
463000 -- (-1977.638) [-1975.488] (-1974.772) (-1981.740) * (-1982.854) (-1978.595) [-1977.563] (-1977.718) -- 0:01:53
463500 -- (-1978.637) (-1979.338) [-1983.429] (-1984.430) * (-1972.814) [-1978.129] (-1980.329) (-1976.444) -- 0:01:53
464000 -- (-1975.793) (-1981.177) [-1978.717] (-1979.338) * (-1975.071) [-1970.864] (-1981.789) (-1979.164) -- 0:01:53
464500 -- [-1974.016] (-1982.539) (-1977.529) (-1977.622) * [-1976.250] (-1986.972) (-1980.605) (-1975.655) -- 0:01:52
465000 -- [-1977.386] (-1981.504) (-1974.170) (-1976.276) * (-1975.237) [-1980.046] (-1978.896) (-1975.144) -- 0:01:52
Average standard deviation of split frequencies: 0.000000
465500 -- (-1973.331) (-1979.959) [-1972.301] (-1977.661) * (-1975.118) [-1975.343] (-1984.230) (-1982.785) -- 0:01:52
466000 -- (-1980.625) (-1978.018) [-1976.810] (-1977.385) * (-1976.938) (-1975.614) (-1982.324) [-1974.725] -- 0:01:52
466500 -- (-1975.511) (-1977.904) [-1974.084] (-1975.051) * (-1974.204) [-1978.566] (-1979.635) (-1981.001) -- 0:01:52
467000 -- [-1975.857] (-1979.003) (-1976.037) (-1973.704) * [-1976.312] (-1977.170) (-1975.020) (-1978.927) -- 0:01:51
467500 -- (-1977.303) (-1977.574) [-1976.344] (-1978.590) * [-1975.607] (-1977.927) (-1980.470) (-1983.854) -- 0:01:52
468000 -- [-1974.823] (-1982.738) (-1978.068) (-1975.880) * (-1977.908) (-1981.513) [-1973.713] (-1976.321) -- 0:01:52
468500 -- [-1974.409] (-1979.664) (-1975.471) (-1977.988) * (-1980.285) (-1973.390) [-1979.921] (-1983.695) -- 0:01:52
469000 -- (-1979.038) (-1975.838) [-1972.530] (-1978.018) * (-1971.852) (-1977.793) (-1977.163) [-1973.581] -- 0:01:52
469500 -- (-1981.968) (-1979.074) (-1975.839) [-1971.976] * (-1975.461) [-1975.638] (-1978.105) (-1974.315) -- 0:01:51
470000 -- (-1976.861) (-1977.788) (-1976.829) [-1975.374] * (-1973.248) (-1976.466) [-1975.608] (-1980.248) -- 0:01:51
Average standard deviation of split frequencies: 0.000000
470500 -- (-1974.351) [-1979.352] (-1974.233) (-1979.290) * (-1974.444) (-1975.471) [-1971.955] (-1979.845) -- 0:01:51
471000 -- (-1981.411) (-1977.435) (-1978.891) [-1977.400] * [-1974.667] (-1974.332) (-1975.898) (-1981.923) -- 0:01:51
471500 -- (-1990.722) [-1975.141] (-1980.530) (-1974.301) * (-1976.053) (-1975.242) [-1974.062] (-1984.720) -- 0:01:50
472000 -- (-1976.339) (-1973.622) [-1976.273] (-1983.379) * (-1977.528) (-1976.053) [-1974.437] (-1980.793) -- 0:01:51
472500 -- (-1980.018) (-1973.336) [-1975.733] (-1979.263) * (-1977.011) (-1980.675) (-1976.367) [-1973.352] -- 0:01:51
473000 -- (-1979.413) (-1977.571) (-1978.018) [-1972.267] * (-1976.692) (-1977.657) [-1971.747] (-1977.559) -- 0:01:51
473500 -- (-1975.999) (-1977.658) (-1981.231) [-1973.477] * (-1976.436) (-1976.747) (-1973.392) [-1974.679] -- 0:01:51
474000 -- (-1976.805) (-1974.780) [-1973.838] (-1976.747) * [-1977.703] (-1976.383) (-1978.410) (-1970.470) -- 0:01:50
474500 -- (-1974.228) (-1986.658) (-1983.165) [-1979.687] * (-1977.467) [-1976.539] (-1973.238) (-1977.115) -- 0:01:50
475000 -- (-1975.622) (-1975.617) [-1980.035] (-1975.854) * [-1981.325] (-1973.258) (-1981.150) (-1979.913) -- 0:01:50
Average standard deviation of split frequencies: 0.000000
475500 -- (-1972.083) (-1982.497) [-1974.420] (-1975.270) * (-1974.345) [-1971.763] (-1983.200) (-1976.357) -- 0:01:50
476000 -- [-1976.012] (-1985.339) (-1977.885) (-1980.865) * (-1977.322) [-1980.576] (-1977.985) (-1977.526) -- 0:01:50
476500 -- (-1979.385) (-1982.587) (-1985.359) [-1978.175] * (-1979.664) [-1971.563] (-1977.722) (-1975.456) -- 0:01:49
477000 -- (-1974.129) (-1973.031) [-1973.160] (-1975.955) * (-1977.277) [-1975.856] (-1973.199) (-1975.461) -- 0:01:50
477500 -- [-1970.925] (-1973.728) (-1978.621) (-1980.182) * (-1977.694) (-1977.109) (-1981.634) [-1976.076] -- 0:01:50
478000 -- (-1974.020) (-1974.894) [-1981.619] (-1978.575) * (-1977.514) (-1974.491) (-1976.355) [-1974.939] -- 0:01:50
478500 -- (-1978.020) [-1985.032] (-1975.526) (-1977.252) * (-1980.334) (-1975.589) [-1974.941] (-1977.900) -- 0:01:50
479000 -- [-1972.579] (-1978.167) (-1979.803) (-1979.197) * [-1977.906] (-1973.620) (-1977.484) (-1981.633) -- 0:01:49
479500 -- (-1979.670) [-1970.691] (-1973.191) (-1973.518) * (-1984.915) (-1974.481) [-1974.777] (-1984.996) -- 0:01:49
480000 -- (-1979.117) (-1975.177) (-1986.674) [-1974.483] * (-1976.347) (-1986.420) [-1974.140] (-1983.368) -- 0:01:49
Average standard deviation of split frequencies: 0.000000
480500 -- (-1980.352) [-1984.633] (-1977.505) (-1977.843) * [-1975.846] (-1980.422) (-1973.897) (-1977.419) -- 0:01:49
481000 -- (-1974.510) (-1979.670) (-1975.875) [-1970.350] * [-1972.873] (-1979.320) (-1979.717) (-1977.955) -- 0:01:48
481500 -- (-1985.322) (-1978.400) (-1975.015) [-1976.003] * (-1978.086) [-1982.852] (-1982.080) (-1983.696) -- 0:01:49
482000 -- (-1974.310) [-1974.392] (-1978.558) (-1978.656) * [-1978.446] (-1984.018) (-1983.086) (-1979.664) -- 0:01:49
482500 -- (-1977.008) (-1979.412) [-1975.942] (-1981.002) * [-1978.111] (-1978.207) (-1978.121) (-1978.173) -- 0:01:49
483000 -- (-1971.826) [-1979.034] (-1975.712) (-1981.022) * (-1975.996) [-1972.920] (-1978.028) (-1975.892) -- 0:01:49
483500 -- (-1977.672) [-1976.269] (-1980.624) (-1979.490) * (-1976.987) (-1974.301) (-1986.200) [-1979.674] -- 0:01:48
484000 -- (-1977.066) (-1984.082) (-1975.764) [-1972.556] * (-1978.269) (-1974.819) [-1974.230] (-1979.394) -- 0:01:48
484500 -- (-1988.273) [-1977.536] (-1977.723) (-1974.942) * (-1982.351) (-1975.685) (-1973.802) [-1981.093] -- 0:01:48
485000 -- (-1977.882) (-1974.768) (-1975.775) [-1972.901] * [-1975.947] (-1980.910) (-1972.966) (-1981.006) -- 0:01:48
Average standard deviation of split frequencies: 0.000000
485500 -- (-1971.758) [-1976.023] (-1983.719) (-1971.267) * [-1972.165] (-1981.213) (-1978.128) (-1985.777) -- 0:01:48
486000 -- (-1973.171) (-1978.170) [-1975.113] (-1980.759) * [-1981.438] (-1981.434) (-1979.207) (-1980.541) -- 0:01:47
486500 -- (-1980.135) (-1973.050) [-1976.498] (-1978.666) * (-1978.884) [-1976.562] (-1981.309) (-1971.602) -- 0:01:48
487000 -- (-1977.624) [-1977.181] (-1976.073) (-1976.144) * (-1978.689) [-1978.055] (-1980.610) (-1974.205) -- 0:01:48
487500 -- (-1975.814) (-1985.535) (-1978.440) [-1976.428] * [-1975.763] (-1979.812) (-1982.269) (-1972.681) -- 0:01:48
488000 -- (-1973.831) (-1971.960) [-1978.282] (-1974.873) * [-1969.407] (-1974.207) (-1984.183) (-1978.025) -- 0:01:48
488500 -- (-1977.694) (-1972.743) (-1979.092) [-1977.965] * [-1974.507] (-1979.107) (-1984.537) (-1978.735) -- 0:01:47
489000 -- [-1979.224] (-1976.789) (-1974.920) (-1980.938) * (-1975.021) (-1979.702) [-1976.419] (-1979.637) -- 0:01:47
489500 -- [-1976.990] (-1988.634) (-1977.567) (-1972.599) * (-1975.481) [-1975.057] (-1981.263) (-1980.968) -- 0:01:47
490000 -- (-1982.038) (-1985.096) (-1974.543) [-1972.932] * (-1977.116) (-1975.485) (-1974.631) [-1973.060] -- 0:01:47
Average standard deviation of split frequencies: 0.000000
490500 -- (-1975.518) (-1977.663) (-1976.202) [-1976.670] * [-1976.778] (-1972.297) (-1974.512) (-1975.662) -- 0:01:46
491000 -- (-1972.596) (-1979.879) [-1979.124] (-1971.251) * [-1978.879] (-1973.305) (-1976.348) (-1981.325) -- 0:01:47
491500 -- (-1979.589) (-1975.241) (-1977.397) [-1975.370] * (-1981.675) [-1976.180] (-1981.044) (-1980.967) -- 0:01:47
492000 -- [-1974.946] (-1975.289) (-1974.237) (-1975.593) * (-1979.134) (-1983.879) (-1978.843) [-1973.824] -- 0:01:47
492500 -- (-1974.918) [-1973.073] (-1974.500) (-1971.451) * (-1974.445) (-1970.601) [-1977.210] (-1982.157) -- 0:01:47
493000 -- (-1977.452) [-1976.759] (-1973.382) (-1980.986) * (-1984.020) [-1973.723] (-1975.286) (-1978.304) -- 0:01:46
493500 -- (-1976.071) (-1978.862) [-1973.436] (-1979.073) * (-1980.016) (-1977.751) [-1975.181] (-1984.084) -- 0:01:46
494000 -- (-1975.811) (-1984.258) (-1976.969) [-1975.857] * (-1975.168) (-1982.292) (-1977.140) [-1975.855] -- 0:01:46
494500 -- (-1977.516) (-1981.790) (-1974.620) [-1977.583] * (-1984.564) (-1977.272) (-1980.879) [-1978.628] -- 0:01:46
495000 -- (-1978.634) (-1978.847) (-1977.927) [-1984.655] * (-1990.286) (-1975.060) (-1973.869) [-1970.015] -- 0:01:46
Average standard deviation of split frequencies: 0.000000
495500 -- [-1975.790] (-1979.672) (-1982.099) (-1976.246) * (-1981.860) (-1979.094) (-1979.768) [-1981.000] -- 0:01:45
496000 -- (-1976.580) (-1975.239) (-1975.233) [-1976.233] * (-1980.313) [-1979.975] (-1983.926) (-1974.526) -- 0:01:46
496500 -- (-1983.764) (-1976.156) [-1973.407] (-1972.801) * (-1975.753) (-1977.831) [-1981.147] (-1975.050) -- 0:01:46
497000 -- (-1986.769) [-1978.149] (-1978.099) (-1973.858) * (-1977.564) (-1979.853) [-1977.558] (-1976.004) -- 0:01:46
497500 -- (-1978.035) [-1976.059] (-1978.649) (-1978.022) * (-1974.277) (-1987.092) (-1977.302) [-1978.312] -- 0:01:46
498000 -- (-1979.288) (-1976.105) [-1975.229] (-1980.227) * [-1979.490] (-1983.769) (-1974.841) (-1977.652) -- 0:01:45
498500 -- (-1979.868) (-1975.276) (-1979.014) [-1972.000] * [-1974.697] (-1978.717) (-1975.654) (-1978.368) -- 0:01:45
499000 -- [-1972.121] (-1976.409) (-1976.840) (-1975.837) * (-1975.748) (-1978.490) [-1976.131] (-1973.489) -- 0:01:45
499500 -- (-1980.719) [-1973.578] (-1975.384) (-1979.609) * (-1974.182) [-1976.166] (-1976.665) (-1976.023) -- 0:01:45
500000 -- [-1974.185] (-1980.697) (-1977.783) (-1985.631) * [-1983.092] (-1976.678) (-1979.034) (-1976.069) -- 0:01:45
Average standard deviation of split frequencies: 0.000000
500500 -- (-1972.747) (-1976.554) [-1977.306] (-1982.018) * (-1981.850) [-1985.139] (-1974.200) (-1978.003) -- 0:01:45
501000 -- (-1975.790) (-1979.360) (-1977.949) [-1976.433] * [-1975.787] (-1979.294) (-1972.674) (-1974.907) -- 0:01:45
501500 -- (-1973.228) [-1977.389] (-1977.590) (-1975.235) * (-1978.943) [-1975.079] (-1974.559) (-1977.925) -- 0:01:45
502000 -- (-1976.551) (-1975.614) (-1976.565) [-1976.174] * (-1980.029) (-1980.728) [-1975.994] (-1974.814) -- 0:01:45
502500 -- (-1978.410) [-1976.247] (-1973.183) (-1973.786) * [-1975.216] (-1975.621) (-1975.247) (-1972.075) -- 0:01:44
503000 -- (-1974.304) [-1977.935] (-1976.337) (-1976.932) * (-1973.982) [-1972.101] (-1980.278) (-1979.120) -- 0:01:44
503500 -- (-1973.216) (-1977.817) (-1982.633) [-1975.446] * [-1977.673] (-1978.814) (-1984.030) (-1983.849) -- 0:01:44
504000 -- [-1970.423] (-1980.231) (-1978.649) (-1979.582) * (-1974.167) (-1974.514) [-1975.728] (-1977.984) -- 0:01:44
504500 -- (-1977.084) (-1977.599) (-1986.365) [-1981.619] * (-1982.188) (-1973.936) [-1973.964] (-1971.521) -- 0:01:44
505000 -- (-1983.571) [-1976.511] (-1977.258) (-1973.396) * (-1980.581) (-1975.019) [-1973.563] (-1976.850) -- 0:01:43
Average standard deviation of split frequencies: 0.000000
505500 -- (-1981.445) [-1971.083] (-1978.544) (-1976.064) * (-1975.534) (-1977.435) [-1976.301] (-1978.094) -- 0:01:44
506000 -- (-1975.568) [-1981.239] (-1975.812) (-1984.459) * (-1973.310) [-1974.649] (-1975.136) (-1973.914) -- 0:01:44
506500 -- (-1980.785) (-1975.722) (-1979.513) [-1979.099] * (-1976.146) (-1972.007) (-1979.048) [-1983.896] -- 0:01:44
507000 -- (-1975.867) (-1983.723) [-1972.173] (-1984.482) * (-1978.285) [-1975.032] (-1977.293) (-1984.892) -- 0:01:44
507500 -- (-1979.066) (-1981.663) (-1970.117) [-1975.734] * (-1974.387) (-1978.443) [-1977.716] (-1976.336) -- 0:01:43
508000 -- [-1982.769] (-1976.462) (-1982.230) (-1974.343) * (-1980.413) (-1978.268) [-1971.974] (-1980.503) -- 0:01:43
508500 -- [-1976.394] (-1978.611) (-1972.604) (-1975.945) * (-1978.634) [-1973.419] (-1974.784) (-1979.885) -- 0:01:43
509000 -- [-1971.583] (-1979.631) (-1974.436) (-1983.580) * [-1973.943] (-1978.442) (-1975.734) (-1979.271) -- 0:01:43
509500 -- (-1973.496) (-1977.003) (-1980.065) [-1976.424] * [-1972.818] (-1974.163) (-1971.200) (-1979.598) -- 0:01:43
510000 -- (-1975.072) (-1979.856) (-1969.767) [-1975.149] * (-1976.045) (-1974.866) [-1975.901] (-1974.565) -- 0:01:42
Average standard deviation of split frequencies: 0.000000
510500 -- [-1978.230] (-1981.649) (-1980.808) (-1972.952) * (-1970.984) [-1977.180] (-1977.279) (-1978.552) -- 0:01:43
511000 -- [-1977.324] (-1977.586) (-1976.066) (-1975.602) * (-1979.432) (-1975.010) [-1975.573] (-1979.881) -- 0:01:43
511500 -- (-1974.444) [-1979.308] (-1976.372) (-1972.786) * [-1971.643] (-1977.089) (-1977.592) (-1978.614) -- 0:01:43
512000 -- (-1974.074) [-1980.774] (-1972.768) (-1977.021) * (-1978.314) (-1975.109) (-1976.576) [-1983.415] -- 0:01:42
512500 -- [-1973.117] (-1985.151) (-1979.279) (-1974.847) * (-1971.862) [-1974.792] (-1978.361) (-1977.273) -- 0:01:42
513000 -- (-1975.556) (-1985.914) (-1977.265) [-1976.634] * (-1977.090) (-1973.981) (-1973.602) [-1974.865] -- 0:01:42
513500 -- [-1973.124] (-1980.844) (-1977.794) (-1978.255) * (-1978.211) (-1978.920) [-1979.162] (-1972.946) -- 0:01:42
514000 -- [-1978.441] (-1984.659) (-1980.576) (-1974.964) * (-1974.117) (-1978.274) [-1981.016] (-1971.714) -- 0:01:42
514500 -- (-1976.985) (-1973.293) (-1974.056) [-1979.187] * (-1975.606) (-1979.602) (-1978.980) [-1971.733] -- 0:01:41
515000 -- [-1974.568] (-1981.480) (-1968.888) (-1980.402) * (-1977.782) [-1983.517] (-1980.527) (-1975.271) -- 0:01:42
Average standard deviation of split frequencies: 0.000000
515500 -- (-1974.192) (-1976.693) [-1973.192] (-1977.622) * (-1977.505) (-1976.030) [-1974.764] (-1979.346) -- 0:01:42
516000 -- (-1973.171) [-1974.310] (-1979.999) (-1980.513) * (-1978.550) [-1976.220] (-1974.686) (-1973.927) -- 0:01:42
516500 -- (-1978.584) [-1974.653] (-1981.833) (-1975.553) * (-1981.831) (-1976.738) (-1982.646) [-1974.573] -- 0:01:42
517000 -- (-1975.870) [-1976.068] (-1978.492) (-1981.294) * [-1980.307] (-1975.153) (-1980.976) (-1990.234) -- 0:01:41
517500 -- (-1978.553) [-1972.937] (-1979.091) (-1984.518) * (-1978.585) (-1979.994) [-1974.244] (-1976.225) -- 0:01:41
518000 -- (-1978.324) [-1973.798] (-1974.701) (-1980.814) * (-1982.703) (-1977.100) (-1979.962) [-1977.227] -- 0:01:41
518500 -- [-1976.682] (-1978.098) (-1978.626) (-1978.170) * (-1977.379) (-1978.363) (-1974.616) [-1977.169] -- 0:01:41
519000 -- [-1971.313] (-1973.625) (-1975.972) (-1976.432) * (-1974.169) (-1977.853) (-1975.984) [-1976.111] -- 0:01:41
519500 -- (-1978.504) (-1976.423) (-1976.606) [-1980.932] * (-1977.640) (-1975.836) (-1972.796) [-1974.497] -- 0:01:40
520000 -- (-1970.213) [-1971.608] (-1984.141) (-1975.848) * (-1974.919) (-1977.949) (-1979.878) [-1977.077] -- 0:01:41
Average standard deviation of split frequencies: 0.000000
520500 -- (-1979.317) (-1973.666) [-1976.965] (-1976.079) * [-1977.119] (-1976.587) (-1980.108) (-1974.408) -- 0:01:41
521000 -- (-1976.051) (-1970.266) [-1975.867] (-1977.558) * [-1970.467] (-1978.110) (-1986.582) (-1978.978) -- 0:01:41
521500 -- [-1973.847] (-1973.304) (-1978.580) (-1971.973) * (-1973.591) (-1974.581) (-1978.741) [-1975.211] -- 0:01:40
522000 -- (-1980.935) [-1976.295] (-1969.772) (-1973.752) * (-1976.665) (-1981.907) (-1976.064) [-1972.541] -- 0:01:40
522500 -- (-1977.515) (-1978.622) [-1974.221] (-1973.301) * (-1975.485) (-1977.114) [-1973.946] (-1979.873) -- 0:01:40
523000 -- (-1974.743) (-1976.397) (-1975.340) [-1976.633] * (-1975.592) [-1980.188] (-1992.493) (-1979.675) -- 0:01:40
523500 -- (-1986.970) (-1975.332) [-1979.059] (-1980.306) * (-1977.617) [-1980.682] (-1973.211) (-1984.268) -- 0:01:40
524000 -- [-1973.303] (-1979.840) (-1977.974) (-1978.936) * (-1974.590) [-1975.210] (-1978.397) (-1973.769) -- 0:01:39
524500 -- [-1983.216] (-1981.182) (-1980.969) (-1977.185) * (-1973.009) (-1975.700) [-1975.808] (-1972.203) -- 0:01:40
525000 -- (-1976.451) [-1977.590] (-1977.762) (-1978.335) * (-1976.478) (-1977.447) [-1974.411] (-1979.089) -- 0:01:40
Average standard deviation of split frequencies: 0.000000
525500 -- (-1976.665) (-1977.225) [-1979.835] (-1979.587) * (-1978.751) [-1977.029] (-1975.824) (-1976.530) -- 0:01:40
526000 -- (-1979.653) [-1972.786] (-1982.061) (-1979.025) * (-1974.607) [-1975.577] (-1979.819) (-1978.250) -- 0:01:40
526500 -- (-1984.711) (-1973.068) [-1979.972] (-1979.538) * (-1979.012) (-1972.480) (-1982.310) [-1972.815] -- 0:01:39
527000 -- [-1980.308] (-1978.189) (-1977.359) (-1978.655) * [-1984.759] (-1974.178) (-1980.782) (-1979.269) -- 0:01:39
527500 -- (-1984.520) [-1977.146] (-1985.053) (-1981.744) * (-1979.863) [-1977.395] (-1979.404) (-1980.126) -- 0:01:39
528000 -- (-1978.859) (-1972.509) (-1972.704) [-1976.073] * (-1976.341) (-1976.955) [-1979.286] (-1975.300) -- 0:01:39
528500 -- (-1978.867) [-1973.993] (-1979.291) (-1976.035) * (-1972.579) (-1980.661) [-1976.573] (-1975.474) -- 0:01:39
529000 -- (-1981.514) (-1974.309) [-1974.648] (-1974.450) * (-1980.588) [-1979.090] (-1980.978) (-1982.994) -- 0:01:38
529500 -- [-1980.349] (-1976.144) (-1976.748) (-1979.455) * (-1975.073) [-1973.938] (-1976.826) (-1976.787) -- 0:01:39
530000 -- (-1979.861) (-1984.108) [-1976.659] (-1973.724) * (-1981.107) (-1975.059) [-1979.892] (-1974.876) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
530500 -- (-1982.219) (-1976.977) [-1972.024] (-1978.556) * [-1977.614] (-1976.638) (-1973.838) (-1981.849) -- 0:01:39
531000 -- (-1975.276) [-1973.463] (-1981.348) (-1972.933) * (-1976.294) (-1972.626) (-1980.268) [-1971.904] -- 0:01:38
531500 -- (-1987.520) (-1976.301) (-1976.764) [-1975.833] * [-1977.176] (-1970.493) (-1976.094) (-1977.747) -- 0:01:38
532000 -- (-1973.055) (-1977.441) [-1973.331] (-1975.027) * (-1974.376) (-1975.350) (-1976.076) [-1976.010] -- 0:01:38
532500 -- (-1970.817) [-1975.453] (-1982.040) (-1978.408) * (-1975.498) (-1972.259) (-1980.691) [-1977.409] -- 0:01:38
533000 -- [-1971.960] (-1974.609) (-1972.256) (-1982.609) * (-1976.613) (-1975.244) [-1980.820] (-1973.269) -- 0:01:38
533500 -- [-1975.459] (-1982.760) (-1973.177) (-1977.391) * (-1977.174) (-1972.921) (-1977.180) [-1972.303] -- 0:01:37
534000 -- (-1971.707) (-1983.582) (-1972.265) [-1974.440] * (-1979.755) (-1977.841) (-1975.202) [-1976.072] -- 0:01:37
534500 -- [-1974.949] (-1981.498) (-1975.683) (-1979.185) * (-1976.384) (-1973.562) (-1979.236) [-1979.555] -- 0:01:38
535000 -- [-1973.457] (-1976.483) (-1979.002) (-1978.967) * (-1971.297) [-1972.507] (-1983.426) (-1976.398) -- 0:01:38
Average standard deviation of split frequencies: 0.000000
535500 -- [-1975.253] (-1976.573) (-1978.648) (-1977.116) * (-1977.888) (-1980.967) (-1979.354) [-1976.373] -- 0:01:38
536000 -- (-1971.001) (-1975.248) (-1983.137) [-1979.770] * (-1978.879) (-1973.466) (-1985.359) [-1972.444] -- 0:01:37
536500 -- (-1981.992) (-1980.047) (-1976.199) [-1974.555] * (-1978.424) (-1979.264) [-1977.570] (-1974.902) -- 0:01:37
537000 -- [-1975.093] (-1975.438) (-1977.277) (-1975.904) * (-1972.565) [-1970.409] (-1975.317) (-1986.167) -- 0:01:37
537500 -- (-1980.061) (-1975.918) [-1978.214] (-1974.950) * (-1979.693) [-1970.597] (-1981.269) (-1987.048) -- 0:01:37
538000 -- [-1977.718] (-1974.118) (-1976.664) (-1976.621) * (-1981.972) (-1975.105) (-1978.365) [-1977.911] -- 0:01:37
538500 -- [-1975.756] (-1977.005) (-1973.036) (-1976.904) * (-1978.565) (-1975.341) [-1972.294] (-1974.985) -- 0:01:36
539000 -- (-1979.394) [-1975.473] (-1978.293) (-1979.176) * [-1974.310] (-1973.869) (-1982.719) (-1974.286) -- 0:01:37
539500 -- (-1973.938) [-1973.203] (-1974.343) (-1980.861) * (-1975.669) (-1978.442) (-1976.305) [-1978.565] -- 0:01:37
540000 -- (-1980.768) (-1977.821) [-1978.590] (-1973.760) * (-1978.900) (-1980.144) (-1972.889) [-1974.709] -- 0:01:37
Average standard deviation of split frequencies: 0.000000
540500 -- (-1975.479) (-1979.110) (-1974.379) [-1974.462] * [-1977.871] (-1981.653) (-1975.427) (-1980.152) -- 0:01:36
541000 -- (-1983.462) [-1976.367] (-1975.747) (-1976.783) * (-1975.716) (-1976.866) [-1977.593] (-1986.798) -- 0:01:36
541500 -- (-1976.989) (-1980.790) (-1973.411) [-1981.611] * (-1982.869) [-1975.702] (-1976.125) (-1977.605) -- 0:01:36
542000 -- (-1973.932) (-1977.337) (-1972.111) [-1977.883] * [-1975.147] (-1978.391) (-1975.203) (-1974.461) -- 0:01:36
542500 -- [-1973.158] (-1973.232) (-1975.407) (-1982.249) * (-1972.205) [-1973.353] (-1977.979) (-1979.295) -- 0:01:36
543000 -- (-1976.942) (-1980.663) [-1974.488] (-1972.335) * (-1979.998) (-1977.817) (-1978.032) [-1978.655] -- 0:01:35
543500 -- [-1969.700] (-1975.207) (-1978.114) (-1973.611) * [-1977.757] (-1977.565) (-1974.340) (-1972.755) -- 0:01:36
544000 -- [-1972.092] (-1974.769) (-1981.418) (-1977.397) * (-1979.094) (-1981.757) (-1974.548) [-1977.786] -- 0:01:36
544500 -- (-1971.498) [-1981.436] (-1984.487) (-1979.722) * [-1979.204] (-1977.373) (-1976.758) (-1985.104) -- 0:01:36
545000 -- [-1973.425] (-1988.593) (-1981.466) (-1975.305) * (-1981.258) [-1979.126] (-1987.610) (-1975.737) -- 0:01:36
Average standard deviation of split frequencies: 0.000000
545500 -- (-1979.360) (-1987.160) (-1977.477) [-1976.173] * [-1977.068] (-1978.378) (-1974.507) (-1987.205) -- 0:01:35
546000 -- [-1975.612] (-1983.511) (-1980.708) (-1975.313) * (-1977.671) (-1981.469) [-1978.735] (-1981.562) -- 0:01:35
546500 -- [-1974.370] (-1983.402) (-1979.148) (-1973.233) * [-1971.683] (-1977.799) (-1983.985) (-1979.377) -- 0:01:35
547000 -- (-1973.808) (-1974.982) (-1978.087) [-1975.001] * [-1978.034] (-1981.699) (-1977.296) (-1977.808) -- 0:01:35
547500 -- (-1972.782) (-1974.739) (-1980.013) [-1978.416] * [-1970.172] (-1983.612) (-1984.721) (-1979.926) -- 0:01:35
548000 -- (-1970.905) (-1976.813) [-1974.089] (-1975.637) * (-1973.227) [-1977.888] (-1978.962) (-1973.204) -- 0:01:34
548500 -- (-1977.486) (-1982.095) (-1982.906) [-1974.533] * [-1974.367] (-1975.731) (-1980.472) (-1975.187) -- 0:01:35
549000 -- (-1973.396) (-1974.208) [-1975.484] (-1981.571) * (-1978.775) (-1974.790) [-1974.628] (-1977.853) -- 0:01:35
549500 -- (-1981.496) (-1976.413) (-1981.203) [-1979.893] * (-1978.650) (-1984.297) (-1974.629) [-1975.973] -- 0:01:35
550000 -- (-1983.322) (-1978.103) [-1976.309] (-1981.059) * (-1980.290) (-1977.916) [-1975.332] (-1974.644) -- 0:01:34
Average standard deviation of split frequencies: 0.000000
550500 -- [-1977.991] (-1984.621) (-1972.084) (-1973.449) * (-1978.085) (-1977.144) [-1981.045] (-1976.599) -- 0:01:34
551000 -- (-1977.897) [-1977.165] (-1975.799) (-1973.077) * [-1975.142] (-1977.225) (-1976.008) (-1973.622) -- 0:01:34
551500 -- (-1982.319) (-1975.413) [-1971.548] (-1980.005) * (-1979.216) (-1975.395) (-1982.891) [-1970.572] -- 0:01:34
552000 -- [-1976.721] (-1977.343) (-1976.661) (-1972.658) * (-1975.781) (-1974.853) [-1976.971] (-1972.396) -- 0:01:34
552500 -- (-1976.289) (-1976.209) (-1974.123) [-1975.103] * (-1969.657) (-1973.218) [-1978.617] (-1973.194) -- 0:01:33
553000 -- (-1978.140) (-1973.209) (-1977.629) [-1978.090] * (-1980.922) [-1977.016] (-1972.883) (-1973.830) -- 0:01:33
553500 -- [-1977.386] (-1970.730) (-1987.920) (-1973.417) * (-1976.435) (-1975.820) [-1976.522] (-1971.873) -- 0:01:34
554000 -- [-1977.303] (-1981.222) (-1975.577) (-1978.204) * [-1973.071] (-1974.570) (-1978.753) (-1982.675) -- 0:01:34
554500 -- (-1973.854) (-1975.555) [-1972.280] (-1980.151) * (-1975.299) (-1972.986) [-1973.523] (-1980.259) -- 0:01:34
555000 -- (-1972.061) (-1973.760) (-1980.364) [-1979.816] * (-1980.022) [-1974.592] (-1977.890) (-1978.363) -- 0:01:33
Average standard deviation of split frequencies: 0.000000
555500 -- [-1973.348] (-1977.934) (-1979.386) (-1969.606) * (-1989.854) (-1983.605) [-1973.506] (-1978.273) -- 0:01:33
556000 -- [-1980.560] (-1973.525) (-1988.161) (-1975.048) * (-1976.102) [-1976.287] (-1985.622) (-1974.088) -- 0:01:33
556500 -- (-1979.894) [-1974.481] (-1977.308) (-1975.004) * [-1973.649] (-1977.469) (-1980.521) (-1979.412) -- 0:01:33
557000 -- (-1981.418) [-1979.791] (-1975.708) (-1979.972) * (-1975.722) (-1973.686) (-1977.866) [-1979.685] -- 0:01:33
557500 -- (-1973.298) (-1970.479) (-1973.505) [-1974.751] * (-1982.087) [-1974.279] (-1982.933) (-1986.760) -- 0:01:32
558000 -- [-1975.456] (-1982.487) (-1978.921) (-1983.905) * (-1979.263) [-1978.126] (-1979.320) (-1981.206) -- 0:01:33
558500 -- (-1978.252) (-1984.576) [-1974.333] (-1976.338) * (-1980.335) (-1977.741) [-1975.786] (-1986.145) -- 0:01:33
559000 -- (-1978.078) [-1974.851] (-1979.783) (-1975.030) * [-1972.814] (-1975.431) (-1974.811) (-1976.406) -- 0:01:33
559500 -- (-1975.806) (-1975.175) [-1978.958] (-1976.741) * (-1975.415) (-1976.377) [-1973.707] (-1982.522) -- 0:01:32
560000 -- [-1976.156] (-1980.957) (-1975.837) (-1979.223) * (-1974.103) (-1977.161) [-1975.817] (-1976.233) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
560500 -- (-1975.298) [-1972.918] (-1979.166) (-1980.978) * (-1976.817) (-1979.844) (-1977.112) [-1974.017] -- 0:01:32
561000 -- (-1986.329) [-1971.826] (-1971.781) (-1973.669) * (-1979.032) (-1981.796) (-1974.400) [-1973.911] -- 0:01:32
561500 -- (-1977.645) (-1972.875) (-1980.266) [-1973.279] * [-1975.596] (-1976.846) (-1979.209) (-1974.369) -- 0:01:32
562000 -- [-1976.542] (-1974.420) (-1977.282) (-1979.489) * (-1974.836) [-1980.171] (-1983.366) (-1984.554) -- 0:01:31
562500 -- [-1981.428] (-1978.311) (-1980.853) (-1979.719) * (-1981.520) [-1975.612] (-1976.972) (-1987.532) -- 0:01:31
563000 -- (-1975.094) (-1970.620) (-1982.775) [-1980.827] * [-1973.621] (-1979.615) (-1980.287) (-1980.221) -- 0:01:32
563500 -- [-1978.137] (-1975.931) (-1977.578) (-1977.178) * [-1976.145] (-1976.574) (-1976.858) (-1976.926) -- 0:01:32
564000 -- (-1977.318) (-1976.364) (-1978.772) [-1975.944] * [-1975.930] (-1979.075) (-1976.443) (-1975.840) -- 0:01:31
564500 -- (-1979.406) (-1970.179) (-1978.234) [-1983.667] * (-1982.745) (-1969.401) [-1971.806] (-1972.648) -- 0:01:31
565000 -- (-1975.410) (-1983.984) (-1976.454) [-1986.978] * (-1976.549) (-1979.566) [-1972.438] (-1975.802) -- 0:01:31
Average standard deviation of split frequencies: 0.000000
565500 -- (-1976.432) [-1973.480] (-1974.289) (-1978.824) * (-1976.469) (-1988.714) (-1978.406) [-1975.947] -- 0:01:31
566000 -- (-1978.755) (-1976.075) [-1975.258] (-1974.658) * (-1974.786) (-1983.157) (-1973.760) [-1975.727] -- 0:01:31
566500 -- (-1983.143) (-1972.019) [-1974.942] (-1973.979) * (-1976.987) [-1978.300] (-1985.643) (-1977.178) -- 0:01:31
567000 -- (-1977.570) [-1973.489] (-1980.831) (-1983.998) * (-1975.380) [-1976.163] (-1976.975) (-1977.014) -- 0:01:30
567500 -- (-1978.758) (-1977.607) [-1978.000] (-1983.002) * (-1978.341) (-1976.104) [-1971.526] (-1975.464) -- 0:01:31
568000 -- (-1976.102) (-1971.521) [-1974.385] (-1988.462) * (-1979.680) [-1977.006] (-1978.920) (-1975.815) -- 0:01:31
568500 -- (-1976.605) (-1972.383) (-1978.915) [-1972.321] * (-1980.415) (-1994.534) (-1976.577) [-1974.178] -- 0:01:31
569000 -- [-1973.139] (-1977.374) (-1980.125) (-1974.015) * [-1977.171] (-1979.788) (-1972.653) (-1973.537) -- 0:01:30
569500 -- (-1974.711) [-1971.309] (-1983.584) (-1979.752) * (-1980.050) (-1972.466) [-1979.611] (-1974.797) -- 0:01:30
570000 -- (-1975.846) (-1978.109) (-1973.977) [-1977.552] * (-1977.054) [-1972.607] (-1974.293) (-1973.756) -- 0:01:30
Average standard deviation of split frequencies: 0.000000
570500 -- [-1978.531] (-1977.244) (-1976.012) (-1974.420) * (-1984.329) (-1971.217) [-1981.728] (-1974.936) -- 0:01:30
571000 -- (-1975.463) [-1973.053] (-1975.681) (-1972.733) * (-1979.221) (-1975.150) [-1973.381] (-1978.780) -- 0:01:30
571500 -- (-1980.652) (-1975.603) (-1978.257) [-1974.449] * (-1976.580) (-1974.154) [-1978.183] (-1975.276) -- 0:01:29
572000 -- [-1976.593] (-1986.786) (-1980.327) (-1976.819) * (-1975.050) [-1977.864] (-1974.510) (-1972.615) -- 0:01:29
572500 -- (-1974.758) [-1975.505] (-1986.071) (-1979.258) * [-1978.916] (-1980.668) (-1976.626) (-1973.850) -- 0:01:30
573000 -- (-1975.085) [-1971.956] (-1976.786) (-1977.442) * (-1977.030) (-1981.867) (-1976.099) [-1975.622] -- 0:01:30
573500 -- [-1973.803] (-1977.815) (-1977.940) (-1982.823) * (-1979.368) (-1988.723) (-1978.498) [-1976.234] -- 0:01:29
574000 -- (-1976.798) (-1974.960) [-1977.483] (-1985.396) * [-1975.624] (-1975.799) (-1971.228) (-1976.289) -- 0:01:29
574500 -- (-1983.262) (-1977.223) (-1973.870) [-1977.620] * (-1972.970) (-1974.804) [-1971.412] (-1973.929) -- 0:01:29
575000 -- (-1979.312) (-1980.776) (-1976.517) [-1972.878] * (-1975.562) (-1981.092) (-1975.638) [-1974.621] -- 0:01:29
Average standard deviation of split frequencies: 0.000000
575500 -- (-1980.047) (-1977.918) [-1976.343] (-1976.326) * (-1977.259) (-1974.067) (-1975.254) [-1973.712] -- 0:01:29
576000 -- [-1983.865] (-1979.661) (-1976.468) (-1976.939) * (-1976.886) (-1980.159) [-1975.426] (-1973.013) -- 0:01:29
576500 -- (-1976.681) (-1981.247) (-1972.262) [-1981.219] * [-1974.210] (-1980.791) (-1972.253) (-1977.098) -- 0:01:28
577000 -- (-1977.969) (-1978.019) [-1979.460] (-1980.411) * (-1983.140) [-1978.563] (-1976.940) (-1976.698) -- 0:01:29
577500 -- [-1981.613] (-1978.195) (-1977.986) (-1980.392) * (-1974.644) [-1978.500] (-1976.099) (-1977.915) -- 0:01:29
578000 -- [-1986.159] (-1977.729) (-1978.343) (-1978.203) * (-1983.396) (-1978.095) [-1978.747] (-1976.471) -- 0:01:29
578500 -- (-1988.038) (-1981.618) (-1979.705) [-1982.391] * (-1978.771) (-1978.051) [-1976.348] (-1975.382) -- 0:01:28
579000 -- (-1974.709) [-1978.850] (-1981.494) (-1978.588) * (-1973.171) (-1972.980) [-1975.041] (-1983.501) -- 0:01:28
579500 -- (-1981.575) [-1977.436] (-1975.930) (-1975.406) * (-1975.561) (-1972.691) (-1973.359) [-1974.603] -- 0:01:28
580000 -- (-1984.185) (-1975.842) (-1982.485) [-1973.833] * (-1979.818) (-1977.196) (-1973.141) [-1981.562] -- 0:01:28
Average standard deviation of split frequencies: 0.000000
580500 -- [-1978.155] (-1978.462) (-1973.326) (-1973.466) * (-1978.418) (-1975.661) [-1980.991] (-1974.524) -- 0:01:28
581000 -- (-1977.920) [-1972.736] (-1978.691) (-1975.103) * (-1983.629) (-1977.531) [-1976.267] (-1977.889) -- 0:01:27
581500 -- (-1978.977) (-1974.247) (-1974.425) [-1972.574] * (-1977.123) (-1981.166) (-1976.290) [-1974.027] -- 0:01:27
582000 -- (-1974.082) (-1987.244) [-1976.621] (-1978.470) * (-1984.300) (-1973.089) [-1974.117] (-1975.811) -- 0:01:28
582500 -- [-1971.470] (-1976.534) (-1979.506) (-1973.418) * (-1980.221) (-1974.944) [-1974.421] (-1976.128) -- 0:01:28
583000 -- (-1977.035) (-1981.174) [-1973.361] (-1971.419) * (-1974.832) (-1972.098) [-1977.032] (-1981.321) -- 0:01:27
583500 -- (-1975.124) [-1975.342] (-1976.941) (-1981.191) * (-1975.013) (-1980.369) (-1978.458) [-1976.259] -- 0:01:27
584000 -- (-1977.985) (-1983.153) [-1975.051] (-1976.785) * (-1977.800) [-1980.475] (-1975.475) (-1976.814) -- 0:01:27
584500 -- (-1978.098) [-1982.561] (-1981.280) (-1977.405) * (-1979.509) [-1974.024] (-1982.081) (-1977.966) -- 0:01:27
585000 -- [-1978.220] (-1982.715) (-1976.197) (-1981.087) * (-1975.187) (-1973.309) [-1975.058] (-1977.098) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
585500 -- (-1975.784) (-1981.726) [-1972.506] (-1981.203) * (-1975.174) [-1975.195] (-1978.960) (-1974.210) -- 0:01:27
586000 -- [-1977.724] (-1981.264) (-1973.288) (-1975.892) * (-1978.210) (-1972.916) [-1975.085] (-1978.584) -- 0:01:26
586500 -- (-1975.288) [-1971.689] (-1979.721) (-1977.851) * (-1976.894) (-1974.354) [-1977.185] (-1981.736) -- 0:01:26
587000 -- (-1979.687) (-1972.653) [-1974.793] (-1973.331) * (-1978.635) [-1972.537] (-1978.106) (-1984.461) -- 0:01:27
587500 -- (-1971.369) (-1981.275) [-1976.353] (-1980.725) * (-1977.289) [-1976.486] (-1982.940) (-1983.009) -- 0:01:27
588000 -- [-1975.554] (-1976.213) (-1978.373) (-1977.751) * (-1985.938) [-1972.590] (-1981.399) (-1987.429) -- 0:01:26
588500 -- (-1983.007) [-1977.943] (-1977.953) (-1981.029) * (-1977.581) (-1980.019) (-1982.678) [-1982.948] -- 0:01:26
589000 -- (-1981.310) [-1974.560] (-1971.458) (-1979.363) * (-1978.948) [-1979.184] (-1971.916) (-1993.127) -- 0:01:26
589500 -- (-1973.155) (-1979.323) [-1977.358] (-1985.055) * [-1972.533] (-1987.390) (-1983.676) (-1982.528) -- 0:01:26
590000 -- (-1978.752) (-1978.123) [-1978.146] (-1978.138) * (-1973.527) [-1974.850] (-1980.021) (-1982.892) -- 0:01:26
Average standard deviation of split frequencies: 0.000000
590500 -- (-1977.179) (-1976.238) [-1976.527] (-1983.516) * (-1972.628) (-1973.643) (-1978.998) [-1979.973] -- 0:01:25
591000 -- (-1975.872) [-1974.233] (-1973.759) (-1974.829) * (-1977.414) (-1976.496) [-1975.792] (-1977.297) -- 0:01:25
591500 -- (-1982.150) (-1974.009) (-1972.590) [-1972.390] * [-1981.787] (-1982.255) (-1979.220) (-1978.328) -- 0:01:26
592000 -- (-1976.610) (-1979.933) [-1975.709] (-1977.244) * (-1975.813) (-1975.559) (-1975.561) [-1974.407] -- 0:01:26
592500 -- (-1980.564) (-1987.047) [-1973.335] (-1973.535) * [-1970.904] (-1975.558) (-1979.827) (-1973.915) -- 0:01:25
593000 -- (-1976.681) (-1974.418) [-1978.556] (-1979.324) * (-1980.790) [-1973.406] (-1982.635) (-1975.909) -- 0:01:25
593500 -- (-1983.109) (-1977.411) (-1978.014) [-1972.663] * (-1978.495) [-1974.041] (-1975.799) (-1971.902) -- 0:01:25
594000 -- [-1978.310] (-1975.218) (-1976.016) (-1981.500) * (-1975.903) (-1976.135) (-1980.227) [-1979.646] -- 0:01:25
594500 -- (-1974.020) (-1972.998) [-1978.382] (-1986.798) * (-1980.137) (-1977.672) (-1990.458) [-1981.188] -- 0:01:25
595000 -- [-1973.058] (-1978.065) (-1983.205) (-1978.360) * (-1977.043) (-1979.717) (-1976.204) [-1977.542] -- 0:01:25
Average standard deviation of split frequencies: 0.000000
595500 -- (-1976.364) (-1975.735) [-1976.499] (-1979.223) * (-1973.099) [-1978.710] (-1981.856) (-1974.777) -- 0:01:24
596000 -- (-1978.157) (-1976.634) (-1978.782) [-1973.065] * (-1977.957) (-1978.600) [-1976.877] (-1979.151) -- 0:01:24
596500 -- [-1976.993] (-1983.225) (-1979.050) (-1971.889) * (-1982.484) (-1973.491) [-1975.338] (-1980.452) -- 0:01:25
597000 -- (-1974.191) [-1974.917] (-1982.720) (-1971.867) * (-1979.963) (-1979.079) (-1973.417) [-1972.317] -- 0:01:25
597500 -- (-1977.326) (-1974.046) (-1979.701) [-1970.006] * (-1976.720) (-1975.735) (-1976.333) [-1973.321] -- 0:01:24
598000 -- (-1980.582) [-1978.143] (-1980.297) (-1977.671) * (-1976.299) (-1975.316) (-1977.852) [-1975.738] -- 0:01:24
598500 -- (-1979.685) (-1972.223) (-1983.764) [-1979.204] * (-1975.855) (-1973.861) [-1974.849] (-1984.674) -- 0:01:24
599000 -- (-1982.240) [-1972.199] (-1971.835) (-1977.933) * (-1976.630) [-1975.433] (-1981.079) (-1978.224) -- 0:01:24
599500 -- [-1985.864] (-1976.647) (-1974.444) (-1974.857) * (-1973.974) [-1978.426] (-1976.335) (-1978.027) -- 0:01:24
600000 -- (-1981.418) (-1971.792) [-1975.726] (-1978.361) * (-1972.669) [-1979.431] (-1975.980) (-1982.846) -- 0:01:24
Average standard deviation of split frequencies: 0.000000
600500 -- (-1977.518) (-1977.251) (-1977.285) [-1981.395] * [-1974.310] (-1982.961) (-1978.820) (-1981.494) -- 0:01:23
601000 -- (-1978.410) (-1976.111) [-1978.452] (-1984.478) * (-1976.243) (-1974.290) [-1977.267] (-1977.923) -- 0:01:24
601500 -- (-1974.371) (-1978.730) [-1973.451] (-1977.234) * [-1975.556] (-1974.987) (-1974.910) (-1981.063) -- 0:01:24
602000 -- (-1986.716) [-1975.254] (-1977.236) (-1972.353) * (-1973.447) (-1978.861) [-1974.852] (-1980.380) -- 0:01:23
602500 -- (-1978.842) [-1973.847] (-1976.245) (-1972.453) * (-1983.640) [-1975.652] (-1978.817) (-1975.435) -- 0:01:23
603000 -- (-1984.253) (-1982.216) (-1984.226) [-1971.358] * (-1976.116) (-1975.878) (-1977.379) [-1978.392] -- 0:01:23
603500 -- (-1990.903) [-1974.088] (-1971.083) (-1977.504) * (-1977.272) (-1975.149) [-1973.647] (-1976.592) -- 0:01:23
604000 -- [-1976.368] (-1979.043) (-1976.509) (-1972.248) * [-1979.953] (-1972.525) (-1979.732) (-1980.207) -- 0:01:23
604500 -- (-1980.441) [-1981.330] (-1980.937) (-1973.458) * (-1977.090) [-1971.465] (-1980.957) (-1978.399) -- 0:01:23
605000 -- (-1983.561) [-1977.973] (-1973.829) (-1980.400) * [-1978.019] (-1974.038) (-1981.830) (-1979.942) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
605500 -- (-1982.714) [-1975.385] (-1976.456) (-1980.519) * (-1973.936) (-1980.599) (-1975.596) [-1976.051] -- 0:01:22
606000 -- (-1981.933) [-1981.549] (-1976.640) (-1978.281) * (-1974.913) [-1974.395] (-1976.909) (-1974.448) -- 0:01:23
606500 -- (-1979.078) (-1978.950) (-1975.368) [-1974.913] * (-1978.092) (-1979.514) [-1978.642] (-1978.383) -- 0:01:23
607000 -- (-1973.121) [-1974.626] (-1985.072) (-1976.719) * (-1978.893) [-1975.721] (-1978.885) (-1974.883) -- 0:01:22
607500 -- (-1974.791) (-1977.486) [-1986.979] (-1976.354) * (-1978.093) (-1978.941) (-1970.838) [-1976.186] -- 0:01:22
608000 -- [-1974.044] (-1977.842) (-1972.070) (-1979.511) * (-1975.044) [-1978.934] (-1977.709) (-1974.182) -- 0:01:22
608500 -- [-1977.459] (-1982.071) (-1976.997) (-1975.757) * (-1972.231) [-1980.341] (-1977.771) (-1972.544) -- 0:01:22
609000 -- (-1976.217) (-1977.216) (-1978.608) [-1975.476] * (-1973.871) (-1977.905) [-1975.269] (-1974.559) -- 0:01:22
609500 -- (-1973.784) [-1977.160] (-1985.540) (-1980.856) * (-1974.698) [-1973.547] (-1979.372) (-1971.434) -- 0:01:22
610000 -- (-1979.091) (-1979.266) (-1985.853) [-1973.201] * [-1975.684] (-1974.086) (-1980.527) (-1977.373) -- 0:01:21
Average standard deviation of split frequencies: 0.000000
610500 -- (-1975.904) [-1975.466] (-1982.350) (-1971.785) * (-1975.333) (-1980.138) [-1978.470] (-1978.057) -- 0:01:22
611000 -- (-1975.401) [-1976.576] (-1979.956) (-1976.331) * (-1974.822) (-1977.566) (-1973.259) [-1981.662] -- 0:01:22
611500 -- [-1973.823] (-1978.404) (-1979.696) (-1981.479) * (-1978.279) (-1977.676) (-1973.379) [-1974.326] -- 0:01:21
612000 -- [-1973.494] (-1976.678) (-1978.818) (-1974.528) * [-1975.868] (-1974.851) (-1977.536) (-1980.834) -- 0:01:21
612500 -- (-1974.154) (-1976.447) (-1972.124) [-1978.695] * (-1982.089) [-1973.616] (-1982.257) (-1978.858) -- 0:01:21
613000 -- [-1972.130] (-1973.581) (-1983.585) (-1977.630) * (-1983.904) [-1973.131] (-1978.519) (-1979.058) -- 0:01:21
613500 -- (-1976.591) [-1975.880] (-1975.706) (-1980.592) * (-1982.022) (-1973.759) [-1973.949] (-1976.485) -- 0:01:21
614000 -- (-1974.883) [-1976.931] (-1975.848) (-1971.246) * (-1982.434) (-1978.033) (-1972.633) [-1979.373] -- 0:01:21
614500 -- [-1977.311] (-1973.545) (-1977.581) (-1978.564) * [-1979.131] (-1974.480) (-1974.694) (-1975.558) -- 0:01:20
615000 -- (-1975.608) (-1975.518) (-1979.385) [-1983.181] * [-1973.625] (-1981.187) (-1977.010) (-1975.367) -- 0:01:20
Average standard deviation of split frequencies: 0.000000
615500 -- [-1975.465] (-1979.669) (-1976.504) (-1978.064) * [-1976.710] (-1985.404) (-1977.762) (-1979.998) -- 0:01:21
616000 -- (-1974.315) (-1979.644) (-1980.974) [-1979.740] * (-1973.898) [-1976.899] (-1976.221) (-1979.147) -- 0:01:21
616500 -- (-1982.643) [-1979.254] (-1978.246) (-1979.375) * [-1971.273] (-1975.037) (-1977.977) (-1975.735) -- 0:01:20
617000 -- (-1975.931) [-1977.712] (-1977.253) (-1973.884) * (-1973.338) (-1977.730) [-1973.170] (-1970.743) -- 0:01:20
617500 -- [-1981.949] (-1973.625) (-1974.941) (-1976.864) * (-1977.435) (-1972.495) [-1982.121] (-1978.505) -- 0:01:20
618000 -- (-1978.584) (-1975.152) (-1976.562) [-1979.371] * [-1975.500] (-1974.926) (-1979.337) (-1979.848) -- 0:01:20
618500 -- (-1975.474) (-1978.982) (-1978.983) [-1976.673] * [-1973.385] (-1976.565) (-1978.629) (-1976.717) -- 0:01:20
619000 -- [-1972.097] (-1977.126) (-1979.777) (-1980.904) * (-1976.007) (-1975.687) (-1971.298) [-1983.068] -- 0:01:20
619500 -- (-1979.792) (-1981.031) (-1973.048) [-1974.699] * [-1982.675] (-1974.380) (-1976.626) (-1978.259) -- 0:01:19
620000 -- (-1981.260) (-1979.141) [-1974.462] (-1979.024) * (-1978.009) [-1978.435] (-1982.760) (-1980.277) -- 0:01:20
Average standard deviation of split frequencies: 0.000000
620500 -- (-1985.020) [-1974.341] (-1980.155) (-1978.134) * (-1975.817) (-1976.262) (-1981.078) [-1973.194] -- 0:01:20
621000 -- (-1984.490) [-1978.573] (-1977.148) (-1976.216) * (-1976.640) (-1971.865) (-1981.166) [-1980.312] -- 0:01:19
621500 -- (-1978.569) (-1977.362) (-1979.429) [-1976.688] * (-1981.706) [-1975.011] (-1980.594) (-1976.035) -- 0:01:19
622000 -- (-1977.736) (-1980.084) (-1977.435) [-1977.740] * (-1975.759) (-1977.720) [-1982.904] (-1978.599) -- 0:01:19
622500 -- [-1973.109] (-1982.173) (-1986.664) (-1976.532) * (-1978.573) [-1972.918] (-1976.489) (-1978.714) -- 0:01:19
623000 -- (-1977.318) (-1978.657) (-1980.886) [-1976.387] * (-1981.260) (-1973.592) (-1977.847) [-1976.614] -- 0:01:19
623500 -- (-1978.172) [-1982.469] (-1978.311) (-1977.594) * (-1979.511) (-1981.877) [-1978.008] (-1975.286) -- 0:01:19
624000 -- (-1976.976) (-1983.151) [-1972.840] (-1990.993) * [-1976.421] (-1977.530) (-1976.463) (-1976.422) -- 0:01:18
624500 -- (-1977.823) [-1971.510] (-1979.923) (-1972.813) * [-1973.219] (-1977.076) (-1979.064) (-1993.178) -- 0:01:18
625000 -- (-1982.079) [-1978.526] (-1983.394) (-1978.348) * (-1978.202) [-1977.471] (-1975.361) (-1974.852) -- 0:01:19
Average standard deviation of split frequencies: 0.000000
625500 -- (-1976.768) (-1977.836) [-1973.875] (-1983.190) * (-1979.288) [-1974.548] (-1975.164) (-1978.235) -- 0:01:19
626000 -- (-1975.623) (-1975.823) (-1977.985) [-1980.544] * [-1972.816] (-1979.627) (-1973.590) (-1985.556) -- 0:01:18
626500 -- (-1974.764) (-1976.384) (-1978.815) [-1971.784] * [-1973.792] (-1977.301) (-1975.483) (-1979.396) -- 0:01:18
627000 -- (-1976.574) (-1974.223) (-1980.991) [-1972.982] * (-1975.213) [-1981.270] (-1974.684) (-1979.505) -- 0:01:18
627500 -- (-1976.907) [-1976.150] (-1977.787) (-1986.824) * (-1984.917) (-1976.053) (-1975.177) [-1978.123] -- 0:01:18
628000 -- (-1977.454) (-1974.123) (-1976.674) [-1978.358] * (-1980.705) (-1976.522) [-1976.723] (-1976.234) -- 0:01:18
628500 -- [-1976.891] (-1975.339) (-1976.446) (-1974.796) * (-1980.107) (-1978.242) [-1972.119] (-1974.587) -- 0:01:18
629000 -- [-1978.898] (-1971.949) (-1978.660) (-1973.463) * (-1981.309) (-1979.206) [-1976.225] (-1973.565) -- 0:01:17
629500 -- (-1984.215) (-1978.434) (-1984.279) [-1982.798] * (-1977.816) [-1976.341] (-1979.809) (-1980.891) -- 0:01:17
630000 -- (-1976.751) (-1970.528) [-1978.672] (-1982.005) * (-1979.717) (-1975.824) [-1979.832] (-1981.799) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
630500 -- (-1975.267) [-1972.084] (-1978.921) (-1974.657) * (-1979.922) (-1972.071) [-1981.867] (-1973.880) -- 0:01:17
631000 -- (-1972.005) (-1977.141) [-1976.341] (-1974.977) * (-1972.564) (-1976.049) [-1976.737] (-1980.943) -- 0:01:17
631500 -- [-1980.338] (-1976.835) (-1985.301) (-1975.090) * (-1979.016) (-1978.480) (-1974.255) [-1975.394] -- 0:01:17
632000 -- (-1979.911) (-1977.536) (-1975.776) [-1976.623] * (-1975.759) (-1984.154) [-1983.224] (-1980.418) -- 0:01:17
632500 -- (-1978.374) [-1978.860] (-1973.756) (-1979.396) * (-1977.534) (-1983.412) [-1977.703] (-1977.995) -- 0:01:17
633000 -- [-1977.328] (-1977.087) (-1975.834) (-1984.162) * (-1973.238) (-1979.073) (-1979.307) [-1977.356] -- 0:01:17
633500 -- [-1975.102] (-1976.539) (-1976.318) (-1976.389) * [-1977.094] (-1972.794) (-1977.109) (-1975.279) -- 0:01:16
634000 -- (-1974.616) (-1980.300) [-1974.667] (-1982.128) * (-1977.800) (-1981.798) (-1979.191) [-1973.938] -- 0:01:16
634500 -- (-1976.704) (-1979.550) (-1975.184) [-1976.576] * (-1975.564) (-1976.291) (-1977.914) [-1972.109] -- 0:01:17
635000 -- (-1973.086) (-1976.370) [-1973.763] (-1974.529) * [-1976.198] (-1983.359) (-1975.699) (-1972.491) -- 0:01:17
Average standard deviation of split frequencies: 0.000000
635500 -- (-1980.920) [-1976.862] (-1976.414) (-1974.471) * (-1979.515) [-1976.728] (-1979.891) (-1972.323) -- 0:01:16
636000 -- (-1976.043) [-1975.707] (-1978.515) (-1979.254) * [-1975.609] (-1978.002) (-1980.373) (-1977.785) -- 0:01:16
636500 -- (-1975.102) [-1975.403] (-1977.644) (-1974.567) * (-1976.933) (-1976.179) [-1976.446] (-1982.008) -- 0:01:16
637000 -- (-1981.779) (-1970.365) (-1980.469) [-1974.153] * (-1983.078) (-1977.275) (-1976.160) [-1972.311] -- 0:01:16
637500 -- (-1979.131) [-1977.839] (-1981.590) (-1977.322) * (-1973.890) (-1975.884) [-1972.732] (-1978.893) -- 0:01:16
638000 -- (-1972.655) (-1975.634) [-1981.116] (-1977.140) * [-1975.362] (-1977.334) (-1976.540) (-1976.111) -- 0:01:16
638500 -- (-1974.863) [-1972.974] (-1980.848) (-1978.325) * [-1971.110] (-1976.775) (-1975.553) (-1977.269) -- 0:01:15
639000 -- [-1974.366] (-1978.546) (-1976.054) (-1975.054) * [-1978.407] (-1977.507) (-1972.748) (-1986.288) -- 0:01:15
639500 -- (-1978.592) (-1972.811) [-1977.564] (-1971.979) * (-1983.644) (-1977.027) [-1977.276] (-1985.007) -- 0:01:16
640000 -- (-1976.316) (-1982.755) [-1976.209] (-1972.609) * (-1971.824) [-1977.125] (-1979.349) (-1982.061) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
640500 -- [-1973.050] (-1982.654) (-1973.555) (-1978.381) * [-1976.808] (-1977.376) (-1973.755) (-1978.778) -- 0:01:15
641000 -- (-1981.267) (-1980.014) [-1979.130] (-1982.485) * (-1981.472) [-1973.547] (-1975.358) (-1978.133) -- 0:01:15
641500 -- (-1979.829) (-1978.313) [-1975.821] (-1980.549) * (-1984.841) (-1977.748) (-1973.936) [-1978.561] -- 0:01:15
642000 -- [-1972.223] (-1984.389) (-1974.332) (-1974.319) * (-1983.890) (-1982.560) [-1970.795] (-1985.881) -- 0:01:15
642500 -- (-1978.107) [-1973.017] (-1983.778) (-1978.905) * (-1988.169) (-1976.767) [-1974.681] (-1975.288) -- 0:01:15
643000 -- (-1981.413) (-1974.729) (-1978.918) [-1977.883] * (-1973.346) (-1973.975) [-1977.134] (-1977.677) -- 0:01:14
643500 -- (-1978.920) [-1973.644] (-1976.724) (-1974.336) * (-1975.231) (-1979.864) [-1974.042] (-1978.675) -- 0:01:14
644000 -- (-1980.764) [-1973.863] (-1975.396) (-1975.977) * (-1979.774) (-1974.556) (-1978.495) [-1978.628] -- 0:01:15
644500 -- (-1983.794) (-1970.990) [-1979.899] (-1981.426) * [-1980.075] (-1979.802) (-1974.005) (-1972.832) -- 0:01:15
645000 -- [-1978.366] (-1973.904) (-1978.817) (-1980.779) * [-1975.403] (-1978.273) (-1970.980) (-1976.502) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
645500 -- [-1972.320] (-1976.650) (-1976.937) (-1982.942) * (-1974.205) (-1978.304) (-1974.600) [-1977.589] -- 0:01:14
646000 -- [-1977.427] (-1971.729) (-1982.336) (-1982.597) * (-1976.495) (-1974.837) [-1981.788] (-1982.505) -- 0:01:14
646500 -- [-1975.822] (-1971.613) (-1973.598) (-1978.381) * (-1971.253) (-1970.946) [-1980.658] (-1976.785) -- 0:01:14
647000 -- (-1978.225) [-1975.876] (-1981.788) (-1979.179) * (-1976.469) (-1977.459) [-1977.655] (-1976.249) -- 0:01:14
647500 -- [-1970.657] (-1977.907) (-1969.736) (-1983.412) * (-1979.428) (-1976.632) [-1975.427] (-1977.207) -- 0:01:14
648000 -- (-1977.979) [-1979.634] (-1971.216) (-1974.161) * (-1973.111) (-1977.893) (-1979.155) [-1974.119] -- 0:01:13
648500 -- (-1979.396) [-1971.914] (-1973.106) (-1981.270) * [-1974.477] (-1977.869) (-1977.371) (-1972.760) -- 0:01:13
649000 -- (-1982.178) (-1983.976) (-1975.458) [-1979.379] * [-1975.156] (-1974.532) (-1975.215) (-1977.228) -- 0:01:14
649500 -- [-1974.350] (-1979.064) (-1979.388) (-1984.492) * (-1977.929) [-1976.209] (-1981.650) (-1975.164) -- 0:01:13
650000 -- (-1981.641) (-1980.689) [-1973.433] (-1980.875) * (-1973.329) [-1979.692] (-1976.244) (-1979.432) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
650500 -- (-1975.970) [-1977.492] (-1978.712) (-1984.756) * (-1975.030) (-1977.664) [-1976.346] (-1978.298) -- 0:01:13
651000 -- (-1983.232) (-1975.444) (-1976.710) [-1981.980] * [-1976.621] (-1983.717) (-1972.097) (-1977.550) -- 0:01:13
651500 -- (-1982.109) (-1975.219) [-1970.687] (-1980.305) * (-1974.568) [-1976.921] (-1972.691) (-1981.311) -- 0:01:13
652000 -- (-1978.549) [-1971.822] (-1974.497) (-1980.158) * (-1973.329) (-1971.751) [-1978.083] (-1978.222) -- 0:01:13
652500 -- (-1976.252) [-1978.559] (-1986.643) (-1976.705) * (-1972.528) [-1973.246] (-1977.874) (-1976.784) -- 0:01:12
653000 -- [-1973.242] (-1981.114) (-1981.143) (-1980.424) * (-1973.155) (-1971.810) [-1979.101] (-1973.945) -- 0:01:12
653500 -- [-1972.018] (-1981.725) (-1976.557) (-1979.107) * (-1974.650) (-1971.721) (-1978.318) [-1977.626] -- 0:01:13
654000 -- (-1974.140) (-1984.794) (-1984.720) [-1979.440] * [-1970.936] (-1972.474) (-1975.767) (-1978.449) -- 0:01:13
654500 -- [-1973.112] (-1976.532) (-1976.694) (-1979.667) * [-1976.146] (-1975.289) (-1979.044) (-1980.159) -- 0:01:12
655000 -- [-1970.574] (-1981.928) (-1976.242) (-1977.048) * (-1973.247) (-1979.382) (-1974.986) [-1976.516] -- 0:01:12
Average standard deviation of split frequencies: 0.000000
655500 -- (-1971.294) [-1976.620] (-1984.467) (-1983.669) * (-1975.822) (-1977.425) [-1980.690] (-1974.456) -- 0:01:12
656000 -- (-1974.256) (-1978.196) (-1973.395) [-1974.503] * (-1976.927) (-1986.188) [-1976.208] (-1975.484) -- 0:01:12
656500 -- (-1974.998) (-1977.507) (-1974.475) [-1972.203] * (-1975.905) [-1974.478] (-1979.801) (-1977.618) -- 0:01:12
657000 -- [-1971.684] (-1978.405) (-1979.558) (-1978.540) * [-1975.525] (-1974.842) (-1975.162) (-1971.562) -- 0:01:12
657500 -- (-1976.451) (-1974.183) (-1982.641) [-1976.657] * (-1973.436) (-1970.634) (-1973.249) [-1975.074] -- 0:01:11
658000 -- (-1975.277) (-1977.479) [-1972.076] (-1975.427) * (-1976.337) [-1975.761] (-1977.563) (-1978.260) -- 0:01:11
658500 -- (-1974.313) [-1973.377] (-1978.254) (-1989.925) * (-1970.969) (-1975.456) (-1977.330) [-1972.024] -- 0:01:12
659000 -- [-1977.290] (-1976.015) (-1974.221) (-1980.527) * (-1980.060) (-1974.863) (-1978.695) [-1972.749] -- 0:01:11
659500 -- (-1972.054) (-1974.700) [-1976.492] (-1976.793) * (-1978.811) (-1974.978) [-1972.400] (-1977.131) -- 0:01:11
660000 -- (-1974.439) (-1979.092) (-1978.501) [-1979.345] * (-1973.765) (-1973.814) [-1980.210] (-1973.254) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
660500 -- [-1975.123] (-1974.634) (-1975.209) (-1983.780) * (-1972.367) [-1975.183] (-1976.190) (-1975.590) -- 0:01:11
661000 -- (-1977.218) (-1976.684) [-1973.333] (-1975.687) * [-1977.926] (-1979.811) (-1975.121) (-1976.110) -- 0:01:11
661500 -- (-1973.381) (-1976.159) (-1974.456) [-1971.985] * [-1973.272] (-1980.267) (-1974.569) (-1974.958) -- 0:01:11
662000 -- [-1978.119] (-1980.130) (-1986.124) (-1979.971) * [-1974.407] (-1979.180) (-1976.497) (-1974.480) -- 0:01:10
662500 -- (-1975.989) [-1973.766] (-1974.886) (-1984.616) * (-1974.331) (-1978.269) [-1973.784] (-1975.402) -- 0:01:10
663000 -- (-1977.704) (-1978.253) (-1986.582) [-1979.493] * (-1974.733) [-1975.711] (-1976.898) (-1975.126) -- 0:01:11
663500 -- (-1986.194) [-1976.229] (-1977.864) (-1975.541) * (-1973.919) (-1975.499) [-1975.590] (-1979.554) -- 0:01:11
664000 -- (-1980.282) (-1976.841) (-1983.410) [-1975.905] * [-1977.026] (-1971.688) (-1977.405) (-1975.084) -- 0:01:10
664500 -- (-1982.586) (-1980.862) (-1983.767) [-1972.914] * (-1980.108) (-1976.851) [-1975.937] (-1981.562) -- 0:01:10
665000 -- (-1980.293) (-1973.902) (-1979.834) [-1980.306] * (-1979.049) (-1980.690) (-1978.737) [-1976.749] -- 0:01:10
Average standard deviation of split frequencies: 0.000000
665500 -- (-1983.588) (-1974.621) (-1976.088) [-1975.316] * (-1977.636) (-1978.611) (-1980.535) [-1973.057] -- 0:01:10
666000 -- (-1979.416) [-1978.571] (-1981.558) (-1988.725) * [-1978.585] (-1974.244) (-1976.395) (-1973.632) -- 0:01:10
666500 -- (-1981.733) (-1994.089) [-1975.802] (-1982.287) * (-1975.501) (-1979.266) [-1972.907] (-1982.546) -- 0:01:10
667000 -- [-1977.420] (-1979.678) (-1975.758) (-1973.319) * [-1979.558] (-1980.755) (-1978.116) (-1977.545) -- 0:01:09
667500 -- (-1976.452) (-1980.236) (-1980.134) [-1977.050] * [-1977.047] (-1975.630) (-1975.950) (-1979.930) -- 0:01:09
668000 -- [-1976.700] (-1980.754) (-1974.625) (-1976.518) * (-1976.675) (-1974.598) (-1973.826) [-1972.652] -- 0:01:10
668500 -- [-1978.387] (-1982.153) (-1975.270) (-1977.260) * (-1977.139) [-1974.955] (-1975.148) (-1971.891) -- 0:01:09
669000 -- (-1974.662) (-1983.985) [-1976.829] (-1979.434) * (-1977.591) (-1976.552) (-1977.149) [-1974.773] -- 0:01:09
669500 -- [-1977.595] (-1974.595) (-1980.366) (-1973.176) * (-1977.494) (-1974.117) [-1978.423] (-1974.416) -- 0:01:09
670000 -- (-1976.320) (-1982.103) (-1977.393) [-1972.565] * (-1977.341) [-1976.066] (-1974.326) (-1977.916) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
670500 -- [-1976.613] (-1977.410) (-1979.402) (-1976.705) * (-1977.005) (-1975.025) [-1977.296] (-1976.826) -- 0:01:09
671000 -- (-1972.597) (-1982.116) (-1980.488) [-1976.028] * (-1976.074) [-1974.839] (-1972.020) (-1980.589) -- 0:01:09
671500 -- [-1975.679] (-1973.088) (-1979.529) (-1978.556) * (-1977.188) [-1976.675] (-1972.653) (-1975.104) -- 0:01:08
672000 -- (-1976.751) (-1976.761) (-1978.605) [-1975.620] * (-1981.892) (-1978.971) (-1976.942) [-1979.660] -- 0:01:08
672500 -- (-1981.441) (-1974.374) (-1975.844) [-1981.159] * (-1975.037) (-1972.608) (-1983.989) [-1975.532] -- 0:01:09
673000 -- [-1977.478] (-1981.472) (-1977.299) (-1976.624) * (-1978.744) (-1980.293) [-1975.554] (-1979.275) -- 0:01:08
673500 -- (-1983.104) (-1983.155) [-1975.690] (-1976.088) * (-1976.364) [-1976.742] (-1976.243) (-1975.827) -- 0:01:08
674000 -- (-1981.001) [-1973.048] (-1975.397) (-1982.748) * (-1981.647) (-1977.183) [-1976.374] (-1976.474) -- 0:01:08
674500 -- [-1977.670] (-1974.136) (-1972.097) (-1982.336) * (-1976.375) (-1977.777) (-1977.514) [-1984.486] -- 0:01:08
675000 -- (-1978.285) (-1976.345) [-1972.242] (-1973.868) * (-1977.461) (-1978.342) (-1979.787) [-1976.177] -- 0:01:08
Average standard deviation of split frequencies: 0.000000
675500 -- (-1972.985) (-1979.080) (-1972.641) [-1981.242] * (-1977.162) (-1980.464) (-1976.175) [-1973.104] -- 0:01:08
676000 -- (-1980.521) (-1981.353) [-1972.079] (-1980.966) * (-1974.491) [-1973.481] (-1977.401) (-1976.670) -- 0:01:08
676500 -- (-1974.327) (-1979.934) [-1975.157] (-1979.613) * (-1973.927) (-1973.348) (-1975.878) [-1980.992] -- 0:01:07
677000 -- (-1976.849) (-1977.177) [-1973.813] (-1981.642) * (-1978.872) (-1976.823) (-1978.558) [-1980.558] -- 0:01:07
677500 -- (-1975.977) (-1983.364) [-1975.053] (-1972.954) * (-1983.647) (-1977.403) (-1981.577) [-1984.588] -- 0:01:08
678000 -- (-1974.814) (-1976.062) (-1975.679) [-1980.764] * (-1975.625) (-1976.881) [-1976.033] (-1979.117) -- 0:01:07
678500 -- (-1978.608) [-1976.570] (-1978.247) (-1978.159) * (-1976.869) (-1980.017) [-1973.748] (-1977.478) -- 0:01:07
679000 -- (-1975.228) [-1973.804] (-1977.178) (-1976.549) * [-1974.568] (-1979.457) (-1973.885) (-1981.727) -- 0:01:07
679500 -- (-1975.277) (-1977.080) [-1979.229] (-1972.355) * (-1977.359) (-1981.666) (-1974.588) [-1973.418] -- 0:01:07
680000 -- (-1975.951) [-1978.227] (-1980.216) (-1972.125) * (-1978.611) (-1972.893) (-1980.189) [-1973.709] -- 0:01:07
Average standard deviation of split frequencies: 0.000000
680500 -- (-1976.133) (-1973.773) (-1983.304) [-1973.892] * (-1976.050) (-1980.482) [-1982.849] (-1978.165) -- 0:01:07
681000 -- (-1979.831) (-1983.010) (-1981.119) [-1976.662] * (-1977.997) (-1981.525) (-1980.793) [-1975.034] -- 0:01:06
681500 -- (-1972.694) (-1973.779) [-1973.388] (-1974.986) * (-1974.699) [-1971.466] (-1985.005) (-1978.024) -- 0:01:06
682000 -- (-1976.889) (-1975.462) [-1977.213] (-1987.404) * [-1975.438] (-1980.083) (-1976.419) (-1973.069) -- 0:01:07
682500 -- (-1974.295) [-1976.514] (-1983.447) (-1979.039) * (-1974.879) (-1974.772) (-1984.353) [-1973.532] -- 0:01:06
683000 -- (-1975.980) (-1976.656) (-1979.896) [-1975.191] * [-1974.831] (-1975.446) (-1974.389) (-1974.202) -- 0:01:06
683500 -- (-1974.835) [-1976.328] (-1977.522) (-1975.393) * (-1975.869) (-1969.876) (-1985.876) [-1979.383] -- 0:01:06
684000 -- [-1977.188] (-1979.743) (-1984.039) (-1975.841) * (-1969.990) [-1977.153] (-1982.863) (-1978.614) -- 0:01:06
684500 -- (-1975.370) (-1975.666) [-1984.271] (-1976.129) * [-1970.628] (-1982.409) (-1981.916) (-1975.946) -- 0:01:06
685000 -- [-1975.076] (-1972.329) (-1985.940) (-1977.994) * [-1972.453] (-1976.761) (-1979.660) (-1983.432) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
685500 -- [-1979.130] (-1976.151) (-1985.489) (-1975.344) * [-1971.366] (-1974.927) (-1980.850) (-1983.757) -- 0:01:06
686000 -- (-1978.079) [-1976.575] (-1974.030) (-1978.303) * (-1976.400) [-1975.058] (-1975.475) (-1979.181) -- 0:01:05
686500 -- (-1980.592) [-1972.560] (-1975.769) (-1983.813) * [-1974.227] (-1977.256) (-1979.091) (-1977.627) -- 0:01:05
687000 -- (-1982.561) (-1988.839) [-1980.237] (-1982.359) * (-1973.085) [-1976.392] (-1975.337) (-1977.542) -- 0:01:06
687500 -- (-1979.676) [-1983.141] (-1975.231) (-1973.857) * (-1978.139) (-1980.992) [-1979.164] (-1977.351) -- 0:01:05
688000 -- (-1986.556) (-1981.047) [-1976.513] (-1973.278) * [-1977.391] (-1978.202) (-1983.044) (-1974.016) -- 0:01:05
688500 -- (-1975.596) (-1972.041) [-1975.134] (-1973.617) * [-1973.762] (-1980.473) (-1978.995) (-1972.823) -- 0:01:05
689000 -- (-1971.031) (-1979.667) [-1974.156] (-1974.471) * (-1975.769) [-1974.416] (-1980.792) (-1977.261) -- 0:01:05
689500 -- (-1974.579) (-1974.316) [-1977.559] (-1975.661) * (-1984.854) (-1980.818) [-1983.679] (-1978.629) -- 0:01:05
690000 -- (-1979.439) (-1975.684) (-1977.647) [-1977.933] * (-1977.348) (-1974.679) [-1978.082] (-1976.076) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
690500 -- (-1974.685) (-1981.162) [-1973.712] (-1984.557) * (-1973.560) (-1979.276) (-1975.491) [-1976.823] -- 0:01:04
691000 -- [-1971.184] (-1978.045) (-1977.319) (-1986.283) * (-1974.352) [-1984.079] (-1975.766) (-1974.719) -- 0:01:04
691500 -- (-1976.129) [-1977.902] (-1976.338) (-1977.556) * (-1978.374) [-1979.024] (-1973.618) (-1972.800) -- 0:01:05
692000 -- (-1976.084) (-1987.472) (-1979.530) [-1971.272] * [-1975.904] (-1975.060) (-1982.868) (-1980.280) -- 0:01:04
692500 -- (-1979.462) [-1979.788] (-1984.347) (-1977.097) * (-1972.599) [-1973.351] (-1981.298) (-1978.764) -- 0:01:04
693000 -- (-1975.742) (-1983.109) (-1980.492) [-1978.253] * (-1975.155) (-1975.319) (-1976.280) [-1981.508] -- 0:01:04
693500 -- (-1971.623) [-1977.835] (-1977.982) (-1981.726) * [-1974.042] (-1973.889) (-1976.257) (-1977.825) -- 0:01:04
694000 -- (-1987.133) (-1981.257) (-1983.831) [-1975.992] * (-1975.033) [-1976.346] (-1974.096) (-1983.786) -- 0:01:04
694500 -- (-1983.787) (-1978.399) [-1979.741] (-1973.527) * [-1976.895] (-1972.419) (-1973.900) (-1979.645) -- 0:01:04
695000 -- (-1978.623) (-1972.257) (-1983.344) [-1976.196] * [-1971.675] (-1977.431) (-1977.145) (-1984.147) -- 0:01:04
Average standard deviation of split frequencies: 0.000000
695500 -- (-1979.923) (-1974.812) [-1981.325] (-1978.995) * (-1973.228) (-1978.876) [-1976.911] (-1976.596) -- 0:01:03
696000 -- [-1976.170] (-1980.003) (-1977.652) (-1977.122) * [-1972.959] (-1985.175) (-1979.667) (-1979.527) -- 0:01:03
696500 -- (-1975.235) (-1976.350) [-1980.018] (-1977.201) * (-1974.199) (-1985.185) (-1978.019) [-1978.997] -- 0:01:04
697000 -- (-1971.580) (-1979.997) (-1976.865) [-1976.952] * (-1976.323) (-1980.538) (-1981.603) [-1971.974] -- 0:01:03
697500 -- [-1979.639] (-1975.120) (-1980.821) (-1971.889) * [-1977.020] (-1978.989) (-1976.070) (-1976.874) -- 0:01:03
698000 -- (-1975.389) (-1978.009) [-1974.402] (-1976.428) * (-1980.847) (-1972.714) [-1976.744] (-1978.402) -- 0:01:03
698500 -- (-1974.110) (-1978.657) (-1975.705) [-1975.038] * [-1975.623] (-1974.836) (-1976.021) (-1982.449) -- 0:01:03
699000 -- (-1977.574) (-1977.943) (-1975.894) [-1977.171] * [-1976.343] (-1984.463) (-1975.684) (-1978.724) -- 0:01:03
699500 -- (-1973.928) (-1977.076) [-1980.316] (-1977.083) * (-1981.012) (-1974.091) (-1980.581) [-1978.538] -- 0:01:03
700000 -- (-1977.089) (-1976.026) [-1970.428] (-1972.939) * (-1975.206) [-1975.625] (-1977.895) (-1975.278) -- 0:01:03
Average standard deviation of split frequencies: 0.000000
700500 -- [-1981.410] (-1975.363) (-1973.331) (-1977.731) * (-1985.043) (-1977.053) [-1978.962] (-1974.250) -- 0:01:02
701000 -- (-1980.742) (-1978.906) [-1970.503] (-1981.882) * (-1980.719) (-1977.684) [-1977.458] (-1977.988) -- 0:01:03
701500 -- (-1983.379) (-1975.323) [-1977.632] (-1985.388) * (-1974.680) (-1975.852) (-1977.399) [-1974.380] -- 0:01:02
702000 -- [-1979.300] (-1981.025) (-1971.365) (-1978.829) * (-1975.259) [-1976.851] (-1974.772) (-1981.395) -- 0:01:02
702500 -- (-1975.596) (-1978.490) (-1979.436) [-1973.835] * (-1974.666) (-1978.966) (-1979.369) [-1975.660] -- 0:01:02
703000 -- (-1975.085) (-1970.968) (-1981.741) [-1980.510] * (-1978.238) [-1975.927] (-1976.972) (-1976.885) -- 0:01:02
703500 -- (-1981.965) (-1974.922) (-1981.837) [-1980.152] * (-1973.690) (-1976.919) (-1977.779) [-1975.742] -- 0:01:02
704000 -- (-1983.439) (-1980.858) [-1976.754] (-1975.125) * (-1983.821) (-1975.926) (-1977.198) [-1975.153] -- 0:01:02
704500 -- (-1978.498) [-1980.213] (-1980.513) (-1973.384) * (-1977.144) (-1980.098) [-1973.889] (-1978.254) -- 0:01:02
705000 -- (-1981.348) [-1975.441] (-1971.916) (-1973.893) * (-1984.388) (-1982.111) [-1975.136] (-1973.875) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
705500 -- (-1983.400) (-1975.591) (-1973.059) [-1977.126] * (-1977.107) (-1986.921) (-1982.845) [-1974.746] -- 0:01:01
706000 -- [-1984.404] (-1982.506) (-1976.695) (-1984.020) * [-1972.941] (-1984.169) (-1973.970) (-1975.751) -- 0:01:02
706500 -- (-1978.298) (-1979.151) (-1976.535) [-1975.392] * (-1979.788) (-1975.335) (-1978.526) [-1972.044] -- 0:01:01
707000 -- (-1973.733) (-1977.388) (-1976.532) [-1974.108] * (-1974.162) [-1980.021] (-1972.480) (-1986.788) -- 0:01:01
707500 -- (-1970.615) (-1981.278) [-1977.014] (-1976.586) * (-1975.144) (-1977.333) [-1976.157] (-1978.758) -- 0:01:01
708000 -- (-1973.912) (-1976.835) (-1975.225) [-1974.239] * [-1976.141] (-1986.319) (-1980.709) (-1977.918) -- 0:01:01
708500 -- (-1974.863) (-1980.951) [-1976.911] (-1976.803) * (-1983.449) [-1971.299] (-1985.306) (-1983.100) -- 0:01:01
709000 -- [-1977.318] (-1980.953) (-1981.184) (-1974.719) * [-1977.690] (-1978.888) (-1981.387) (-1981.350) -- 0:01:01
709500 -- (-1974.252) (-1994.400) [-1979.849] (-1978.549) * [-1978.703] (-1974.387) (-1985.246) (-1977.814) -- 0:01:01
710000 -- (-1977.509) [-1986.681] (-1978.621) (-1975.944) * (-1977.675) [-1975.381] (-1980.230) (-1977.113) -- 0:01:00
Average standard deviation of split frequencies: 0.000000
710500 -- (-1984.475) (-1979.930) (-1981.874) [-1977.272] * [-1980.041] (-1974.480) (-1985.440) (-1974.650) -- 0:01:01
711000 -- (-1978.550) [-1974.083] (-1974.486) (-1976.827) * (-1973.945) [-1979.367] (-1978.736) (-1974.816) -- 0:01:00
711500 -- (-1989.644) (-1971.887) [-1977.259] (-1980.104) * (-1978.421) (-1980.145) [-1976.212] (-1975.611) -- 0:01:00
712000 -- (-1977.188) [-1973.613] (-1976.613) (-1975.874) * (-1975.510) (-1981.514) (-1975.674) [-1976.868] -- 0:01:00
712500 -- (-1976.670) (-1975.168) (-1980.326) [-1981.289] * (-1973.168) (-1977.251) [-1976.076] (-1979.847) -- 0:01:00
713000 -- (-1978.587) (-1979.918) [-1973.826] (-1976.577) * (-1971.596) (-1991.625) (-1984.644) [-1974.854] -- 0:01:00
713500 -- [-1979.519] (-1973.997) (-1978.715) (-1976.504) * [-1977.279] (-1981.250) (-1975.894) (-1973.596) -- 0:01:00
714000 -- (-1975.570) (-1974.300) [-1973.474] (-1975.955) * (-1978.583) (-1980.356) (-1975.168) [-1973.326] -- 0:01:00
714500 -- (-1986.182) [-1974.791] (-1980.695) (-1976.212) * (-1976.251) (-1979.793) (-1980.724) [-1976.941] -- 0:00:59
715000 -- (-1985.789) [-1978.908] (-1972.876) (-1979.214) * (-1975.764) (-1980.005) (-1976.754) [-1976.487] -- 0:00:59
Average standard deviation of split frequencies: 0.000000
715500 -- [-1979.427] (-1978.300) (-1976.286) (-1976.490) * [-1977.947] (-1987.844) (-1981.977) (-1977.887) -- 0:01:00
716000 -- (-1978.144) (-1983.213) [-1976.964] (-1978.673) * [-1972.541] (-1985.561) (-1978.725) (-1974.035) -- 0:00:59
716500 -- (-1974.716) (-1984.372) (-1976.063) [-1975.299] * (-1980.535) (-1980.697) [-1980.461] (-1976.531) -- 0:00:59
717000 -- (-1976.533) [-1974.474] (-1974.970) (-1974.018) * (-1980.936) [-1976.087] (-1979.741) (-1982.030) -- 0:00:59
717500 -- (-1977.535) (-1976.148) (-1974.789) [-1976.772] * [-1974.942] (-1978.273) (-1973.489) (-1982.822) -- 0:00:59
718000 -- (-1977.415) [-1975.365] (-1974.820) (-1978.747) * (-1978.767) (-1980.852) [-1975.970] (-1975.701) -- 0:00:59
718500 -- (-1972.668) [-1977.868] (-1978.175) (-1979.620) * (-1975.763) (-1981.921) (-1985.791) [-1973.262] -- 0:00:59
719000 -- (-1973.855) (-1981.768) [-1977.449] (-1976.843) * (-1983.029) [-1977.794] (-1978.237) (-1986.786) -- 0:00:59
719500 -- (-1972.906) (-1970.528) [-1978.811] (-1979.305) * [-1982.639] (-1974.211) (-1974.664) (-1983.316) -- 0:00:58
720000 -- (-1979.246) (-1979.875) (-1974.310) [-1976.234] * (-1975.090) [-1971.033] (-1982.038) (-1970.059) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
720500 -- (-1974.015) (-1975.723) [-1977.938] (-1980.285) * (-1979.986) (-1980.423) [-1981.341] (-1976.789) -- 0:00:58
721000 -- [-1972.639] (-1977.703) (-1973.930) (-1972.580) * [-1974.143] (-1978.728) (-1973.573) (-1972.490) -- 0:00:58
721500 -- (-1977.276) [-1980.310] (-1974.588) (-1973.437) * (-1981.185) [-1979.853] (-1986.221) (-1975.205) -- 0:00:58
722000 -- (-1971.626) [-1975.187] (-1973.549) (-1975.963) * [-1979.583] (-1977.984) (-1978.560) (-1974.613) -- 0:00:58
722500 -- (-1976.607) (-1971.961) [-1975.896] (-1975.846) * (-1981.381) (-1980.470) (-1973.252) [-1980.873] -- 0:00:58
723000 -- (-1974.448) [-1972.004] (-1983.818) (-1974.149) * (-1979.471) (-1980.311) [-1973.415] (-1975.670) -- 0:00:58
723500 -- (-1973.217) [-1973.246] (-1980.361) (-1976.372) * (-1970.237) [-1974.191] (-1975.836) (-1978.341) -- 0:00:58
724000 -- [-1973.432] (-1977.054) (-1980.521) (-1972.472) * (-1974.603) (-1986.188) [-1974.461] (-1975.215) -- 0:00:57
724500 -- (-1980.828) (-1977.216) (-1983.557) [-1977.265] * (-1978.500) (-1978.142) [-1976.422] (-1973.602) -- 0:00:57
725000 -- (-1978.892) (-1982.101) (-1977.029) [-1973.886] * (-1975.614) (-1977.039) (-1976.081) [-1974.599] -- 0:00:58
Average standard deviation of split frequencies: 0.000000
725500 -- [-1978.505] (-1984.787) (-1974.308) (-1971.575) * (-1976.212) (-1976.323) [-1974.223] (-1976.260) -- 0:00:57
726000 -- (-1984.343) [-1978.797] (-1974.991) (-1976.792) * [-1973.326] (-1973.039) (-1973.736) (-1972.176) -- 0:00:57
726500 -- (-1981.558) (-1974.463) [-1980.667] (-1978.439) * (-1975.385) [-1975.422] (-1977.172) (-1978.467) -- 0:00:57
727000 -- (-1979.093) [-1977.784] (-1977.659) (-1977.058) * [-1975.179] (-1975.259) (-1984.620) (-1973.553) -- 0:00:57
727500 -- (-1978.070) (-1976.617) [-1973.088] (-1976.773) * (-1980.323) (-1975.312) [-1974.003] (-1974.161) -- 0:00:57
728000 -- (-1975.395) (-1979.913) (-1973.767) [-1976.650] * (-1985.098) (-1974.169) (-1983.433) [-1976.705] -- 0:00:57
728500 -- [-1971.528] (-1976.932) (-1974.981) (-1978.302) * (-1975.731) [-1976.272] (-1979.030) (-1972.931) -- 0:00:57
729000 -- (-1979.386) (-1976.522) [-1972.631] (-1971.765) * (-1980.716) [-1972.382] (-1974.835) (-1974.315) -- 0:00:56
729500 -- (-1983.945) [-1977.352] (-1975.234) (-1971.265) * (-1973.593) (-1977.181) (-1974.415) [-1972.777] -- 0:00:56
730000 -- (-1977.790) (-1976.138) (-1971.497) [-1977.506] * [-1975.524] (-1977.925) (-1972.721) (-1975.110) -- 0:00:56
Average standard deviation of split frequencies: 0.000000
730500 -- (-1982.817) (-1977.394) (-1974.825) [-1981.022] * [-1975.113] (-1975.475) (-1974.221) (-1974.052) -- 0:00:56
731000 -- [-1975.337] (-1984.273) (-1974.722) (-1978.210) * [-1978.889] (-1973.359) (-1984.363) (-1974.653) -- 0:00:56
731500 -- [-1977.787] (-1975.522) (-1973.306) (-1982.331) * (-1980.054) (-1976.591) [-1977.664] (-1972.249) -- 0:00:56
732000 -- (-1982.207) (-1977.031) (-1973.157) [-1975.737] * [-1975.756] (-1973.701) (-1983.296) (-1979.723) -- 0:00:56
732500 -- (-1980.263) [-1974.108] (-1973.621) (-1981.609) * (-1982.336) (-1975.729) (-1977.989) [-1974.049] -- 0:00:56
733000 -- (-1973.147) [-1973.152] (-1975.619) (-1982.443) * (-1979.879) (-1979.510) (-1981.705) [-1974.299] -- 0:00:56
733500 -- (-1977.224) [-1972.101] (-1984.149) (-1974.242) * (-1978.208) (-1975.707) [-1975.646] (-1982.693) -- 0:00:55
734000 -- [-1983.217] (-1982.976) (-1978.515) (-1976.378) * (-1981.170) (-1977.975) (-1976.893) [-1975.058] -- 0:00:55
734500 -- (-1987.001) (-1982.147) (-1983.580) [-1977.621] * [-1974.982] (-1980.480) (-1979.053) (-1977.115) -- 0:00:56
735000 -- (-1976.011) (-1985.017) (-1978.122) [-1975.658] * (-1979.393) (-1971.847) [-1972.647] (-1978.317) -- 0:00:55
Average standard deviation of split frequencies: 0.000000
735500 -- (-1981.412) (-1976.393) (-1971.509) [-1976.831] * (-1973.781) [-1975.914] (-1973.873) (-1981.209) -- 0:00:55
736000 -- (-1979.861) (-1977.392) [-1978.279] (-1970.473) * (-1970.664) [-1973.483] (-1974.800) (-1974.900) -- 0:00:55
736500 -- (-1976.083) (-1978.208) [-1973.552] (-1978.346) * (-1976.682) (-1978.696) (-1976.061) [-1972.954] -- 0:00:55
737000 -- (-1973.151) (-1974.656) (-1978.377) [-1980.553] * (-1982.427) (-1977.651) (-1982.177) [-1976.388] -- 0:00:55
737500 -- (-1972.740) [-1974.087] (-1976.132) (-1976.492) * [-1977.942] (-1975.806) (-1976.415) (-1973.064) -- 0:00:55
738000 -- (-1977.828) [-1973.916] (-1973.140) (-1986.989) * (-1974.641) [-1975.190] (-1979.559) (-1983.004) -- 0:00:55
738500 -- (-1979.844) (-1974.454) [-1979.184] (-1982.486) * [-1974.523] (-1978.421) (-1978.065) (-1975.605) -- 0:00:54
739000 -- (-1972.494) (-1977.957) (-1973.650) [-1977.580] * (-1974.293) (-1979.480) (-1981.002) [-1978.350] -- 0:00:54
739500 -- [-1977.930] (-1978.293) (-1983.333) (-1979.637) * (-1984.272) (-1975.846) (-1975.912) [-1970.798] -- 0:00:54
740000 -- [-1970.831] (-1989.486) (-1981.023) (-1979.707) * [-1976.764] (-1978.865) (-1983.865) (-1974.547) -- 0:00:54
Average standard deviation of split frequencies: 0.000000
740500 -- (-1975.939) [-1979.577] (-1977.152) (-1976.967) * [-1970.081] (-1973.838) (-1972.118) (-1980.987) -- 0:00:54
741000 -- [-1973.707] (-1977.967) (-1973.816) (-1977.943) * (-1973.895) (-1973.104) [-1976.618] (-1981.275) -- 0:00:54
741500 -- (-1978.022) [-1975.025] (-1972.171) (-1973.240) * [-1975.446] (-1982.498) (-1975.175) (-1982.495) -- 0:00:54
742000 -- (-1975.174) [-1979.550] (-1977.488) (-1978.567) * (-1990.940) [-1973.042] (-1978.704) (-1978.454) -- 0:00:54
742500 -- (-1975.999) (-1976.299) [-1969.908] (-1979.168) * (-1976.376) [-1971.025] (-1980.276) (-1972.379) -- 0:00:54
743000 -- (-1978.120) (-1979.050) [-1975.348] (-1975.101) * [-1988.487] (-1981.805) (-1976.644) (-1975.543) -- 0:00:53
743500 -- [-1976.108] (-1974.433) (-1976.203) (-1976.332) * (-1980.451) (-1977.504) [-1983.935] (-1981.441) -- 0:00:53
744000 -- (-1982.160) (-1979.036) (-1980.192) [-1982.507] * [-1973.465] (-1977.608) (-1973.116) (-1975.555) -- 0:00:54
744500 -- (-1976.822) (-1978.219) [-1973.219] (-1975.575) * (-1973.839) (-1979.595) [-1975.390] (-1981.217) -- 0:00:53
745000 -- (-1985.106) (-1977.706) (-1972.961) [-1974.840] * (-1974.674) (-1973.694) (-1975.641) [-1976.520] -- 0:00:53
Average standard deviation of split frequencies: 0.000000
745500 -- [-1975.738] (-1979.834) (-1973.183) (-1977.593) * (-1983.094) (-1982.900) [-1977.823] (-1979.246) -- 0:00:53
746000 -- (-1976.301) (-1977.197) (-1972.673) [-1978.068] * [-1977.833] (-1972.546) (-1981.769) (-1985.564) -- 0:00:53
746500 -- [-1978.473] (-1975.836) (-1977.354) (-1977.814) * (-1972.439) (-1974.572) [-1975.469] (-1979.552) -- 0:00:53
747000 -- (-1976.064) [-1971.516] (-1976.048) (-1979.911) * (-1974.863) (-1976.656) (-1976.146) [-1977.393] -- 0:00:53
747500 -- [-1975.047] (-1974.770) (-1976.873) (-1977.994) * (-1975.770) (-1973.837) (-1978.209) [-1973.696] -- 0:00:53
748000 -- [-1976.034] (-1977.396) (-1984.765) (-1982.858) * (-1975.570) (-1976.682) (-1975.248) [-1975.022] -- 0:00:52
748500 -- [-1970.979] (-1982.536) (-1979.157) (-1982.455) * (-1975.711) (-1974.639) (-1979.996) [-1971.912] -- 0:00:52
749000 -- (-1977.569) [-1981.590] (-1976.477) (-1980.850) * (-1978.917) (-1981.795) [-1976.970] (-1987.122) -- 0:00:52
749500 -- (-1973.655) [-1979.121] (-1980.881) (-1983.982) * (-1984.304) (-1979.651) [-1981.201] (-1978.040) -- 0:00:52
750000 -- [-1976.543] (-1975.213) (-1981.255) (-1977.555) * (-1977.073) [-1976.353] (-1978.112) (-1979.725) -- 0:00:52
Average standard deviation of split frequencies: 0.000000
750500 -- (-1973.385) [-1972.190] (-1978.728) (-1980.046) * (-1981.887) (-1978.931) (-1982.763) [-1976.314] -- 0:00:52
751000 -- [-1978.017] (-1974.534) (-1977.288) (-1980.078) * (-1974.843) (-1978.338) (-1979.239) [-1975.741] -- 0:00:52
751500 -- [-1980.382] (-1978.727) (-1976.373) (-1978.085) * (-1975.776) [-1973.593] (-1985.787) (-1981.360) -- 0:00:52
752000 -- (-1976.096) (-1983.619) (-1979.136) [-1976.665] * (-1975.962) (-1979.913) (-1976.123) [-1975.847] -- 0:00:52
752500 -- (-1987.429) [-1977.996] (-1978.930) (-1977.188) * (-1978.929) [-1973.951] (-1976.754) (-1974.007) -- 0:00:51
753000 -- [-1977.060] (-1976.655) (-1980.156) (-1986.735) * (-1975.836) [-1973.643] (-1977.997) (-1976.222) -- 0:00:51
753500 -- (-1972.926) [-1969.186] (-1971.998) (-1974.739) * [-1973.024] (-1974.647) (-1982.373) (-1975.538) -- 0:00:52
754000 -- [-1974.620] (-1976.152) (-1972.645) (-1977.853) * (-1977.044) (-1976.007) [-1980.502] (-1981.212) -- 0:00:51
754500 -- [-1978.588] (-1975.394) (-1977.537) (-1980.547) * (-1976.190) [-1975.709] (-1973.223) (-1971.121) -- 0:00:51
755000 -- (-1972.996) [-1972.071] (-1976.512) (-1978.697) * [-1977.059] (-1971.454) (-1977.082) (-1971.485) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
755500 -- (-1980.100) (-1976.830) [-1976.589] (-1978.207) * (-1978.161) [-1978.000] (-1980.577) (-1977.680) -- 0:00:51
756000 -- [-1985.973] (-1974.195) (-1978.183) (-1977.231) * [-1973.028] (-1975.833) (-1975.892) (-1978.229) -- 0:00:51
756500 -- (-1979.524) (-1978.921) (-1977.506) [-1977.854] * (-1979.943) (-1985.694) (-1976.367) [-1977.271] -- 0:00:51
757000 -- [-1975.586] (-1976.143) (-1975.456) (-1975.880) * (-1974.862) (-1974.703) [-1977.043] (-1982.120) -- 0:00:51
757500 -- (-1979.484) [-1982.269] (-1976.269) (-1976.323) * (-1977.201) (-1973.822) (-1974.896) [-1975.673] -- 0:00:51
758000 -- (-1980.720) (-1980.988) (-1979.121) [-1977.040] * (-1975.376) [-1974.391] (-1976.653) (-1973.666) -- 0:00:51
758500 -- (-1983.408) [-1977.060] (-1977.996) (-1981.489) * (-1975.011) (-1975.648) [-1975.099] (-1977.079) -- 0:00:50
759000 -- (-1973.616) (-1977.972) [-1973.175] (-1990.636) * (-1973.432) (-1978.053) [-1972.548] (-1975.939) -- 0:00:50
759500 -- (-1980.999) [-1972.045] (-1977.790) (-1983.648) * (-1978.599) [-1976.369] (-1974.878) (-1981.285) -- 0:00:50
760000 -- (-1987.686) [-1975.305] (-1976.368) (-1982.411) * [-1972.676] (-1978.012) (-1973.998) (-1973.130) -- 0:00:50
Average standard deviation of split frequencies: 0.000000
760500 -- (-1980.501) [-1976.434] (-1979.327) (-1983.026) * (-1974.278) [-1974.478] (-1977.819) (-1979.651) -- 0:00:50
761000 -- (-1976.347) (-1974.588) (-1978.176) [-1982.100] * (-1973.068) [-1974.446] (-1978.268) (-1976.324) -- 0:00:50
761500 -- (-1974.555) [-1972.804] (-1973.833) (-1974.037) * (-1977.537) [-1975.348] (-1975.522) (-1975.961) -- 0:00:50
762000 -- (-1978.240) [-1976.428] (-1978.763) (-1979.961) * (-1982.052) [-1975.241] (-1978.491) (-1973.841) -- 0:00:50
762500 -- (-1981.572) (-1975.309) (-1976.152) [-1979.059] * (-1979.425) (-1979.666) (-1976.158) [-1972.884] -- 0:00:50
763000 -- (-1973.261) (-1977.660) [-1975.860] (-1985.802) * (-1977.146) (-1984.410) [-1980.879] (-1975.411) -- 0:00:50
763500 -- [-1973.764] (-1976.729) (-1976.880) (-1983.134) * (-1982.249) (-1980.095) [-1979.998] (-1979.654) -- 0:00:49
764000 -- (-1971.439) (-1972.493) (-1979.379) [-1981.807] * [-1978.821] (-1978.113) (-1979.494) (-1977.709) -- 0:00:49
764500 -- (-1979.226) (-1978.050) [-1976.853] (-1984.744) * (-1974.044) (-1984.733) [-1976.735] (-1973.880) -- 0:00:49
765000 -- [-1974.240] (-1976.853) (-1983.870) (-1981.332) * [-1971.839] (-1976.076) (-1972.863) (-1986.966) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
765500 -- [-1980.660] (-1972.493) (-1976.705) (-1978.047) * (-1975.848) (-1975.328) [-1969.640] (-1975.715) -- 0:00:49
766000 -- (-1976.576) (-1973.572) [-1972.594] (-1979.962) * (-1980.950) (-1973.062) [-1976.710] (-1976.227) -- 0:00:49
766500 -- [-1976.441] (-1973.587) (-1978.678) (-1988.452) * [-1977.115] (-1972.578) (-1973.626) (-1983.239) -- 0:00:49
767000 -- [-1980.227] (-1977.498) (-1976.996) (-1980.828) * (-1977.720) (-1976.197) [-1974.462] (-1978.981) -- 0:00:49
767500 -- (-1975.475) [-1972.754] (-1977.596) (-1983.229) * (-1980.218) (-1978.017) (-1981.583) [-1976.101] -- 0:00:49
768000 -- (-1981.102) [-1974.995] (-1983.145) (-1979.639) * (-1975.010) (-1979.245) (-1978.354) [-1975.303] -- 0:00:48
768500 -- (-1976.463) (-1975.479) [-1977.313] (-1976.335) * (-1972.058) (-1984.210) [-1974.959] (-1976.417) -- 0:00:48
769000 -- [-1977.615] (-1980.730) (-1975.698) (-1979.748) * (-1974.514) [-1972.970] (-1977.632) (-1975.278) -- 0:00:48
769500 -- [-1982.650] (-1975.907) (-1974.917) (-1979.886) * [-1974.248] (-1978.557) (-1977.950) (-1974.082) -- 0:00:48
770000 -- (-1978.524) (-1976.536) [-1976.246] (-1978.273) * [-1975.302] (-1981.411) (-1979.462) (-1977.505) -- 0:00:48
Average standard deviation of split frequencies: 0.000000
770500 -- (-1979.749) (-1980.225) [-1971.976] (-1981.820) * [-1976.907] (-1976.384) (-1975.483) (-1980.189) -- 0:00:48
771000 -- (-1975.891) (-1977.182) [-1976.755] (-1978.527) * [-1977.643] (-1980.407) (-1974.603) (-1979.343) -- 0:00:48
771500 -- (-1976.315) (-1978.748) (-1976.129) [-1978.981] * (-1993.429) (-1981.486) (-1975.184) [-1980.192] -- 0:00:48
772000 -- (-1976.387) [-1976.301] (-1975.918) (-1983.480) * (-1983.164) (-1975.030) [-1974.502] (-1976.329) -- 0:00:48
772500 -- (-1980.589) (-1978.998) [-1977.698] (-1980.719) * (-1979.932) (-1971.589) [-1977.243] (-1978.193) -- 0:00:48
773000 -- (-1984.724) [-1977.493] (-1973.997) (-1977.946) * (-1977.774) [-1973.265] (-1973.876) (-1978.821) -- 0:00:47
773500 -- (-1977.013) (-1975.854) (-1980.667) [-1981.524] * (-1980.910) [-1972.531] (-1977.411) (-1976.291) -- 0:00:47
774000 -- [-1978.999] (-1982.271) (-1976.523) (-1982.825) * [-1980.273] (-1979.549) (-1974.318) (-1983.064) -- 0:00:47
774500 -- (-1975.451) [-1974.998] (-1974.401) (-1988.436) * [-1980.225] (-1980.441) (-1977.305) (-1973.907) -- 0:00:47
775000 -- [-1973.916] (-1979.637) (-1972.821) (-1992.004) * (-1977.672) (-1975.122) [-1981.262] (-1973.127) -- 0:00:47
Average standard deviation of split frequencies: 0.000000
775500 -- [-1978.438] (-1978.994) (-1975.337) (-1990.362) * (-1975.377) (-1976.673) (-1979.209) [-1975.655] -- 0:00:47
776000 -- (-1979.537) [-1977.287] (-1979.130) (-1994.357) * (-1981.539) (-1979.010) [-1976.852] (-1975.669) -- 0:00:47
776500 -- [-1972.320] (-1976.967) (-1978.341) (-1985.668) * [-1975.946] (-1975.849) (-1979.364) (-1983.868) -- 0:00:47
777000 -- (-1975.907) (-1976.944) [-1973.997] (-1981.109) * (-1979.129) (-1977.102) [-1979.062] (-1980.123) -- 0:00:47
777500 -- (-1974.662) (-1983.577) [-1977.149] (-1974.415) * (-1977.288) (-1980.075) [-1978.869] (-1975.655) -- 0:00:46
778000 -- (-1979.845) (-1978.689) [-1970.991] (-1975.747) * (-1980.541) (-1974.693) [-1976.465] (-1989.279) -- 0:00:46
778500 -- [-1976.454] (-1973.614) (-1977.896) (-1974.852) * [-1981.699] (-1976.814) (-1977.351) (-1979.835) -- 0:00:46
779000 -- (-1975.768) (-1975.489) [-1977.312] (-1976.691) * (-1979.093) (-1972.678) (-1976.725) [-1977.750] -- 0:00:46
779500 -- (-1977.231) (-1981.818) [-1974.150] (-1971.822) * [-1975.614] (-1977.663) (-1977.152) (-1976.058) -- 0:00:46
780000 -- (-1979.747) (-1984.249) [-1976.708] (-1977.283) * (-1973.172) (-1977.704) [-1984.060] (-1970.596) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
780500 -- (-1981.913) (-1975.668) (-1978.341) [-1982.121] * [-1973.420] (-1979.569) (-1984.621) (-1974.269) -- 0:00:46
781000 -- (-1971.130) (-1978.488) [-1976.843] (-1977.543) * (-1970.865) [-1973.004] (-1980.191) (-1973.924) -- 0:00:46
781500 -- (-1977.520) (-1973.830) [-1979.678] (-1983.176) * (-1978.551) (-1974.993) [-1975.211] (-1976.422) -- 0:00:46
782000 -- [-1974.471] (-1980.740) (-1975.587) (-1974.659) * (-1976.032) (-1971.671) [-1975.784] (-1977.726) -- 0:00:45
782500 -- (-1973.712) (-1978.732) [-1972.838] (-1978.269) * (-1980.744) (-1975.514) [-1973.192] (-1975.535) -- 0:00:45
783000 -- (-1974.548) [-1974.807] (-1983.073) (-1974.077) * (-1978.894) (-1974.791) [-1976.271] (-1976.237) -- 0:00:45
783500 -- (-1982.064) (-1977.050) (-1981.110) [-1982.086] * (-1974.707) (-1974.128) [-1973.748] (-1974.834) -- 0:00:45
784000 -- (-1979.552) (-1977.203) (-1980.701) [-1977.976] * (-1976.250) (-1977.183) [-1971.629] (-1975.222) -- 0:00:45
784500 -- (-1988.545) (-1976.127) (-1975.029) [-1973.558] * [-1979.479] (-1973.601) (-1977.688) (-1975.726) -- 0:00:45
785000 -- (-1987.318) [-1973.653] (-1980.174) (-1971.293) * (-1978.805) (-1979.780) (-1975.759) [-1984.681] -- 0:00:45
Average standard deviation of split frequencies: 0.000000
785500 -- (-1978.947) [-1974.473] (-1980.322) (-1976.545) * (-1973.793) [-1977.297] (-1974.599) (-1976.580) -- 0:00:45
786000 -- (-1980.745) [-1978.141] (-1980.998) (-1980.870) * (-1983.408) (-1976.941) [-1976.826] (-1987.505) -- 0:00:45
786500 -- (-1975.112) (-1979.719) (-1981.596) [-1972.921] * (-1976.281) (-1979.512) [-1972.793] (-1982.092) -- 0:00:45
787000 -- [-1979.786] (-1974.225) (-1980.045) (-1975.044) * [-1977.678] (-1977.253) (-1974.113) (-1981.858) -- 0:00:44
787500 -- [-1979.898] (-1976.762) (-1977.811) (-1988.932) * (-1974.294) (-1981.882) [-1976.828] (-1974.573) -- 0:00:44
788000 -- (-1980.227) (-1978.389) [-1981.594] (-1982.600) * (-1979.724) [-1982.753] (-1972.282) (-1978.873) -- 0:00:44
788500 -- [-1976.621] (-1975.753) (-1974.933) (-1979.226) * [-1974.774] (-1975.669) (-1974.438) (-1974.674) -- 0:00:44
789000 -- [-1973.345] (-1982.220) (-1993.132) (-1977.022) * (-1975.327) [-1983.454] (-1975.517) (-1978.067) -- 0:00:44
789500 -- (-1987.168) (-1973.420) (-1979.707) [-1975.746] * (-1971.726) (-1972.532) (-1977.908) [-1978.830] -- 0:00:44
790000 -- [-1974.358] (-1975.720) (-1977.846) (-1974.089) * [-1974.372] (-1977.826) (-1976.059) (-1981.116) -- 0:00:44
Average standard deviation of split frequencies: 0.000000
790500 -- (-1975.237) [-1974.182] (-1979.167) (-1977.572) * (-1979.838) [-1981.356] (-1983.540) (-1975.572) -- 0:00:44
791000 -- [-1976.314] (-1975.320) (-1984.354) (-1974.903) * (-1991.065) [-1976.599] (-1977.018) (-1978.970) -- 0:00:44
791500 -- (-1979.862) [-1971.201] (-1979.282) (-1976.876) * [-1974.167] (-1973.582) (-1985.738) (-1980.518) -- 0:00:43
792000 -- (-1977.304) (-1972.646) [-1974.792] (-1974.157) * (-1981.245) [-1981.810] (-1979.374) (-1987.637) -- 0:00:43
792500 -- [-1977.051] (-1978.277) (-1975.733) (-1974.539) * (-1976.304) (-1981.632) [-1975.277] (-1980.664) -- 0:00:43
793000 -- (-1979.592) (-1977.490) [-1974.569] (-1976.984) * (-1985.858) (-1979.931) [-1982.008] (-1977.965) -- 0:00:43
793500 -- (-1982.642) (-1973.068) (-1976.086) [-1984.881] * [-1972.238] (-1976.785) (-1980.606) (-1979.682) -- 0:00:43
794000 -- [-1971.859] (-1974.744) (-1973.552) (-1982.266) * (-1976.630) [-1982.389] (-1981.925) (-1978.913) -- 0:00:43
794500 -- (-1983.612) (-1984.272) [-1981.615] (-1981.303) * (-1975.577) (-1983.613) [-1976.594] (-1972.479) -- 0:00:43
795000 -- (-1981.989) [-1981.890] (-1974.010) (-1972.206) * (-1972.906) (-1983.997) [-1980.886] (-1975.090) -- 0:00:43
Average standard deviation of split frequencies: 0.000000
795500 -- (-1975.692) (-1976.516) (-1982.617) [-1979.268] * [-1976.601] (-1981.819) (-1975.439) (-1970.441) -- 0:00:43
796000 -- (-1982.324) [-1976.686] (-1974.644) (-1977.212) * (-1975.869) (-1969.735) (-1977.995) [-1972.613] -- 0:00:43
796500 -- (-1975.779) (-1975.002) (-1972.822) [-1976.804] * [-1977.092] (-1974.628) (-1973.639) (-1971.125) -- 0:00:42
797000 -- (-1985.099) (-1971.844) (-1971.886) [-1977.279] * (-1985.073) [-1975.792] (-1980.629) (-1977.849) -- 0:00:42
797500 -- (-1979.382) (-1971.449) [-1976.984] (-1975.803) * (-1983.742) (-1977.745) [-1974.809] (-1981.477) -- 0:00:42
798000 -- (-1980.373) (-1975.633) [-1974.190] (-1976.228) * (-1979.078) (-1976.240) (-1982.978) [-1977.536] -- 0:00:42
798500 -- [-1974.918] (-1977.315) (-1975.629) (-1984.274) * [-1976.666] (-1980.536) (-1979.997) (-1974.672) -- 0:00:42
799000 -- (-1974.223) [-1979.661] (-1977.013) (-1987.904) * [-1980.662] (-1977.358) (-1979.998) (-1979.670) -- 0:00:42
799500 -- [-1975.526] (-1977.146) (-1976.883) (-1982.315) * [-1974.505] (-1979.510) (-1976.899) (-1979.213) -- 0:00:42
800000 -- (-1974.508) [-1979.963] (-1981.574) (-1980.236) * (-1975.780) (-1985.456) [-1974.490] (-1982.941) -- 0:00:42
Average standard deviation of split frequencies: 0.000000
800500 -- (-1976.564) (-1974.530) (-1986.466) [-1978.255] * [-1972.606] (-1978.943) (-1984.802) (-1979.242) -- 0:00:42
801000 -- (-1981.953) (-1975.097) (-1982.173) [-1973.434] * (-1983.528) (-1976.864) [-1974.032] (-1973.763) -- 0:00:41
801500 -- (-1977.005) (-1976.527) (-1978.998) [-1976.251] * (-1977.174) [-1976.844] (-1978.746) (-1979.558) -- 0:00:41
802000 -- (-1978.679) [-1970.173] (-1975.969) (-1977.317) * (-1980.646) [-1975.409] (-1976.522) (-1980.749) -- 0:00:41
802500 -- [-1979.658] (-1974.988) (-1979.764) (-1977.589) * [-1976.949] (-1980.593) (-1973.065) (-1973.487) -- 0:00:41
803000 -- (-1981.292) (-1982.078) (-1978.592) [-1975.742] * [-1972.321] (-1982.323) (-1977.388) (-1979.230) -- 0:00:41
803500 -- (-1972.481) (-1981.288) [-1973.013] (-1974.900) * (-1973.197) (-1976.561) [-1976.753] (-1972.549) -- 0:00:41
804000 -- [-1972.365] (-1981.052) (-1977.186) (-1981.779) * (-1973.862) [-1974.498] (-1973.690) (-1973.167) -- 0:00:41
804500 -- (-1977.194) (-1979.041) (-1973.436) [-1976.820] * (-1975.672) (-1978.283) (-1974.624) [-1975.917] -- 0:00:41
805000 -- (-1981.630) [-1977.698] (-1979.595) (-1978.542) * [-1979.287] (-1981.030) (-1971.946) (-1975.978) -- 0:00:41
Average standard deviation of split frequencies: 0.000000
805500 -- (-1977.751) (-1976.404) [-1974.000] (-1973.594) * (-1977.261) (-1978.687) (-1982.824) [-1972.640] -- 0:00:41
806000 -- (-1972.405) (-1974.130) (-1976.348) [-1976.401] * (-1974.185) (-1973.572) (-1978.401) [-1976.993] -- 0:00:40
806500 -- (-1974.548) (-1977.362) [-1976.305] (-1976.089) * (-1977.207) (-1974.302) [-1972.258] (-1971.389) -- 0:00:40
807000 -- [-1976.400] (-1984.887) (-1973.913) (-1982.008) * (-1975.655) (-1973.598) (-1978.232) [-1975.562] -- 0:00:40
807500 -- (-1971.375) [-1978.579] (-1972.665) (-1982.339) * (-1981.174) [-1972.107] (-1976.209) (-1981.674) -- 0:00:40
808000 -- (-1979.974) [-1976.822] (-1975.190) (-1980.851) * (-1982.885) [-1969.952] (-1976.982) (-1974.417) -- 0:00:40
808500 -- [-1972.564] (-1980.452) (-1975.691) (-1976.589) * (-1980.150) [-1971.886] (-1977.026) (-1972.471) -- 0:00:40
809000 -- [-1972.987] (-1977.173) (-1973.981) (-1989.433) * (-1980.691) (-1970.506) [-1976.297] (-1980.377) -- 0:00:40
809500 -- (-1979.094) (-1977.092) [-1974.394] (-1980.271) * (-1981.615) (-1975.326) (-1971.743) [-1976.114] -- 0:00:40
810000 -- (-1978.926) (-1977.107) (-1979.801) [-1976.738] * (-1979.584) (-1974.030) [-1974.973] (-1978.200) -- 0:00:40
Average standard deviation of split frequencies: 0.000000
810500 -- (-1977.555) (-1980.677) (-1974.322) [-1982.280] * (-1971.799) [-1980.860] (-1971.264) (-1980.885) -- 0:00:39
811000 -- [-1980.674] (-1976.234) (-1971.869) (-1974.264) * (-1983.454) [-1976.382] (-1985.435) (-1980.104) -- 0:00:39
811500 -- [-1979.090] (-1969.244) (-1980.723) (-1978.842) * (-1983.355) [-1972.845] (-1971.143) (-1981.580) -- 0:00:39
812000 -- (-1981.542) (-1974.036) (-1973.448) [-1979.045] * (-1981.562) (-1974.408) (-1972.666) [-1974.709] -- 0:00:39
812500 -- (-1982.240) (-1971.542) (-1974.470) [-1977.172] * [-1981.635] (-1976.667) (-1975.089) (-1977.380) -- 0:00:39
813000 -- [-1979.146] (-1971.950) (-1973.753) (-1976.686) * (-1973.955) (-1979.009) [-1977.423] (-1978.454) -- 0:00:39
813500 -- (-1981.769) (-1976.794) (-1972.944) [-1977.782] * (-1982.523) (-1978.630) [-1975.003] (-1981.218) -- 0:00:39
814000 -- (-1978.223) (-1974.817) [-1976.231] (-1983.586) * (-1976.319) [-1975.438] (-1977.172) (-1980.809) -- 0:00:39
814500 -- [-1979.130] (-1974.893) (-1980.989) (-1978.244) * (-1978.161) [-1974.597] (-1983.027) (-1979.005) -- 0:00:39
815000 -- (-1974.537) (-1972.965) [-1975.527] (-1978.734) * (-1977.347) (-1981.807) [-1980.128] (-1980.912) -- 0:00:39
Average standard deviation of split frequencies: 0.000000
815500 -- (-1978.451) (-1980.239) [-1974.914] (-1980.475) * (-1984.777) (-1974.410) [-1983.885] (-1977.429) -- 0:00:38
816000 -- (-1983.089) [-1975.816] (-1976.357) (-1979.670) * (-1975.354) (-1974.827) (-1987.888) [-1976.160] -- 0:00:38
816500 -- (-1975.901) (-1974.777) [-1981.164] (-1977.990) * (-1976.605) (-1977.844) (-1975.272) [-1974.272] -- 0:00:38
817000 -- (-1972.350) (-1976.941) (-1976.948) [-1976.198] * [-1980.478] (-1979.060) (-1983.560) (-1980.220) -- 0:00:38
817500 -- (-1975.876) (-1979.533) [-1974.577] (-1973.222) * (-1983.852) (-1974.563) [-1981.719] (-1973.926) -- 0:00:38
818000 -- (-1978.139) [-1973.664] (-1977.377) (-1980.600) * (-1980.356) (-1990.295) [-1977.410] (-1978.751) -- 0:00:38
818500 -- (-1983.531) (-1981.719) (-1978.823) [-1972.582] * (-1981.194) [-1972.307] (-1976.634) (-1980.412) -- 0:00:38
819000 -- (-1973.497) (-1976.689) [-1972.323] (-1975.929) * (-1977.135) [-1972.421] (-1980.665) (-1976.297) -- 0:00:38
819500 -- (-1979.232) (-1983.221) (-1975.571) [-1976.738] * (-1976.256) (-1980.299) [-1976.582] (-1974.337) -- 0:00:38
820000 -- (-1973.511) (-1971.563) [-1978.122] (-1985.650) * (-1978.709) (-1975.887) (-1980.056) [-1973.389] -- 0:00:37
Average standard deviation of split frequencies: 0.000000
820500 -- (-1976.133) (-1984.004) (-1979.074) [-1974.606] * (-1980.645) (-1977.697) [-1974.811] (-1975.086) -- 0:00:37
821000 -- (-1979.923) [-1974.800] (-1979.300) (-1977.274) * [-1973.229] (-1979.507) (-1976.190) (-1985.265) -- 0:00:37
821500 -- (-1978.648) (-1979.521) [-1974.064] (-1983.413) * (-1975.310) [-1976.116] (-1981.293) (-1983.014) -- 0:00:37
822000 -- (-1980.354) (-1976.959) [-1978.052] (-1979.053) * (-1975.687) (-1976.906) [-1973.292] (-1979.912) -- 0:00:37
822500 -- [-1975.353] (-1981.358) (-1973.873) (-1973.122) * (-1977.867) (-1976.813) [-1973.603] (-1983.074) -- 0:00:37
823000 -- (-1980.598) (-1978.458) (-1977.244) [-1974.163] * (-1973.862) (-1976.426) (-1977.455) [-1976.556] -- 0:00:37
823500 -- (-1978.945) (-1977.711) [-1976.152] (-1979.044) * (-1980.912) (-1982.658) (-1985.835) [-1975.121] -- 0:00:37
824000 -- (-1976.855) (-1980.903) (-1980.180) [-1973.715] * (-1972.713) (-1975.009) [-1974.845] (-1981.417) -- 0:00:37
824500 -- [-1976.561] (-1976.762) (-1972.493) (-1977.873) * (-1972.630) [-1972.014] (-1976.018) (-1977.910) -- 0:00:37
825000 -- (-1973.066) (-1984.546) [-1976.504] (-1972.563) * [-1973.172] (-1988.048) (-1981.356) (-1972.683) -- 0:00:36
Average standard deviation of split frequencies: 0.000000
825500 -- [-1974.227] (-1979.257) (-1977.057) (-1978.349) * (-1976.575) (-1980.745) (-1971.522) [-1974.981] -- 0:00:36
826000 -- (-1979.920) [-1971.112] (-1986.037) (-1973.964) * (-1976.412) (-1978.576) (-1974.181) [-1979.486] -- 0:00:36
826500 -- [-1977.140] (-1976.574) (-1972.823) (-1978.938) * (-1986.305) (-1974.296) (-1980.614) [-1976.827] -- 0:00:36
827000 -- [-1977.874] (-1973.671) (-1980.582) (-1974.690) * [-1977.310] (-1979.196) (-1972.489) (-1980.181) -- 0:00:36
827500 -- (-1977.451) [-1979.093] (-1980.226) (-1973.564) * (-1972.692) (-1974.424) [-1974.856] (-1976.773) -- 0:00:36
828000 -- (-1974.979) [-1977.762] (-1984.784) (-1978.469) * [-1981.624] (-1975.982) (-1981.056) (-1978.136) -- 0:00:36
828500 -- [-1977.001] (-1985.451) (-1976.409) (-1977.945) * (-1977.812) (-1975.935) [-1974.560] (-1980.738) -- 0:00:36
829000 -- [-1974.919] (-1975.766) (-1974.855) (-1981.196) * (-1982.153) (-1980.339) (-1975.617) [-1976.184] -- 0:00:36
829500 -- [-1976.480] (-1979.691) (-1975.375) (-1974.806) * (-1984.413) (-1982.940) [-1973.571] (-1974.156) -- 0:00:35
830000 -- (-1982.548) (-1984.687) [-1977.125] (-1985.988) * [-1978.600] (-1984.533) (-1975.437) (-1975.336) -- 0:00:35
Average standard deviation of split frequencies: 0.000000
830500 -- [-1979.875] (-1983.802) (-1974.323) (-1976.154) * (-1977.061) (-1982.731) [-1973.712] (-1972.767) -- 0:00:35
831000 -- [-1977.300] (-1973.678) (-1974.517) (-1974.717) * (-1988.298) [-1980.563] (-1974.330) (-1973.104) -- 0:00:35
831500 -- (-1975.969) (-1978.151) [-1978.414] (-1973.123) * (-1983.694) (-1974.507) [-1974.371] (-1982.437) -- 0:00:35
832000 -- (-1980.876) [-1974.663] (-1974.687) (-1976.106) * (-1982.402) (-1982.218) (-1980.313) [-1973.675] -- 0:00:35
832500 -- (-1979.283) (-1981.261) [-1975.640] (-1974.246) * (-1977.682) (-1976.702) [-1970.239] (-1976.260) -- 0:00:35
833000 -- [-1978.889] (-1981.172) (-1974.233) (-1974.391) * (-1981.084) (-1975.323) [-1976.927] (-1977.314) -- 0:00:35
833500 -- (-1977.493) [-1979.920] (-1977.834) (-1972.666) * (-1979.641) [-1978.052] (-1977.471) (-1978.541) -- 0:00:35
834000 -- (-1980.673) (-1981.480) [-1975.443] (-1979.648) * [-1973.968] (-1978.182) (-1973.642) (-1976.861) -- 0:00:35
834500 -- (-1979.451) [-1975.385] (-1975.786) (-1973.268) * [-1976.442] (-1982.539) (-1979.376) (-1988.110) -- 0:00:34
835000 -- (-1974.211) [-1979.565] (-1973.756) (-1978.928) * (-1973.345) (-1975.474) [-1981.091] (-1978.519) -- 0:00:34
Average standard deviation of split frequencies: 0.000000
835500 -- (-1975.282) (-1975.946) [-1974.334] (-1972.819) * [-1973.433] (-1979.298) (-1978.902) (-1976.260) -- 0:00:34
836000 -- (-1979.107) [-1973.741] (-1980.480) (-1976.559) * (-1973.737) (-1973.713) [-1973.559] (-1982.410) -- 0:00:34
836500 -- (-1979.924) (-1978.688) [-1978.879] (-1974.656) * (-1984.560) (-1981.453) (-1976.209) [-1968.082] -- 0:00:34
837000 -- (-1975.716) [-1972.880] (-1974.448) (-1974.053) * (-1975.988) (-1973.551) [-1976.074] (-1977.601) -- 0:00:34
837500 -- (-1974.804) (-1979.792) (-1973.518) [-1974.926] * (-1979.677) (-1976.490) [-1979.333] (-1972.126) -- 0:00:34
838000 -- (-1977.198) (-1977.108) (-1979.121) [-1974.331] * (-1978.614) (-1973.732) (-1975.805) [-1975.877] -- 0:00:34
838500 -- (-1972.694) (-1978.598) (-1987.806) [-1976.565] * [-1979.632] (-1972.200) (-1977.829) (-1985.173) -- 0:00:34
839000 -- (-1971.939) [-1974.454] (-1981.401) (-1973.702) * (-1979.793) (-1972.639) [-1975.754] (-1974.952) -- 0:00:33
839500 -- (-1973.881) (-1975.148) [-1975.594] (-1976.668) * (-1979.650) [-1972.783] (-1989.329) (-1975.852) -- 0:00:33
840000 -- (-1975.804) [-1974.574] (-1976.317) (-1978.336) * (-1978.942) (-1977.568) (-1977.289) [-1977.139] -- 0:00:33
Average standard deviation of split frequencies: 0.000000
840500 -- (-1975.496) (-1975.039) [-1978.360] (-1972.908) * (-1980.538) [-1974.201] (-1981.128) (-1986.012) -- 0:00:33
841000 -- [-1977.714] (-1974.256) (-1987.459) (-1974.063) * (-1975.905) [-1976.274] (-1977.426) (-1973.763) -- 0:00:33
841500 -- [-1976.361] (-1980.389) (-1983.628) (-1979.332) * [-1975.399] (-1978.507) (-1979.638) (-1973.295) -- 0:00:33
842000 -- (-1973.224) (-1977.845) (-1983.173) [-1980.341] * [-1976.576] (-1973.415) (-1977.011) (-1979.572) -- 0:00:33
842500 -- [-1980.547] (-1977.140) (-1990.362) (-1974.462) * (-1978.572) [-1973.661] (-1974.485) (-1977.115) -- 0:00:33
843000 -- (-1972.551) (-1973.495) [-1982.533] (-1980.229) * (-1979.347) (-1978.765) (-1971.093) [-1977.794] -- 0:00:33
843500 -- (-1975.243) (-1973.871) [-1977.063] (-1982.098) * [-1981.627] (-1976.266) (-1975.326) (-1976.647) -- 0:00:33
844000 -- (-1975.825) [-1982.722] (-1972.547) (-1982.253) * (-1976.154) [-1979.694] (-1983.661) (-1979.979) -- 0:00:32
844500 -- (-1982.519) (-1975.710) [-1978.103] (-1984.876) * (-1977.952) (-1981.942) [-1976.646] (-1978.937) -- 0:00:32
845000 -- (-1975.042) [-1971.120] (-1974.772) (-1983.334) * (-1977.709) [-1979.148] (-1979.572) (-1979.998) -- 0:00:32
Average standard deviation of split frequencies: 0.000000
845500 -- [-1973.349] (-1980.748) (-1977.787) (-1978.226) * (-1980.540) (-1984.052) [-1972.015] (-1974.170) -- 0:00:32
846000 -- (-1977.260) (-1982.832) [-1974.692] (-1977.627) * (-1975.755) (-1986.924) [-1972.722] (-1985.798) -- 0:00:32
846500 -- [-1971.308] (-1983.985) (-1979.221) (-1976.608) * (-1977.480) (-1978.845) [-1981.137] (-1973.545) -- 0:00:32
847000 -- [-1976.829] (-1984.943) (-1983.824) (-1975.674) * (-1976.581) (-1983.372) (-1974.464) [-1974.364] -- 0:00:32
847500 -- (-1975.388) (-1975.241) [-1976.539] (-1978.902) * (-1976.589) (-1987.399) (-1979.193) [-1972.651] -- 0:00:32
848000 -- (-1973.097) (-1975.719) [-1973.330] (-1973.899) * [-1973.369] (-1973.769) (-1979.474) (-1975.728) -- 0:00:32
848500 -- (-1975.288) (-1976.478) (-1976.411) [-1980.161] * (-1977.520) (-1976.245) [-1977.392] (-1975.252) -- 0:00:31
849000 -- (-1980.878) (-1970.868) (-1975.441) [-1982.452] * [-1974.854] (-1982.056) (-1975.976) (-1974.415) -- 0:00:31
849500 -- (-1977.193) (-1977.114) (-1975.016) [-1977.904] * (-1980.804) (-1984.391) (-1981.015) [-1972.987] -- 0:00:31
850000 -- (-1983.144) [-1971.473] (-1976.584) (-1972.299) * (-1981.167) (-1980.950) [-1971.707] (-1976.869) -- 0:00:31
Average standard deviation of split frequencies: 0.000000
850500 -- (-1977.471) (-1976.554) [-1975.640] (-1972.228) * (-1976.180) (-1976.634) (-1977.127) [-1972.948] -- 0:00:31
851000 -- (-1982.170) (-1982.613) (-1976.793) [-1974.037] * (-1980.120) (-1973.348) (-1976.811) [-1976.406] -- 0:00:31
851500 -- [-1975.967] (-1982.395) (-1991.813) (-1977.066) * (-1974.752) (-1980.381) (-1971.634) [-1974.846] -- 0:00:31
852000 -- (-1974.753) (-1974.068) (-1981.083) [-1983.965] * (-1972.540) [-1972.386] (-1977.104) (-1977.767) -- 0:00:31
852500 -- (-1977.860) (-1979.975) (-1976.720) [-1983.084] * (-1978.580) (-1974.036) (-1975.667) [-1970.811] -- 0:00:31
853000 -- (-1976.585) (-1982.128) [-1975.449] (-1979.200) * [-1972.595] (-1980.931) (-1974.979) (-1981.058) -- 0:00:31
853500 -- (-1980.510) (-1971.894) [-1976.857] (-1981.800) * (-1973.317) (-1973.354) (-1982.361) [-1977.461] -- 0:00:30
854000 -- [-1978.568] (-1981.910) (-1979.996) (-1975.879) * (-1971.662) [-1974.095] (-1987.183) (-1985.012) -- 0:00:30
854500 -- (-1972.873) (-1982.895) [-1982.360] (-1981.983) * (-1973.747) (-1972.538) [-1979.467] (-1978.391) -- 0:00:30
855000 -- [-1978.516] (-1977.875) (-1977.916) (-1978.245) * (-1973.527) [-1975.690] (-1976.647) (-1978.346) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
855500 -- (-1975.677) [-1978.250] (-1981.336) (-1981.718) * (-1978.811) [-1981.083] (-1980.654) (-1979.458) -- 0:00:30
856000 -- (-1982.061) (-1985.682) [-1977.151] (-1977.280) * [-1974.392] (-1973.317) (-1976.940) (-1978.872) -- 0:00:30
856500 -- (-1977.232) (-1978.508) [-1977.316] (-1977.472) * (-1983.793) (-1979.474) (-1974.035) [-1975.463] -- 0:00:30
857000 -- (-1976.684) [-1977.042] (-1977.933) (-1980.504) * (-1974.903) (-1980.554) (-1976.378) [-1974.835] -- 0:00:30
857500 -- (-1974.487) (-1974.314) (-1974.705) [-1977.248] * (-1978.762) [-1972.668] (-1981.939) (-1978.364) -- 0:00:30
858000 -- (-1976.121) (-1985.339) (-1979.036) [-1973.058] * (-1980.847) (-1972.788) (-1975.409) [-1974.345] -- 0:00:29
858500 -- (-1971.766) [-1979.320] (-1977.261) (-1980.930) * (-1977.550) [-1970.383] (-1979.819) (-1975.725) -- 0:00:29
859000 -- (-1976.583) [-1974.506] (-1971.334) (-1973.353) * [-1978.249] (-1976.061) (-1974.366) (-1974.791) -- 0:00:29
859500 -- (-1975.937) (-1975.762) [-1974.456] (-1977.212) * (-1977.690) [-1974.178] (-1976.425) (-1977.464) -- 0:00:29
860000 -- (-1982.569) (-1978.802) [-1974.091] (-1969.598) * (-1979.260) [-1972.146] (-1984.938) (-1974.833) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
860500 -- [-1974.512] (-1975.521) (-1975.871) (-1973.876) * [-1975.779] (-1978.866) (-1974.819) (-1980.377) -- 0:00:29
861000 -- (-1971.330) (-1971.154) [-1977.050] (-1981.623) * (-1981.677) [-1977.609] (-1976.037) (-1974.559) -- 0:00:29
861500 -- (-1975.442) (-1981.477) (-1975.290) [-1976.590] * (-1972.876) (-1978.194) (-1974.333) [-1973.853] -- 0:00:29
862000 -- (-1972.946) (-1988.358) (-1976.854) [-1978.911] * [-1972.719] (-1983.737) (-1976.464) (-1979.208) -- 0:00:29
862500 -- (-1973.704) (-1982.505) (-1975.192) [-1976.112] * (-1978.802) (-1977.072) (-1973.377) [-1977.564] -- 0:00:29
863000 -- [-1977.267] (-1979.468) (-1977.518) (-1974.220) * [-1977.525] (-1982.059) (-1976.733) (-1975.923) -- 0:00:28
863500 -- (-1977.749) (-1985.929) (-1975.886) [-1975.757] * (-1982.633) [-1979.068] (-1980.435) (-1986.854) -- 0:00:28
864000 -- (-1979.885) [-1974.365] (-1980.077) (-1979.499) * [-1971.951] (-1984.848) (-1977.448) (-1974.006) -- 0:00:28
864500 -- (-1981.091) (-1985.893) [-1977.799] (-1973.418) * [-1973.495] (-1981.019) (-1978.208) (-1975.066) -- 0:00:28
865000 -- (-1976.018) (-1975.713) [-1975.055] (-1983.630) * (-1977.210) (-1969.468) (-1977.139) [-1973.770] -- 0:00:28
Average standard deviation of split frequencies: 0.000000
865500 -- [-1976.276] (-1976.565) (-1981.264) (-1977.959) * (-1985.083) [-1977.183] (-1985.824) (-1975.071) -- 0:00:28
866000 -- (-1982.438) (-1975.915) [-1974.301] (-1975.719) * [-1976.131] (-1978.500) (-1979.187) (-1977.654) -- 0:00:28
866500 -- (-1977.945) (-1979.504) (-1975.064) [-1978.072] * (-1980.782) (-1976.568) [-1981.460] (-1976.905) -- 0:00:28
867000 -- (-1979.385) (-1977.012) (-1981.181) [-1977.665] * (-1977.957) [-1974.903] (-1983.937) (-1974.053) -- 0:00:28
867500 -- (-1979.255) (-1975.336) [-1980.503] (-1979.385) * [-1976.218] (-1972.527) (-1974.732) (-1979.002) -- 0:00:27
868000 -- (-1976.887) (-1980.477) [-1986.109] (-1978.218) * [-1976.973] (-1973.361) (-1980.226) (-1983.439) -- 0:00:27
868500 -- (-1978.189) (-1981.510) [-1974.065] (-1976.801) * (-1975.442) [-1976.226] (-1977.185) (-1978.350) -- 0:00:27
869000 -- (-1977.520) (-1981.680) [-1973.669] (-1976.688) * [-1971.455] (-1978.115) (-1975.067) (-1981.708) -- 0:00:27
869500 -- (-1973.539) [-1976.048] (-1981.825) (-1976.063) * [-1976.051] (-1976.453) (-1972.257) (-1977.198) -- 0:00:27
870000 -- (-1972.437) (-1977.493) (-1980.637) [-1975.208] * (-1971.849) [-1974.633] (-1975.334) (-1976.195) -- 0:00:27
Average standard deviation of split frequencies: 0.000000
870500 -- (-1979.386) (-1974.999) [-1972.768] (-1972.753) * [-1976.468] (-1976.648) (-1977.341) (-1974.897) -- 0:00:27
871000 -- (-1973.940) (-1974.984) [-1972.221] (-1975.195) * [-1975.129] (-1981.398) (-1977.955) (-1981.672) -- 0:00:27
871500 -- [-1980.332] (-1977.653) (-1980.318) (-1972.451) * (-1975.106) (-1976.548) [-1980.634] (-1981.835) -- 0:00:27
872000 -- (-1978.842) (-1975.862) (-1974.292) [-1981.332] * (-1992.416) (-1981.788) [-1978.981] (-1980.056) -- 0:00:27
872500 -- (-1974.152) [-1971.717] (-1974.729) (-1977.491) * [-1978.634] (-1979.227) (-1971.889) (-1978.768) -- 0:00:26
873000 -- [-1976.392] (-1979.636) (-1978.411) (-1981.452) * (-1980.854) [-1975.011] (-1972.451) (-1980.660) -- 0:00:26
873500 -- (-1980.589) [-1978.340] (-1979.556) (-1977.111) * [-1982.492] (-1977.723) (-1981.211) (-1985.315) -- 0:00:26
874000 -- (-1976.382) (-1972.764) [-1974.840] (-1980.588) * (-1984.457) (-1974.713) (-1977.830) [-1971.135] -- 0:00:26
874500 -- (-1975.275) (-1981.577) [-1976.210] (-1976.655) * (-1971.485) [-1973.824] (-1980.462) (-1972.838) -- 0:00:26
875000 -- [-1975.495] (-1980.078) (-1981.364) (-1980.165) * (-1976.838) (-1975.652) [-1974.726] (-1974.246) -- 0:00:26
Average standard deviation of split frequencies: 0.000000
875500 -- (-1977.318) (-1981.863) (-1976.117) [-1984.068] * (-1972.330) [-1971.303] (-1977.953) (-1975.080) -- 0:00:26
876000 -- (-1979.241) (-1979.188) [-1977.860] (-1985.694) * (-1982.582) (-1979.952) [-1979.164] (-1975.057) -- 0:00:26
876500 -- (-1974.023) (-1979.349) (-1977.419) [-1980.930] * [-1978.931] (-1976.889) (-1987.963) (-1976.304) -- 0:00:26
877000 -- [-1974.746] (-1975.859) (-1978.086) (-1975.648) * [-1976.125] (-1979.045) (-1982.514) (-1976.673) -- 0:00:25
877500 -- (-1975.966) (-1976.006) (-1982.090) [-1971.650] * (-1975.162) [-1973.017] (-1983.827) (-1977.145) -- 0:00:25
878000 -- (-1975.405) [-1978.090] (-1974.192) (-1977.213) * (-1972.999) [-1972.003] (-1981.790) (-1978.861) -- 0:00:25
878500 -- [-1973.199] (-1980.001) (-1977.602) (-1978.756) * [-1974.790] (-1974.023) (-1982.745) (-1975.914) -- 0:00:25
879000 -- [-1977.209] (-1975.935) (-1975.843) (-1981.774) * (-1976.396) (-1973.715) (-1976.279) [-1974.055] -- 0:00:25
879500 -- (-1974.462) [-1974.066] (-1975.572) (-1979.527) * [-1972.933] (-1972.413) (-1979.496) (-1973.984) -- 0:00:25
880000 -- (-1979.493) [-1976.153] (-1979.285) (-1978.211) * [-1975.575] (-1972.610) (-1976.669) (-1977.591) -- 0:00:25
Average standard deviation of split frequencies: 0.000000
880500 -- [-1977.158] (-1980.654) (-1978.528) (-1973.529) * (-1987.666) (-1978.061) [-1973.188] (-1976.272) -- 0:00:25
881000 -- (-1976.952) [-1975.930] (-1976.093) (-1973.170) * (-1979.180) [-1973.531] (-1976.536) (-1981.957) -- 0:00:25
881500 -- (-1974.989) (-1979.564) (-1979.370) [-1976.307] * (-1975.325) (-1979.447) (-1984.273) [-1972.672] -- 0:00:25
882000 -- (-1975.272) (-1974.195) (-1977.072) [-1974.758] * [-1969.653] (-1974.222) (-1990.116) (-1973.458) -- 0:00:24
882500 -- [-1974.532] (-1972.904) (-1980.617) (-1972.725) * (-1982.004) (-1975.664) (-1982.833) [-1972.909] -- 0:00:24
883000 -- (-1977.529) (-1979.275) (-1979.939) [-1971.556] * (-1982.476) (-1976.478) (-1980.948) [-1971.810] -- 0:00:24
883500 -- [-1978.679] (-1986.929) (-1983.615) (-1975.004) * [-1974.295] (-1972.887) (-1973.128) (-1973.213) -- 0:00:24
884000 -- (-1980.714) (-1973.387) [-1980.976] (-1976.447) * (-1976.579) (-1969.264) (-1980.650) [-1971.254] -- 0:00:24
884500 -- (-1980.191) [-1979.624] (-1981.646) (-1982.230) * (-1977.623) (-1975.617) [-1983.062] (-1971.501) -- 0:00:24
885000 -- (-1977.471) [-1974.105] (-1977.182) (-1976.803) * (-1981.008) (-1982.580) [-1978.671] (-1970.114) -- 0:00:24
Average standard deviation of split frequencies: 0.000000
885500 -- (-1977.997) (-1973.194) [-1976.649] (-1979.021) * [-1973.225] (-1978.610) (-1979.413) (-1974.040) -- 0:00:24
886000 -- [-1976.269] (-1982.296) (-1979.035) (-1982.706) * [-1972.564] (-1972.788) (-1973.292) (-1971.825) -- 0:00:24
886500 -- (-1973.167) (-1972.754) (-1973.794) [-1975.732] * [-1973.010] (-1976.115) (-1980.287) (-1976.171) -- 0:00:23
887000 -- (-1973.250) (-1974.498) (-1978.563) [-1979.436] * (-1972.310) [-1974.113] (-1977.883) (-1976.282) -- 0:00:23
887500 -- (-1976.255) (-1987.854) (-1978.368) [-1974.653] * (-1974.507) (-1979.702) (-1984.746) [-1975.424] -- 0:00:23
888000 -- (-1974.612) (-1974.657) [-1975.450] (-1978.268) * (-1979.992) [-1975.737] (-1984.644) (-1976.301) -- 0:00:23
888500 -- [-1973.002] (-1978.894) (-1975.352) (-1974.768) * (-1975.145) (-1976.160) [-1973.869] (-1980.870) -- 0:00:23
889000 -- [-1977.226] (-1981.692) (-1975.692) (-1975.890) * (-1980.184) (-1975.008) [-1972.351] (-1976.020) -- 0:00:23
889500 -- [-1973.235] (-1980.363) (-1983.029) (-1974.154) * (-1976.168) (-1977.641) [-1971.687] (-1979.953) -- 0:00:23
890000 -- (-1975.288) (-1973.320) [-1974.281] (-1971.971) * [-1975.249] (-1979.491) (-1976.831) (-1978.324) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
890500 -- (-1982.253) [-1971.926] (-1977.728) (-1975.498) * (-1977.737) (-1982.283) (-1978.596) [-1978.587] -- 0:00:23
891000 -- (-1985.069) (-1975.862) [-1978.112] (-1974.786) * [-1974.081] (-1976.260) (-1986.236) (-1982.506) -- 0:00:22
891500 -- [-1978.787] (-1977.058) (-1972.216) (-1981.568) * (-1977.057) (-1973.725) (-1978.184) [-1976.483] -- 0:00:22
892000 -- (-1982.119) (-1972.893) [-1976.943] (-1982.389) * (-1974.577) (-1971.744) (-1975.228) [-1976.554] -- 0:00:22
892500 -- (-1980.642) [-1973.708] (-1974.612) (-1980.140) * [-1978.552] (-1975.671) (-1975.363) (-1979.875) -- 0:00:22
893000 -- [-1978.531] (-1980.021) (-1979.940) (-1974.330) * (-1978.526) (-1980.999) (-1978.283) [-1974.619] -- 0:00:22
893500 -- (-1980.190) (-1977.240) [-1977.206] (-1976.421) * (-1978.439) (-1979.999) [-1971.641] (-1980.405) -- 0:00:22
894000 -- (-1976.683) (-1977.607) [-1974.473] (-1973.996) * (-1976.075) (-1980.951) (-1972.707) [-1971.761] -- 0:00:22
894500 -- (-1976.886) [-1977.765] (-1972.694) (-1977.560) * (-1990.172) (-1976.665) [-1976.996] (-1976.514) -- 0:00:22
895000 -- (-1974.203) (-1977.246) (-1975.098) [-1975.529] * (-1981.184) [-1979.546] (-1976.101) (-1972.049) -- 0:00:22
Average standard deviation of split frequencies: 0.000000
895500 -- [-1981.347] (-1975.858) (-1981.636) (-1978.398) * (-1987.780) (-1977.486) [-1973.592] (-1974.020) -- 0:00:22
896000 -- [-1980.975] (-1979.654) (-1981.123) (-1978.431) * (-1981.179) [-1983.832] (-1980.281) (-1974.965) -- 0:00:21
896500 -- (-1977.995) (-1977.069) [-1982.330] (-1975.606) * (-1975.469) (-1975.571) [-1980.463] (-1981.443) -- 0:00:21
897000 -- (-1975.365) [-1977.974] (-1982.248) (-1975.154) * (-1985.652) (-1974.046) (-1975.244) [-1976.987] -- 0:00:21
897500 -- (-1980.965) (-1978.633) (-1978.576) [-1974.686] * (-1974.893) (-1982.973) (-1975.108) [-1973.140] -- 0:00:21
898000 -- (-1975.654) (-1984.720) [-1978.882] (-1976.953) * (-1975.718) (-1976.531) (-1979.713) [-1975.598] -- 0:00:21
898500 -- (-1980.555) [-1979.653] (-1972.177) (-1974.547) * (-1976.121) (-1971.156) [-1976.289] (-1976.802) -- 0:00:21
899000 -- (-1972.347) [-1975.992] (-1976.296) (-1976.243) * (-1978.059) (-1979.697) (-1971.060) [-1974.850] -- 0:00:21
899500 -- [-1976.229] (-1977.363) (-1978.875) (-1971.612) * (-1976.825) [-1971.937] (-1977.434) (-1971.743) -- 0:00:21
900000 -- (-1975.414) (-1979.313) (-1985.189) [-1978.971] * (-1977.047) [-1975.988] (-1976.979) (-1976.723) -- 0:00:21
Average standard deviation of split frequencies: 0.000000
900500 -- (-1975.407) [-1978.034] (-1979.837) (-1972.917) * (-1977.195) [-1976.755] (-1979.976) (-1974.552) -- 0:00:20
901000 -- (-1976.921) [-1979.715] (-1975.839) (-1982.253) * (-1980.522) [-1973.469] (-1979.449) (-1974.425) -- 0:00:20
901500 -- (-1979.962) (-1979.704) [-1982.833] (-1984.032) * [-1972.250] (-1971.980) (-1976.295) (-1978.469) -- 0:00:20
902000 -- (-1980.919) (-1983.251) (-1982.773) [-1976.083] * (-1979.069) (-1972.735) [-1973.957] (-1977.736) -- 0:00:20
902500 -- (-1975.024) [-1976.140] (-1982.552) (-1975.250) * (-1973.704) (-1972.181) (-1971.297) [-1971.624] -- 0:00:20
903000 -- (-1971.913) (-1980.250) (-1978.797) [-1976.968] * (-1977.932) (-1977.462) [-1983.886] (-1974.788) -- 0:00:20
903500 -- (-1972.990) (-1971.721) (-1981.595) [-1979.431] * [-1976.753] (-1978.582) (-1975.096) (-1974.575) -- 0:00:20
904000 -- [-1973.185] (-1974.180) (-1976.888) (-1981.986) * (-1978.675) [-1979.495] (-1975.707) (-1973.462) -- 0:00:20
904500 -- (-1978.838) (-1976.103) [-1977.416] (-1976.324) * (-1980.786) (-1975.779) [-1971.989] (-1974.257) -- 0:00:20
905000 -- [-1979.655] (-1972.903) (-1982.183) (-1976.536) * [-1976.038] (-1977.614) (-1974.330) (-1982.926) -- 0:00:20
Average standard deviation of split frequencies: 0.000000
905500 -- (-1972.761) (-1974.263) (-1977.138) [-1978.296] * (-1976.662) (-1979.533) [-1978.755] (-1978.303) -- 0:00:19
906000 -- (-1973.633) [-1976.276] (-1974.051) (-1975.303) * (-1977.645) [-1972.389] (-1975.319) (-1976.331) -- 0:00:19
906500 -- (-1978.682) (-1971.206) (-1975.712) [-1974.354] * [-1974.637] (-1972.467) (-1976.011) (-1973.573) -- 0:00:19
907000 -- (-1981.286) (-1974.147) [-1971.776] (-1970.232) * (-1974.577) [-1976.205] (-1981.110) (-1975.298) -- 0:00:19
907500 -- [-1974.448] (-1978.361) (-1980.575) (-1977.857) * (-1980.659) (-1975.402) (-1973.309) [-1975.728] -- 0:00:19
908000 -- (-1979.810) (-1982.993) (-1981.559) [-1975.508] * (-1975.077) [-1975.340] (-1977.309) (-1978.904) -- 0:00:19
908500 -- (-1981.611) (-1977.136) (-1973.034) [-1975.939] * (-1972.753) (-1977.297) [-1974.386] (-1979.275) -- 0:00:19
909000 -- (-1977.943) (-1988.409) [-1972.972] (-1976.741) * (-1976.830) (-1983.441) [-1973.611] (-1976.795) -- 0:00:19
909500 -- (-1986.335) (-1983.419) [-1976.008] (-1980.623) * (-1972.538) (-1979.285) [-1977.199] (-1976.169) -- 0:00:19
910000 -- (-1978.184) [-1982.203] (-1980.563) (-1985.539) * (-1978.274) (-1977.170) (-1975.400) [-1972.728] -- 0:00:18
Average standard deviation of split frequencies: 0.000000
910500 -- (-1978.851) (-1982.035) (-1978.020) [-1976.245] * (-1972.640) (-1974.663) (-1980.517) [-1979.172] -- 0:00:18
911000 -- (-1979.302) (-1978.818) (-1972.043) [-1974.565] * [-1977.053] (-1973.341) (-1979.603) (-1978.504) -- 0:00:18
911500 -- [-1972.686] (-1977.465) (-1976.726) (-1981.351) * (-1978.139) (-1974.406) (-1980.649) [-1978.951] -- 0:00:18
912000 -- [-1974.319] (-1980.080) (-1972.758) (-1978.965) * (-1976.083) [-1971.158] (-1976.426) (-1979.176) -- 0:00:18
912500 -- (-1971.625) (-1976.594) (-1978.396) [-1973.119] * (-1973.763) (-1973.346) [-1976.418] (-1978.564) -- 0:00:18
913000 -- [-1975.307] (-1984.174) (-1979.458) (-1975.308) * (-1974.615) (-1973.897) (-1987.241) [-1972.464] -- 0:00:18
913500 -- (-1972.402) (-1982.676) (-1973.847) [-1974.707] * (-1974.236) (-1974.311) [-1971.525] (-1970.654) -- 0:00:18
914000 -- (-1982.890) (-1977.241) (-1978.082) [-1976.699] * (-1973.114) [-1978.958] (-1978.653) (-1976.814) -- 0:00:18
914500 -- (-1975.127) (-1975.159) (-1978.790) [-1972.949] * [-1978.123] (-1978.411) (-1980.451) (-1977.108) -- 0:00:18
915000 -- (-1982.982) (-1973.962) (-1979.914) [-1983.095] * (-1972.677) (-1972.570) (-1977.528) [-1972.888] -- 0:00:17
Average standard deviation of split frequencies: 0.000000
915500 -- (-1978.604) (-1974.651) (-1973.797) [-1976.779] * (-1975.759) (-1981.016) (-1979.398) [-1974.148] -- 0:00:17
916000 -- (-1984.177) [-1975.992] (-1985.886) (-1979.090) * (-1980.203) (-1974.078) (-1979.023) [-1982.857] -- 0:00:17
916500 -- [-1977.298] (-1977.394) (-1977.284) (-1981.098) * [-1975.836] (-1982.000) (-1990.604) (-1973.609) -- 0:00:17
917000 -- [-1977.386] (-1972.004) (-1985.724) (-1980.137) * (-1973.299) (-1980.225) (-1985.906) [-1973.788] -- 0:00:17
917500 -- [-1975.512] (-1976.737) (-1979.079) (-1976.715) * (-1979.798) (-1979.521) (-1978.036) [-1972.837] -- 0:00:17
918000 -- [-1979.470] (-1980.474) (-1981.130) (-1974.430) * [-1976.494] (-1979.940) (-1984.084) (-1979.714) -- 0:00:17
918500 -- (-1982.645) (-1972.694) (-1981.608) [-1976.474] * (-1979.119) (-1980.725) [-1980.118] (-1981.451) -- 0:00:17
919000 -- (-1978.875) [-1972.646] (-1976.067) (-1976.317) * (-1974.044) [-1970.249] (-1982.338) (-1980.209) -- 0:00:17
919500 -- [-1980.813] (-1983.609) (-1983.043) (-1977.777) * (-1982.518) (-1978.844) [-1982.015] (-1974.096) -- 0:00:16
920000 -- (-1984.195) (-1978.744) (-1987.596) [-1976.486] * (-1978.539) [-1982.123] (-1978.772) (-1974.483) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
920500 -- (-1975.313) (-1988.388) (-1980.158) [-1974.358] * (-1979.499) (-1979.204) (-1983.986) [-1978.035] -- 0:00:16
921000 -- (-1979.147) (-1983.643) (-1974.486) [-1975.819] * (-1975.426) (-1978.407) (-1979.382) [-1976.866] -- 0:00:16
921500 -- (-1984.112) (-1984.518) (-1984.819) [-1976.814] * (-1983.483) (-1978.670) (-1971.423) [-1974.103] -- 0:00:16
922000 -- (-1978.838) [-1978.100] (-1982.631) (-1991.678) * (-1974.723) (-1972.406) (-1977.365) [-1978.182] -- 0:00:16
922500 -- (-1972.084) (-1978.695) (-1975.761) [-1979.594] * [-1974.253] (-1970.510) (-1973.272) (-1973.271) -- 0:00:16
923000 -- (-1973.497) (-1970.780) [-1975.139] (-1979.900) * (-1972.964) (-1978.404) [-1975.864] (-1974.574) -- 0:00:16
923500 -- (-1977.249) (-1970.374) [-1974.057] (-1983.925) * [-1977.571] (-1973.400) (-1974.423) (-1981.342) -- 0:00:16
924000 -- (-1978.383) [-1972.978] (-1981.700) (-1974.561) * [-1972.822] (-1977.624) (-1973.761) (-1978.832) -- 0:00:16
924500 -- (-1983.851) [-1970.968] (-1976.380) (-1985.435) * (-1976.031) [-1985.544] (-1982.115) (-1977.481) -- 0:00:15
925000 -- (-1972.942) (-1975.557) [-1975.077] (-1976.857) * (-1979.146) (-1981.527) (-1974.370) [-1972.597] -- 0:00:15
Average standard deviation of split frequencies: 0.000000
925500 -- (-1976.445) (-1975.299) [-1973.467] (-1982.427) * (-1977.165) (-1982.254) (-1973.537) [-1980.135] -- 0:00:15
926000 -- (-1977.526) [-1979.591] (-1973.616) (-1976.971) * [-1976.938] (-1989.281) (-1976.785) (-1971.908) -- 0:00:15
926500 -- (-1982.289) (-1973.854) [-1975.588] (-1978.338) * (-1979.394) (-1981.372) (-1975.040) [-1982.528] -- 0:00:15
927000 -- [-1973.540] (-1975.309) (-1978.265) (-1995.683) * [-1981.710] (-1976.465) (-1974.634) (-1975.171) -- 0:00:15
927500 -- (-1974.967) (-1976.625) [-1976.952] (-1974.192) * [-1977.927] (-1976.962) (-1975.143) (-1975.415) -- 0:00:15
928000 -- (-1983.517) (-1982.788) (-1978.349) [-1971.996] * (-1978.917) [-1977.896] (-1979.046) (-1978.259) -- 0:00:15
928500 -- [-1976.315] (-1972.032) (-1970.467) (-1976.734) * [-1973.063] (-1974.778) (-1976.460) (-1975.097) -- 0:00:15
929000 -- [-1974.609] (-1983.165) (-1979.319) (-1976.404) * (-1985.495) (-1977.302) (-1977.921) [-1981.636] -- 0:00:14
929500 -- (-1978.353) (-1974.249) (-1979.513) [-1976.315] * (-1979.611) (-1975.620) [-1970.917] (-1980.450) -- 0:00:14
930000 -- [-1978.657] (-1979.509) (-1983.553) (-1980.076) * (-1972.093) (-1978.788) [-1976.425] (-1984.966) -- 0:00:14
Average standard deviation of split frequencies: 0.000000
930500 -- (-1971.005) (-1982.121) (-1983.766) [-1977.734] * (-1976.968) (-1979.525) [-1973.913] (-1981.014) -- 0:00:14
931000 -- (-1972.447) (-1986.576) [-1977.395] (-1976.118) * (-1982.980) (-1973.771) [-1976.173] (-1972.684) -- 0:00:14
931500 -- (-1971.507) (-1973.529) [-1977.085] (-1975.001) * (-1982.728) [-1978.894] (-1974.902) (-1974.733) -- 0:00:14
932000 -- (-1971.742) (-1984.511) [-1973.090] (-1977.619) * (-1983.454) (-1978.164) (-1978.437) [-1975.317] -- 0:00:14
932500 -- (-1971.621) [-1972.248] (-1977.741) (-1978.597) * (-1985.660) (-1977.762) (-1980.623) [-1974.943] -- 0:00:14
933000 -- [-1979.276] (-1978.167) (-1979.103) (-1977.270) * (-1982.100) [-1982.143] (-1975.547) (-1978.019) -- 0:00:14
933500 -- [-1976.425] (-1975.420) (-1978.789) (-1979.270) * [-1975.301] (-1977.632) (-1977.082) (-1971.196) -- 0:00:14
934000 -- (-1981.876) [-1972.138] (-1976.209) (-1976.120) * [-1971.624] (-1984.231) (-1973.467) (-1972.666) -- 0:00:13
934500 -- (-1978.881) (-1977.434) (-1981.684) [-1984.059] * (-1976.692) (-1977.313) [-1980.848] (-1976.827) -- 0:00:13
935000 -- (-1979.666) (-1977.390) [-1980.327] (-1982.108) * [-1976.522] (-1979.775) (-1974.807) (-1975.036) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
935500 -- [-1981.306] (-1977.121) (-1978.785) (-1985.592) * (-1978.165) (-1980.743) [-1978.159] (-1982.447) -- 0:00:13
936000 -- [-1976.429] (-1976.245) (-1975.996) (-1975.608) * [-1979.799] (-1976.236) (-1977.275) (-1975.635) -- 0:00:13
936500 -- (-1972.657) (-1975.442) (-1973.590) [-1976.683] * (-1977.518) (-1979.942) (-1980.754) [-1978.293] -- 0:00:13
937000 -- (-1972.073) (-1978.944) [-1972.477] (-1974.033) * (-1983.788) (-1974.485) (-1987.821) [-1976.852] -- 0:00:13
937500 -- [-1973.114] (-1973.365) (-1977.659) (-1983.813) * (-1974.330) (-1975.332) [-1978.330] (-1972.714) -- 0:00:13
938000 -- (-1973.739) (-1981.075) [-1975.696] (-1985.128) * (-1979.426) [-1979.700] (-1981.132) (-1979.130) -- 0:00:13
938500 -- [-1977.280] (-1975.347) (-1979.239) (-1975.723) * (-1974.009) (-1975.663) (-1980.770) [-1974.337] -- 0:00:12
939000 -- [-1973.443] (-1971.758) (-1985.647) (-1982.011) * (-1969.744) (-1978.582) (-1979.118) [-1971.408] -- 0:00:12
939500 -- (-1980.260) [-1975.368] (-1974.774) (-1978.440) * (-1975.030) [-1982.176] (-1972.890) (-1975.352) -- 0:00:12
940000 -- (-1977.634) (-1983.448) [-1976.661] (-1982.770) * (-1973.048) (-1976.023) (-1977.415) [-1985.393] -- 0:00:12
Average standard deviation of split frequencies: 0.000000
940500 -- (-1983.811) (-1978.704) [-1978.048] (-1981.209) * [-1971.631] (-1979.460) (-1974.398) (-1977.183) -- 0:00:12
941000 -- (-1983.101) [-1973.592] (-1984.093) (-1976.941) * (-1974.738) [-1975.264] (-1975.449) (-1975.609) -- 0:00:12
941500 -- (-1977.753) [-1975.144] (-1974.202) (-1975.305) * (-1982.260) [-1971.396] (-1980.473) (-1978.557) -- 0:00:12
942000 -- [-1973.951] (-1977.315) (-1974.931) (-1981.952) * (-1974.482) [-1973.019] (-1974.264) (-1982.154) -- 0:00:12
942500 -- [-1977.160] (-1978.526) (-1976.907) (-1981.558) * (-1977.763) (-1973.272) (-1975.262) [-1974.051] -- 0:00:12
943000 -- (-1978.655) (-1975.619) (-1972.862) [-1980.129] * (-1987.826) (-1979.729) (-1983.410) [-1972.826] -- 0:00:12
943500 -- [-1976.018] (-1976.488) (-1980.912) (-1983.451) * (-1978.865) (-1972.591) (-1980.020) [-1972.325] -- 0:00:11
944000 -- (-1979.097) (-1970.970) (-1978.180) [-1975.635] * [-1978.162] (-1977.815) (-1977.140) (-1974.316) -- 0:00:11
944500 -- (-1974.053) [-1973.307] (-1978.615) (-1975.965) * (-1976.604) (-1976.835) (-1974.912) [-1972.854] -- 0:00:11
945000 -- (-1976.950) (-1983.383) [-1982.404] (-1978.129) * (-1982.876) [-1971.591] (-1979.901) (-1977.603) -- 0:00:11
Average standard deviation of split frequencies: 0.000000
945500 -- (-1974.943) (-1980.717) [-1974.696] (-1979.127) * [-1976.943] (-1974.250) (-1974.880) (-1979.393) -- 0:00:11
946000 -- [-1974.109] (-1974.994) (-1982.362) (-1976.570) * (-1976.006) [-1978.431] (-1977.254) (-1978.694) -- 0:00:11
946500 -- (-1980.127) [-1970.523] (-1975.604) (-1972.779) * (-1974.018) (-1977.688) [-1971.947] (-1978.758) -- 0:00:11
947000 -- (-1977.784) (-1975.821) [-1974.468] (-1974.491) * (-1984.919) (-1978.639) (-1974.004) [-1974.501] -- 0:00:11
947500 -- (-1978.604) (-1975.098) (-1973.966) [-1975.764] * (-1979.834) [-1973.108] (-1975.134) (-1975.648) -- 0:00:11
948000 -- (-1984.134) (-1971.253) [-1974.221] (-1975.899) * (-1975.230) (-1982.980) (-1976.941) [-1973.940] -- 0:00:10
948500 -- (-1973.786) (-1972.747) [-1974.743] (-1974.344) * (-1977.161) (-1978.547) (-1978.700) [-1973.792] -- 0:00:10
949000 -- (-1980.163) (-1973.717) [-1973.329] (-1985.786) * [-1977.831] (-1980.530) (-1974.113) (-1975.143) -- 0:00:10
949500 -- (-1976.912) (-1973.873) [-1972.435] (-1978.280) * (-1978.526) [-1971.767] (-1976.706) (-1982.685) -- 0:00:10
950000 -- [-1977.387] (-1979.144) (-1974.598) (-1976.939) * (-1973.772) (-1974.473) [-1982.738] (-1984.697) -- 0:00:10
Average standard deviation of split frequencies: 0.000000
950500 -- (-1978.942) (-1981.110) (-1976.329) [-1973.650] * (-1978.582) (-1975.050) [-1981.536] (-1980.578) -- 0:00:10
951000 -- [-1978.424] (-1972.657) (-1978.263) (-1979.788) * (-1976.074) [-1973.029] (-1979.424) (-1970.626) -- 0:00:10
951500 -- [-1978.230] (-1976.099) (-1975.850) (-1974.329) * (-1979.079) (-1975.698) [-1976.237] (-1971.536) -- 0:00:10
952000 -- (-1984.010) [-1979.177] (-1977.652) (-1979.069) * (-1982.631) (-1972.247) [-1973.866] (-1975.454) -- 0:00:10
952500 -- (-1975.234) (-1977.921) (-1973.917) [-1978.485] * (-1976.804) [-1977.463] (-1977.359) (-1983.171) -- 0:00:10
953000 -- (-1978.100) [-1971.015] (-1979.608) (-1985.472) * (-1977.541) [-1974.957] (-1978.132) (-1970.995) -- 0:00:09
953500 -- [-1979.264] (-1977.953) (-1977.551) (-1979.198) * (-1979.884) (-1980.841) (-1979.928) [-1975.618] -- 0:00:09
954000 -- (-1971.477) (-1979.927) (-1975.641) [-1972.223] * (-1977.647) (-1976.848) (-1977.217) [-1974.396] -- 0:00:09
954500 -- (-1980.117) (-1979.182) [-1971.469] (-1980.059) * (-1979.832) (-1978.549) [-1973.660] (-1972.334) -- 0:00:09
955000 -- [-1977.348] (-1970.671) (-1972.003) (-1979.745) * [-1976.505] (-1975.627) (-1979.804) (-1977.549) -- 0:00:09
Average standard deviation of split frequencies: 0.000000
955500 -- (-1980.898) (-1973.086) (-1979.193) [-1975.919] * (-1975.136) [-1972.817] (-1982.544) (-1969.980) -- 0:00:09
956000 -- (-1982.934) (-1979.323) [-1980.734] (-1975.773) * (-1976.449) (-1973.874) (-1972.084) [-1973.004] -- 0:00:09
956500 -- (-1976.062) (-1974.052) [-1976.168] (-1979.021) * (-1976.703) (-1972.456) (-1978.242) [-1975.019] -- 0:00:09
957000 -- (-1982.850) (-1978.439) [-1976.135] (-1977.759) * [-1972.658] (-1977.321) (-1979.971) (-1980.414) -- 0:00:09
957500 -- (-1971.298) (-1979.854) [-1972.633] (-1975.928) * (-1978.099) (-1977.490) [-1979.323] (-1986.478) -- 0:00:08
958000 -- (-1977.341) (-1974.968) [-1975.951] (-1975.442) * [-1980.119] (-1973.374) (-1976.185) (-1978.298) -- 0:00:08
958500 -- (-1975.941) [-1988.221] (-1973.505) (-1975.795) * (-1974.260) [-1971.709] (-1976.756) (-1977.872) -- 0:00:08
959000 -- (-1980.360) (-1981.226) (-1976.739) [-1974.984] * (-1979.231) [-1974.683] (-1978.805) (-1975.940) -- 0:00:08
959500 -- (-1976.440) (-1976.806) [-1979.478] (-1975.884) * (-1981.127) (-1981.202) [-1978.167] (-1974.159) -- 0:00:08
960000 -- [-1975.127] (-1981.067) (-1976.950) (-1972.548) * [-1978.396] (-1977.745) (-1976.480) (-1975.628) -- 0:00:08
Average standard deviation of split frequencies: 0.000000
960500 -- (-1975.479) [-1975.958] (-1974.668) (-1977.662) * (-1978.262) (-1971.021) [-1972.773] (-1980.691) -- 0:00:08
961000 -- (-1981.223) (-1975.214) [-1975.358] (-1982.920) * (-1976.879) (-1972.386) [-1975.786] (-1981.683) -- 0:00:08
961500 -- (-1983.857) [-1979.766] (-1973.795) (-1980.257) * (-1977.387) (-1976.688) [-1973.578] (-1984.002) -- 0:00:08
962000 -- (-1977.373) (-1977.965) (-1975.949) [-1977.112] * (-1974.424) (-1974.910) (-1977.720) [-1977.268] -- 0:00:08
962500 -- (-1972.304) [-1973.928] (-1981.481) (-1982.596) * (-1972.752) (-1980.770) [-1975.555] (-1983.855) -- 0:00:07
963000 -- (-1984.938) (-1975.139) (-1976.472) [-1971.665] * (-1978.574) [-1974.492] (-1977.837) (-1980.952) -- 0:00:07
963500 -- (-1983.829) (-1976.213) (-1976.138) [-1978.201] * [-1972.851] (-1979.437) (-1987.477) (-1984.289) -- 0:00:07
964000 -- (-1977.117) (-1981.964) (-1973.881) [-1979.095] * [-1975.550] (-1976.879) (-1977.122) (-1975.951) -- 0:00:07
964500 -- (-1972.357) (-1977.810) (-1973.852) [-1972.403] * [-1978.383] (-1978.462) (-1971.981) (-1977.406) -- 0:00:07
965000 -- (-1979.930) (-1980.729) [-1975.781] (-1975.390) * (-1976.807) [-1976.818] (-1984.721) (-1975.039) -- 0:00:07
Average standard deviation of split frequencies: 0.000000
965500 -- (-1972.195) [-1978.796] (-1974.095) (-1975.214) * (-1974.483) (-1982.967) [-1979.876] (-1979.971) -- 0:00:07
966000 -- [-1974.951] (-1981.302) (-1981.393) (-1973.077) * (-1985.030) (-1974.406) [-1969.709] (-1985.009) -- 0:00:07
966500 -- (-1973.989) (-1976.961) [-1977.572] (-1976.316) * (-1980.680) (-1980.824) [-1975.331] (-1978.783) -- 0:00:07
967000 -- [-1977.409] (-1976.341) (-1977.772) (-1979.442) * (-1976.622) [-1982.222] (-1974.682) (-1976.439) -- 0:00:06
967500 -- (-1983.871) (-1974.429) (-1988.082) [-1979.908] * (-1976.956) (-1974.827) [-1981.428] (-1977.782) -- 0:00:06
968000 -- (-1978.079) [-1973.637] (-1982.021) (-1981.413) * (-1972.016) (-1975.315) (-1982.221) [-1975.450] -- 0:00:06
968500 -- (-1983.145) (-1974.064) [-1974.768] (-1976.790) * (-1972.513) (-1980.291) [-1975.375] (-1978.307) -- 0:00:06
969000 -- (-1980.738) (-1977.641) [-1975.562] (-1977.010) * (-1974.510) (-1971.059) [-1971.169] (-1976.641) -- 0:00:06
969500 -- (-1980.644) [-1977.857] (-1977.792) (-1975.850) * (-1978.922) (-1979.130) [-1975.687] (-1978.771) -- 0:00:06
970000 -- (-1974.538) [-1975.055] (-1980.988) (-1979.090) * (-1979.222) [-1975.852] (-1978.682) (-1977.638) -- 0:00:06
Average standard deviation of split frequencies: 0.000000
970500 -- (-1974.563) (-1980.217) [-1976.098] (-1978.565) * [-1981.833] (-1976.197) (-1977.922) (-1980.794) -- 0:00:06
971000 -- [-1974.357] (-1976.662) (-1977.789) (-1978.559) * (-1980.914) (-1972.638) [-1978.725] (-1978.957) -- 0:00:06
971500 -- [-1978.581] (-1977.085) (-1980.649) (-1978.954) * (-1978.288) [-1974.564] (-1983.895) (-1974.929) -- 0:00:06
972000 -- (-1979.694) (-1972.891) (-1978.015) [-1976.592] * (-1975.780) [-1979.343] (-1977.373) (-1977.564) -- 0:00:05
972500 -- (-1981.553) (-1974.601) [-1978.108] (-1976.517) * (-1973.701) (-1976.925) [-1975.864] (-1972.796) -- 0:00:05
973000 -- (-1979.713) [-1976.970] (-1975.361) (-1979.964) * (-1982.345) (-1980.220) (-1976.996) [-1982.109] -- 0:00:05
973500 -- (-1983.213) (-1972.302) (-1980.721) [-1976.202] * (-1972.031) (-1981.685) [-1975.813] (-1979.834) -- 0:00:05
974000 -- [-1979.408] (-1975.069) (-1979.666) (-1980.554) * (-1974.523) (-1987.169) (-1981.574) [-1975.990] -- 0:00:05
974500 -- (-1976.366) [-1973.634] (-1977.488) (-1979.474) * (-1981.824) (-1984.156) [-1978.929] (-1971.387) -- 0:00:05
975000 -- (-1975.094) [-1979.611] (-1983.654) (-1972.740) * (-1976.412) (-1979.714) [-1971.331] (-1976.952) -- 0:00:05
Average standard deviation of split frequencies: 0.000000
975500 -- (-1980.598) (-1980.055) [-1982.399] (-1973.959) * (-1973.814) (-1986.160) [-1983.008] (-1975.977) -- 0:00:05
976000 -- (-1978.712) [-1977.522] (-1976.817) (-1987.884) * (-1978.452) (-1980.986) (-1975.683) [-1972.963] -- 0:00:05
976500 -- [-1977.450] (-1983.397) (-1974.985) (-1979.590) * (-1978.174) [-1980.881] (-1978.912) (-1976.978) -- 0:00:04
977000 -- [-1977.536] (-1983.105) (-1975.204) (-1977.407) * (-1982.462) (-1986.090) (-1980.396) [-1976.023] -- 0:00:04
977500 -- (-1983.925) [-1975.954] (-1981.960) (-1975.235) * (-1971.978) (-1980.262) [-1974.950] (-1979.101) -- 0:00:04
978000 -- (-1981.475) (-1971.592) (-1981.470) [-1983.635] * (-1977.857) [-1976.204] (-1982.517) (-1980.634) -- 0:00:04
978500 -- (-1981.280) (-1984.363) [-1977.181] (-1982.296) * [-1972.402] (-1974.491) (-1974.349) (-1977.390) -- 0:00:04
979000 -- (-1981.497) (-1982.138) (-1974.444) [-1978.415] * (-1985.512) [-1976.262] (-1977.533) (-1976.965) -- 0:00:04
979500 -- (-1976.444) [-1978.465] (-1977.938) (-1984.311) * (-1973.245) [-1971.557] (-1974.869) (-1976.947) -- 0:00:04
980000 -- [-1974.944] (-1977.846) (-1978.440) (-1982.210) * [-1979.502] (-1980.867) (-1975.821) (-1977.692) -- 0:00:04
Average standard deviation of split frequencies: 0.000000
980500 -- (-1980.105) (-1974.250) (-1986.739) [-1980.845] * [-1975.016] (-1979.387) (-1970.159) (-1976.150) -- 0:00:04
981000 -- (-1976.244) (-1976.211) [-1977.890] (-1977.626) * (-1972.302) (-1976.505) [-1973.765] (-1978.536) -- 0:00:04
981500 -- (-1973.879) (-1976.139) (-1977.776) [-1979.704] * [-1977.169] (-1986.503) (-1974.520) (-1975.983) -- 0:00:03
982000 -- (-1974.138) (-1980.961) (-1975.720) [-1976.932] * (-1979.357) (-1976.476) [-1975.723] (-1975.902) -- 0:00:03
982500 -- (-1977.215) (-1978.038) [-1975.253] (-1976.550) * [-1978.821] (-1970.966) (-1977.164) (-1974.267) -- 0:00:03
983000 -- [-1980.577] (-1976.048) (-1983.347) (-1980.768) * (-1974.635) (-1976.914) [-1972.705] (-1976.532) -- 0:00:03
983500 -- (-1977.181) (-1975.950) [-1977.219] (-1978.330) * (-1979.604) [-1977.554] (-1977.613) (-1974.396) -- 0:00:03
984000 -- [-1978.823] (-1973.477) (-1976.363) (-1975.816) * [-1976.707] (-1972.236) (-1978.678) (-1974.619) -- 0:00:03
984500 -- (-1978.548) (-1979.486) (-1979.288) [-1970.541] * (-1975.836) [-1976.017] (-1975.897) (-1974.640) -- 0:00:03
985000 -- [-1973.004] (-1980.802) (-1975.308) (-1983.020) * (-1972.938) [-1972.396] (-1973.391) (-1974.517) -- 0:00:03
Average standard deviation of split frequencies: 0.000000
985500 -- (-1976.974) (-1972.681) (-1980.407) [-1974.778] * (-1985.598) (-1971.699) [-1979.966] (-1978.103) -- 0:00:03
986000 -- [-1972.084] (-1977.732) (-1977.331) (-1980.174) * (-1977.636) [-1972.817] (-1978.003) (-1975.674) -- 0:00:02
986500 -- (-1976.955) [-1974.883] (-1976.396) (-1977.085) * (-1981.592) (-1977.199) [-1975.974] (-1974.630) -- 0:00:02
987000 -- [-1972.465] (-1980.974) (-1981.698) (-1974.188) * (-1973.804) (-1988.382) (-1971.529) [-1973.229] -- 0:00:02
987500 -- [-1971.601] (-1985.044) (-1984.805) (-1982.877) * (-1977.310) (-1978.422) (-1976.520) [-1973.238] -- 0:00:02
988000 -- (-1977.848) [-1976.075] (-1980.782) (-1979.785) * [-1974.218] (-1976.291) (-1977.203) (-1977.657) -- 0:00:02
988500 -- (-1976.676) (-1984.135) [-1980.121] (-1970.247) * [-1975.213] (-1977.189) (-1980.172) (-1975.031) -- 0:00:02
989000 -- [-1973.751] (-1981.700) (-1972.706) (-1980.493) * [-1975.145] (-1974.865) (-1983.795) (-1982.939) -- 0:00:02
989500 -- (-1981.769) (-1983.108) [-1972.395] (-1981.642) * (-1978.839) (-1972.649) [-1977.446] (-1978.948) -- 0:00:02
990000 -- (-1975.586) (-1986.980) (-1974.537) [-1976.812] * (-1974.761) (-1972.368) (-1972.547) [-1977.754] -- 0:00:02
Average standard deviation of split frequencies: 0.000000
990500 -- (-1976.309) (-1984.737) (-1977.866) [-1976.493] * (-1971.899) [-1973.777] (-1977.055) (-1975.279) -- 0:00:02
991000 -- (-1978.886) [-1975.569] (-1972.784) (-1980.195) * [-1972.102] (-1979.131) (-1978.947) (-1978.025) -- 0:00:01
991500 -- (-1978.525) (-1975.649) (-1977.071) [-1977.406] * (-1974.472) (-1980.713) [-1977.046] (-1982.164) -- 0:00:01
992000 -- (-1984.061) (-1980.047) (-1971.259) [-1980.065] * (-1976.795) [-1977.043] (-1975.023) (-1982.035) -- 0:00:01
992500 -- (-1977.851) (-1974.689) [-1969.918] (-1983.392) * [-1984.599] (-1973.834) (-1974.676) (-1976.276) -- 0:00:01
993000 -- (-1981.102) [-1975.271] (-1979.418) (-1980.630) * (-1987.188) (-1973.880) [-1973.720] (-1975.235) -- 0:00:01
993500 -- [-1982.487] (-1974.277) (-1975.590) (-1978.741) * (-1986.851) [-1973.418] (-1974.935) (-1976.506) -- 0:00:01
994000 -- [-1980.793] (-1976.155) (-1980.326) (-1976.883) * (-1979.731) (-1977.282) (-1974.683) [-1976.671] -- 0:00:01
994500 -- [-1975.114] (-1973.101) (-1976.247) (-1976.379) * (-1977.208) (-1970.852) (-1979.222) [-1976.955] -- 0:00:01
995000 -- (-1977.472) [-1978.816] (-1977.512) (-1973.745) * (-1973.419) (-1973.259) [-1977.304] (-1983.913) -- 0:00:01
Average standard deviation of split frequencies: 0.000000
995500 -- (-1978.818) (-1977.282) [-1974.830] (-1978.809) * (-1976.522) [-1972.994] (-1976.620) (-1972.477) -- 0:00:00
996000 -- (-1976.471) [-1971.792] (-1973.195) (-1978.059) * (-1977.931) (-1971.896) (-1978.595) [-1976.400] -- 0:00:00
996500 -- (-1976.888) (-1980.165) (-1973.387) [-1981.757] * (-1977.579) (-1981.465) [-1975.590] (-1976.211) -- 0:00:00
997000 -- (-1975.037) (-1979.823) [-1973.373] (-1995.860) * (-1972.024) (-1980.532) [-1974.819] (-1981.339) -- 0:00:00
997500 -- [-1982.561] (-1971.913) (-1982.606) (-1985.129) * (-1973.842) (-1983.869) [-1973.236] (-1976.428) -- 0:00:00
998000 -- [-1979.094] (-1973.716) (-1979.467) (-1980.492) * (-1976.520) (-1980.748) (-1986.977) [-1981.066] -- 0:00:00
998500 -- [-1975.064] (-1977.680) (-1972.910) (-1981.957) * [-1975.969] (-1980.804) (-1974.403) (-1982.110) -- 0:00:00
999000 -- (-1978.958) (-1977.537) [-1974.707] (-1974.590) * (-1975.500) [-1973.219] (-1974.481) (-1975.765) -- 0:00:00
999500 -- (-1981.057) [-1976.107] (-1987.206) (-1977.195) * (-1979.661) (-1974.678) [-1973.981] (-1973.132) -- 0:00:00
1000000 -- (-1974.629) (-1975.651) [-1978.839] (-1981.207) * [-1980.432] (-1977.401) (-1974.086) (-1974.589) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1974.629076 -- 13.154758
Chain 1 -- -1974.629077 -- 13.154758
Chain 2 -- -1975.651036 -- 13.491115
Chain 2 -- -1975.651036 -- 13.491115
Chain 3 -- -1978.838935 -- 14.709959
Chain 3 -- -1978.838935 -- 14.709959
Chain 4 -- -1981.206757 -- 12.127941
Chain 4 -- -1981.206758 -- 12.127941
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1980.432402 -- 14.446040
Chain 1 -- -1980.432402 -- 14.446040
Chain 2 -- -1977.401086 -- 13.657740
Chain 2 -- -1977.401086 -- 13.657740
Chain 3 -- -1974.085658 -- 12.882553
Chain 3 -- -1974.085657 -- 12.882553
Chain 4 -- -1974.589028 -- 14.030477
Chain 4 -- -1974.589028 -- 14.030477
Analysis completed in 3 mins 31 seconds
Analysis used 210.75 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1967.58
Likelihood of best state for "cold" chain of run 2 was -1967.76
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
53.5 % ( 48 %) Dirichlet(Revmat{all})
66.7 % ( 54 %) Slider(Revmat{all})
25.6 % ( 24 %) Dirichlet(Pi{all})
27.6 % ( 21 %) Slider(Pi{all})
65.4 % ( 47 %) Multiplier(Alpha{1,2})
46.7 % ( 20 %) Multiplier(Alpha{3})
64.1 % ( 33 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.1 % ( 24 %) Multiplier(V{all})
25.0 % ( 23 %) Nodeslider(V{all})
25.9 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
53.4 % ( 45 %) Dirichlet(Revmat{all})
66.6 % ( 46 %) Slider(Revmat{all})
25.3 % ( 28 %) Dirichlet(Pi{all})
27.8 % ( 24 %) Slider(Pi{all})
66.1 % ( 46 %) Multiplier(Alpha{1,2})
47.4 % ( 29 %) Multiplier(Alpha{3})
64.4 % ( 44 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.2 % ( 37 %) Multiplier(V{all})
24.6 % ( 19 %) Nodeslider(V{all})
25.5 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.57
2 | 166802 0.85 0.71
3 | 166151 166145 0.86
4 | 166318 167627 166957
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.57
2 | 166449 0.85 0.72
3 | 166505 166563 0.86
4 | 167118 166646 166719
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1974.26
| 2 |
| 2 |
| 2 1 2 2 |
| 2 2 2 |
| 2 1 |
| * 2 * 1 2 2 2 22 |
|1 * 12 1* 1112 12 2 22|
| * 2 11 2 1 2 1 21 * 2 1 |
| 2 1 2 2222 1221 2 1 2 1 2 1 1 |
| 2 2 1 2 22* *1 21 1 1 11 12 1|
| 1 1 2 21 1 1 2 1 1 12 |
|2 1 1 1 2 11 |
| 1 1 1 2 1 |
| 1 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1977.82
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1973.42 -1982.21
2 -1973.09 -1982.06
--------------------------------------
TOTAL -1973.24 -1982.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.374933 0.003232 0.264564 0.480435 0.369938 1276.97 1325.07 1.000
r(A<->C){all} 0.101069 0.000793 0.047157 0.154629 0.098986 848.41 900.31 1.000
r(A<->G){all} 0.292450 0.002609 0.200343 0.396583 0.289384 598.36 766.17 1.001
r(A<->T){all} 0.086027 0.001031 0.027853 0.150188 0.082416 903.47 989.88 1.000
r(C<->G){all} 0.067165 0.000459 0.029942 0.111177 0.065063 890.47 936.09 1.000
r(C<->T){all} 0.385461 0.003123 0.275084 0.490260 0.384191 746.75 794.05 1.001
r(G<->T){all} 0.067828 0.000633 0.022102 0.116987 0.065419 909.67 913.00 1.000
pi(A){all} 0.249291 0.000197 0.221695 0.276218 0.249129 1048.21 1210.93 1.000
pi(C){all} 0.264683 0.000198 0.237316 0.292641 0.265031 1167.30 1207.20 1.001
pi(G){all} 0.287151 0.000221 0.260110 0.317594 0.286916 1093.32 1131.89 1.000
pi(T){all} 0.198875 0.000175 0.173127 0.224392 0.198856 820.01 959.30 1.001
alpha{1,2} 0.055882 0.001615 0.000112 0.127943 0.049388 1183.21 1312.78 1.000
alpha{3} 2.208823 0.672129 0.884970 3.891913 2.080196 1468.81 1484.90 1.000
pinvar{all} 0.289528 0.009824 0.087826 0.475587 0.298077 1212.05 1275.86 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 3002 1.000000 0.000000 1.000000 1.000000 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.052343 0.000214 0.027125 0.082453 0.050607 1.000 2
length{all}[2] 0.011771 0.000026 0.003672 0.022376 0.011098 1.000 2
length{all}[3] 0.008870 0.000020 0.001009 0.017329 0.008306 1.000 2
length{all}[4] 0.060791 0.000292 0.030489 0.096122 0.058775 1.000 2
length{all}[5] 0.079335 0.000389 0.044219 0.120169 0.077201 1.000 2
length{all}[6] 0.125359 0.001095 0.067980 0.193698 0.121250 1.001 2
length{all}[7] 0.036465 0.000147 0.015001 0.062424 0.035094 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000000
Maximum standard deviation of split frequencies = 0.000000
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C2 (2)
|----------------100----------------+
+ \------------------------------------ C3 (3)
|
| /------------------------------------ C4 (4)
\----------------100----------------+
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/------------------ C1 (1)
|
| /---- C2 (2)
|------------+
+ \--- C3 (3)
|
| /--------------------- C4 (4)
\-------------------------------------------+
\---------------------------- C5 (5)
|-----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1 tree sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 828
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
169 patterns at 276 / 276 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
164944 bytes for conP
22984 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), (4, 5)); MP score: 153
247416 bytes for conP, adjusted
0.100864 0.069722 0.019752 0.020654 0.179238 0.125009 0.139564 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -2069.234039
Iterating by ming2
Initial: fx= 2069.234039
x= 0.10086 0.06972 0.01975 0.02065 0.17924 0.12501 0.13956 0.30000 1.30000
1 h-m-p 0.0000 0.0008 239.1227 +++YYCCCCC 2046.023798 6 0.0007 27 | 0/9
2 h-m-p 0.0000 0.0003 6115.4031 +YYCCC 2011.319726 4 0.0001 46 | 0/9
3 h-m-p 0.0001 0.0006 474.9968 +YCYYCCC 1980.453348 6 0.0005 68 | 0/9
4 h-m-p 0.0003 0.0013 165.0700 CCCC 1976.969765 3 0.0004 86 | 0/9
5 h-m-p 0.0005 0.0047 150.9758 +YCYYCCC 1944.230512 6 0.0038 109 | 0/9
6 h-m-p 0.0000 0.0001 5996.1389 +YYCYCCC 1925.352354 6 0.0000 131 | 0/9
7 h-m-p 0.0005 0.0023 106.7159 YCCC 1924.455631 3 0.0003 148 | 0/9
8 h-m-p 0.0003 0.0016 42.4786 CYC 1924.262789 2 0.0003 163 | 0/9
9 h-m-p 0.0029 0.0478 4.1714 CCC 1924.082976 2 0.0035 179 | 0/9
10 h-m-p 0.0048 0.0794 3.0383 +YCCCCC 1917.525948 5 0.0237 201 | 0/9
11 h-m-p 0.1674 1.1349 0.4307 YCCCC 1901.880699 4 0.3654 220 | 0/9
12 h-m-p 1.5725 7.8626 0.0519 CCCCC 1895.077115 4 2.3882 249 | 0/9
13 h-m-p 0.7044 4.6646 0.1759 CYC 1892.147126 2 0.7486 273 | 0/9
14 h-m-p 0.9926 4.9632 0.1026 +YCCCC 1886.570816 4 2.6816 302 | 0/9
15 h-m-p 0.6135 3.0676 0.2656 CCCC 1883.996026 3 0.6014 329 | 0/9
16 h-m-p 1.6000 8.0000 0.0714 CCC 1883.056030 2 1.4247 354 | 0/9
17 h-m-p 1.6000 8.0000 0.0469 YYC 1882.860361 2 1.3551 377 | 0/9
18 h-m-p 1.6000 8.0000 0.0041 CC 1882.829554 1 1.7378 400 | 0/9
19 h-m-p 0.9177 8.0000 0.0077 +C 1882.799770 0 3.7181 422 | 0/9
20 h-m-p 1.6000 8.0000 0.0128 ++ 1882.686947 m 8.0000 443 | 0/9
21 h-m-p 1.6000 8.0000 0.0146 CC 1882.665623 1 1.6909 466 | 0/9
22 h-m-p 1.6000 8.0000 0.0009 YC 1882.665305 1 1.1717 488 | 0/9
23 h-m-p 1.2122 8.0000 0.0008 YC 1882.665210 1 2.8650 510 | 0/9
24 h-m-p 1.6000 8.0000 0.0007 C 1882.665181 0 1.8730 531 | 0/9
25 h-m-p 1.6000 8.0000 0.0001 C 1882.665176 0 1.8993 552 | 0/9
26 h-m-p 1.6000 8.0000 0.0000 C 1882.665176 0 1.3524 573 | 0/9
27 h-m-p 1.6000 8.0000 0.0000 Y 1882.665176 0 1.0444 594 | 0/9
28 h-m-p 1.6000 8.0000 0.0000 +Y 1882.665176 0 4.6957 616 | 0/9
29 h-m-p 1.2781 8.0000 0.0000 C 1882.665176 0 0.3195 637 | 0/9
30 h-m-p 0.7255 8.0000 0.0000 -------C 1882.665176 0 0.0000 665
Out..
lnL = -1882.665176
666 lfun, 666 eigenQcodon, 4662 P(t)
Time used: 0:03
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), (4, 5)); MP score: 153
0.100864 0.069722 0.019752 0.020654 0.179238 0.125009 0.139564 2.271830 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.638412
np = 10
lnL0 = -1931.884474
Iterating by ming2
Initial: fx= 1931.884474
x= 0.10086 0.06972 0.01975 0.02065 0.17924 0.12501 0.13956 2.27183 0.57321 0.49224
1 h-m-p 0.0000 0.0012 90.6726 +++YYCC 1929.855517 3 0.0005 22 | 0/10
2 h-m-p 0.0001 0.0014 450.7627 +YCYCCCC 1922.137373 6 0.0006 46 | 0/10
3 h-m-p 0.0001 0.0003 1307.0338 +YYCYCCC 1905.431669 6 0.0002 69 | 0/10
4 h-m-p 0.0003 0.0016 97.0136 YCCC 1904.890375 3 0.0002 87 | 0/10
5 h-m-p 0.0010 0.0068 19.7805 YCC 1904.767730 2 0.0007 103 | 0/10
6 h-m-p 0.0007 0.0093 19.9541 YC 1904.715693 1 0.0004 117 | 0/10
7 h-m-p 0.0005 0.0135 14.7221 YC 1904.636873 1 0.0010 131 | 0/10
8 h-m-p 0.0030 0.0790 5.0475 +YYC 1904.328285 2 0.0101 147 | 0/10
9 h-m-p 0.0011 0.0433 47.3596 ++YCCCCC 1898.226801 5 0.0198 171 | 0/10
10 h-m-p 0.0014 0.0068 190.8890 YCCCC 1894.867267 4 0.0029 191 | 0/10
11 h-m-p 0.0627 0.3135 0.9764 +YYCYCCC 1887.222899 6 0.2113 214 | 0/10
12 h-m-p 0.0765 0.9430 2.6981 +CYCCCC 1880.627226 5 0.4221 247 | 0/10
13 h-m-p 0.6313 3.1566 0.7936 YYC 1879.059286 2 0.5255 262 | 0/10
14 h-m-p 0.9643 4.8217 0.3962 CCC 1878.323211 2 0.7970 289 | 0/10
15 h-m-p 1.6000 8.0000 0.0947 YC 1878.128359 1 0.8367 313 | 0/10
16 h-m-p 1.5883 7.9415 0.0137 YC 1878.088838 1 0.6931 337 | 0/10
17 h-m-p 1.6000 8.0000 0.0049 YC 1878.085392 1 0.6724 361 | 0/10
18 h-m-p 1.6000 8.0000 0.0017 YC 1878.084589 1 1.0484 385 | 0/10
19 h-m-p 1.6000 8.0000 0.0007 Y 1878.084496 0 1.2457 408 | 0/10
20 h-m-p 1.2251 8.0000 0.0007 C 1878.084478 0 1.2058 431 | 0/10
21 h-m-p 1.6000 8.0000 0.0002 C 1878.084473 0 1.7937 454 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1878.084473 0 1.1672 477 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 Y 1878.084473 0 0.9507 500 | 0/10
24 h-m-p 1.6000 8.0000 0.0000 Y 1878.084473 0 1.6000 523 | 0/10
25 h-m-p 1.6000 8.0000 0.0000 C 1878.084473 0 1.6000 546 | 0/10
26 h-m-p 1.6000 8.0000 0.0000 Y 1878.084473 0 0.4000 569
Out..
lnL = -1878.084473
570 lfun, 1710 eigenQcodon, 7980 P(t)
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), (4, 5)); MP score: 153
initial w for M2:NSpselection reset.
0.100864 0.069722 0.019752 0.020654 0.179238 0.125009 0.139564 2.319372 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.356168
np = 12
lnL0 = -1946.103287
Iterating by ming2
Initial: fx= 1946.103287
x= 0.10086 0.06972 0.01975 0.02065 0.17924 0.12501 0.13956 2.31937 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0084 97.7967 ++YCYC 1944.829073 3 0.0003 23 | 0/12
2 h-m-p 0.0002 0.0024 151.8981 +CYYC 1936.198018 3 0.0016 44 | 0/12
3 h-m-p 0.0000 0.0001 1164.7869 +YYCCC 1931.661942 4 0.0001 66 | 0/12
4 h-m-p 0.0000 0.0001 1248.6410 ++ 1924.480321 m 0.0001 81 | 1/12
5 h-m-p 0.0022 0.0418 31.8260 +YCCCC 1911.747830 4 0.0176 104 | 0/12
6 h-m-p 0.0002 0.0008 1164.9105 CCC 1906.560109 2 0.0002 123 | 0/12
7 h-m-p 0.0007 0.0064 389.5238 YCCC 1899.275690 3 0.0011 143 | 0/12
8 h-m-p 0.0011 0.0053 149.0999 YCYCCC 1889.928025 5 0.0028 166 | 0/12
9 h-m-p 0.0007 0.0035 135.6758 CCCCC 1887.790799 4 0.0009 189 | 0/12
10 h-m-p 0.0024 0.0120 11.1233 CCC 1887.726825 2 0.0009 208 | 0/12
11 h-m-p 0.0040 0.3222 2.4338 ++YCYCCC 1883.518360 5 0.1546 233 | 0/12
12 h-m-p 0.0625 0.3125 2.3687 ++ 1881.393209 m 0.3125 248 | 1/12
13 h-m-p 0.6037 8.0000 0.3570 CCCC 1880.611813 3 0.2253 269 | 1/12
14 h-m-p 0.2903 4.0649 0.2771 CCCC 1880.287955 3 0.4691 301 | 1/12
15 h-m-p 0.3375 8.0000 0.3852 +YCCC 1879.810053 3 0.8538 333 | 1/12
16 h-m-p 0.5822 5.6513 0.5648 CCC 1879.140175 2 0.6502 363 | 1/12
17 h-m-p 1.0732 5.3658 0.2642 YYCC 1878.486613 3 0.9900 393 | 1/12
18 h-m-p 1.6000 8.0000 0.1321 CC 1878.337583 1 1.4201 421 | 1/12
19 h-m-p 1.3434 8.0000 0.1396 CCC 1878.250303 2 2.0911 451 | 1/12
20 h-m-p 1.6000 8.0000 0.0917 CC 1878.177784 1 2.2713 479 | 1/12
21 h-m-p 1.2674 8.0000 0.1643 CCC 1878.108514 2 1.8417 509 | 1/12
22 h-m-p 1.6000 8.0000 0.0642 YC 1878.086243 1 1.1638 536 | 1/12
23 h-m-p 1.6000 8.0000 0.0302 YC 1878.084493 1 1.1945 563 | 1/12
24 h-m-p 1.6000 8.0000 0.0025 Y 1878.084473 0 0.9028 589 | 1/12
25 h-m-p 1.6000 8.0000 0.0002 Y 1878.084473 0 0.9568 615 | 1/12
26 h-m-p 1.6000 8.0000 0.0001 Y 1878.084473 0 0.9136 641 | 1/12
27 h-m-p 1.6000 8.0000 0.0000 Y 1878.084473 0 0.9032 667 | 1/12
28 h-m-p 1.6000 8.0000 0.0000 -----Y 1878.084473 0 0.0004 698
Out..
lnL = -1878.084473
699 lfun, 2796 eigenQcodon, 14679 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1889.083602 S = -1789.973893 -90.948724
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 169 patterns 0:12
did 20 / 169 patterns 0:12
did 30 / 169 patterns 0:12
did 40 / 169 patterns 0:12
did 50 / 169 patterns 0:12
did 60 / 169 patterns 0:12
did 70 / 169 patterns 0:12
did 80 / 169 patterns 0:12
did 90 / 169 patterns 0:12
did 100 / 169 patterns 0:12
did 110 / 169 patterns 0:13
did 120 / 169 patterns 0:13
did 130 / 169 patterns 0:13
did 140 / 169 patterns 0:13
did 150 / 169 patterns 0:13
did 160 / 169 patterns 0:13
did 169 / 169 patterns 0:13
Time used: 0:13
Model 3: discrete
TREE # 1
(1, (2, 3), (4, 5)); MP score: 153
0.100864 0.069722 0.019752 0.020654 0.179238 0.125009 0.139564 2.319372 0.331355 0.382499 0.067439 0.168355 0.281892
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 12.057608
np = 13
lnL0 = -1881.674965
Iterating by ming2
Initial: fx= 1881.674965
x= 0.10086 0.06972 0.01975 0.02065 0.17924 0.12501 0.13956 2.31937 0.33136 0.38250 0.06744 0.16836 0.28189
1 h-m-p 0.0000 0.0016 61.6203 ++YC 1880.968339 1 0.0004 21 | 0/13
2 h-m-p 0.0001 0.0005 152.2273 +CCC 1879.763083 2 0.0003 42 | 0/13
3 h-m-p 0.0000 0.0001 154.1635 ++ 1879.221380 m 0.0001 58 | 1/13
4 h-m-p 0.0004 0.0075 24.8314 +YYC 1878.898336 2 0.0015 77 | 1/13
5 h-m-p 0.0008 0.0039 38.7604 YCCCC 1878.466371 4 0.0015 100 | 1/13
6 h-m-p 0.0004 0.0019 60.5098 YCCC 1878.095472 3 0.0009 121 | 1/13
7 h-m-p 0.0029 0.0613 17.9168 CCC 1877.900916 2 0.0023 141 | 0/13
8 h-m-p 0.0022 0.0738 18.7157 YCCC 1877.716886 3 0.0012 162 | 0/13
9 h-m-p 0.0054 0.0654 4.0477 YC 1877.691578 1 0.0022 179 | 0/13
10 h-m-p 0.0036 0.0635 2.4635 +YCC 1877.617126 2 0.0110 199 | 0/13
11 h-m-p 0.0010 0.0049 26.5598 YCCC 1877.474258 3 0.0019 220 | 0/13
12 h-m-p 0.0420 1.3695 1.1816 +YC 1877.029300 1 0.4098 238 | 0/13
13 h-m-p 0.4079 2.0393 0.2788 CCC 1876.996620 2 0.3880 258 | 0/13
14 h-m-p 0.2227 1.1133 0.1708 YC 1876.955158 1 0.5265 288 | 0/13
15 h-m-p 0.1478 0.7389 0.0636 +YC 1876.948820 1 0.4151 319 | 0/13
16 h-m-p 0.1670 2.0887 0.1579 +YC 1876.924530 1 1.3225 350 | 0/13
17 h-m-p 0.0550 0.2749 0.2268 ++ 1876.913953 m 0.2749 379 | 1/13
18 h-m-p 0.0348 0.1738 0.4209 ++ 1876.908588 m 0.1738 408 | 2/13
19 h-m-p 0.7149 8.0000 0.1021 YC 1876.900291 1 0.4978 437 | 2/13
20 h-m-p 1.6000 8.0000 0.0155 YC 1876.899922 1 0.6440 465 | 2/13
21 h-m-p 1.6000 8.0000 0.0009 Y 1876.899907 0 1.0120 492 | 2/13
22 h-m-p 1.6000 8.0000 0.0001 Y 1876.899906 0 1.0905 519 | 2/13
23 h-m-p 1.6000 8.0000 0.0000 Y 1876.899906 0 0.9429 546 | 2/13
24 h-m-p 1.6000 8.0000 0.0000 Y 1876.899906 0 1.0401 573 | 2/13
25 h-m-p 1.6000 8.0000 0.0000 --Y 1876.899906 0 0.0250 602
Out..
lnL = -1876.899906
603 lfun, 2412 eigenQcodon, 12663 P(t)
Time used: 0:18
Model 7: beta
TREE # 1
(1, (2, 3), (4, 5)); MP score: 153
0.100864 0.069722 0.019752 0.020654 0.179238 0.125009 0.139564 2.295148 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.391308
np = 10
lnL0 = -1888.878088
Iterating by ming2
Initial: fx= 1888.878088
x= 0.10086 0.06972 0.01975 0.02065 0.17924 0.12501 0.13956 2.29515 0.66567 1.54913
1 h-m-p 0.0000 0.0024 64.6859 ++YCCC 1888.361106 3 0.0003 22 | 0/10
2 h-m-p 0.0002 0.0019 97.2758 +YYC 1887.061015 2 0.0006 38 | 0/10
3 h-m-p 0.0006 0.0065 102.1561 +YYYYCCCCCC 1880.588551 9 0.0028 66 | 0/10
4 h-m-p 0.0001 0.0007 528.9216 YCYC 1879.788444 3 0.0001 83 | 0/10
5 h-m-p 0.0002 0.0013 201.5711 CC 1878.969533 1 0.0002 98 | 0/10
6 h-m-p 0.0018 0.0088 25.5923 YCCC 1878.763507 3 0.0009 116 | 0/10
7 h-m-p 0.0044 0.1813 5.0013 +YCC 1878.571351 2 0.0137 133 | 0/10
8 h-m-p 0.0011 0.0260 60.0488 +YCCC 1878.061239 3 0.0031 152 | 0/10
9 h-m-p 0.0018 0.0131 103.6329 CYC 1877.614491 2 0.0016 168 | 0/10
10 h-m-p 0.3108 4.5144 0.5371 CCCC 1877.440635 3 0.3809 187 | 0/10
11 h-m-p 0.7711 3.8554 0.2533 YCCC 1877.250877 3 0.4545 215 | 0/10
12 h-m-p 1.5481 8.0000 0.0744 YCC 1877.193431 2 3.5349 241 | 0/10
13 h-m-p 1.3649 8.0000 0.1926 CCCC 1877.126781 3 1.7578 270 | 0/10
14 h-m-p 1.6000 8.0000 0.0348 YC 1877.120031 1 0.8224 294 | 0/10
15 h-m-p 1.6000 8.0000 0.0139 YC 1877.119910 1 0.8026 318 | 0/10
16 h-m-p 1.6000 8.0000 0.0012 Y 1877.119905 0 0.9544 341 | 0/10
17 h-m-p 1.6000 8.0000 0.0000 Y 1877.119905 0 0.9744 364 | 0/10
18 h-m-p 1.6000 8.0000 0.0000 Y 1877.119905 0 0.9255 387 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 C 1877.119905 0 0.4753 410 | 0/10
20 h-m-p 0.8375 8.0000 0.0000 Y 1877.119905 0 0.2094 433 | 0/10
21 h-m-p 0.1606 8.0000 0.0000 ------Y 1877.119905 0 0.0000 462
Out..
lnL = -1877.119905
463 lfun, 5093 eigenQcodon, 32410 P(t)
Time used: 0:31
Model 8: beta&w>1
TREE # 1
(1, (2, 3), (4, 5)); MP score: 153
initial w for M8:NSbetaw>1 reset.
0.100864 0.069722 0.019752 0.020654 0.179238 0.125009 0.139564 2.294044 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.047704
np = 12
lnL0 = -1893.440547
Iterating by ming2
Initial: fx= 1893.440547
x= 0.10086 0.06972 0.01975 0.02065 0.17924 0.12501 0.13956 2.29404 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0007 169.8907 +++CCC 1884.167603 2 0.0006 24 | 0/12
2 h-m-p 0.0000 0.0000 239.8623 ++ 1882.884713 m 0.0000 39 | 1/12
3 h-m-p 0.0000 0.0003 216.8950 +CYCYC 1879.991998 4 0.0002 62 | 1/12
4 h-m-p 0.0003 0.0014 86.1849 CYCCC 1878.334175 4 0.0005 84 | 1/12
5 h-m-p 0.0011 0.0096 39.6559 CCC 1877.681051 2 0.0011 103 | 1/12
6 h-m-p 0.0013 0.0085 35.0977 YYC 1877.302913 2 0.0010 120 | 1/12
7 h-m-p 0.0039 0.0196 7.5201 YC 1877.284702 1 0.0007 136 | 1/12
8 h-m-p 0.0022 0.0654 2.2433 CC 1877.283119 1 0.0006 153 | 1/12
9 h-m-p 0.0035 1.7617 0.6935 +CC 1877.274566 1 0.0223 171 | 1/12
10 h-m-p 0.0011 0.0930 14.6974 +YCC 1877.209201 2 0.0078 201 | 1/12
11 h-m-p 0.3573 6.8318 0.3214 CYC 1877.141498 2 0.4005 219 | 1/12
12 h-m-p 0.5842 8.0000 0.2203 YC 1877.130828 1 0.3051 246 | 1/12
13 h-m-p 0.8989 8.0000 0.0748 YC 1877.125468 1 0.5374 273 | 1/12
14 h-m-p 0.8580 8.0000 0.0468 YC 1877.120864 1 1.8571 300 | 1/12
15 h-m-p 1.6000 8.0000 0.0096 YC 1877.120480 1 1.1137 327 | 1/12
16 h-m-p 1.6000 8.0000 0.0013 Y 1877.120475 0 1.0997 353 | 1/12
17 h-m-p 1.6000 8.0000 0.0004 C 1877.120475 0 2.0070 379 | 1/12
18 h-m-p 0.8774 8.0000 0.0008 ++ 1877.120471 m 8.0000 405 | 1/12
19 h-m-p 0.0810 8.0000 0.0820 ++Y 1877.120424 0 2.3182 433 | 1/12
20 h-m-p 1.6000 8.0000 0.1018 ++ 1877.120063 m 8.0000 459 | 1/12
21 h-m-p 0.0387 0.1936 1.4906 ++ 1877.119971 m 0.1936 485 | 2/12
22 h-m-p 0.2011 8.0000 0.0015 +C 1877.119945 0 0.9773 501 | 2/12
23 h-m-p 1.6000 8.0000 0.0004 Y 1877.119945 0 1.0318 526 | 2/12
24 h-m-p 1.6000 8.0000 0.0000 Y 1877.119945 0 1.1842 551 | 2/12
25 h-m-p 1.6000 8.0000 0.0000 C 1877.119945 0 0.4000 576 | 2/12
26 h-m-p 0.6505 8.0000 0.0000 ----------------.. | 2/12
27 h-m-p 0.0160 8.0000 0.0001 ------------- | 2/12
28 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -1877.119945
688 lfun, 8256 eigenQcodon, 52976 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1886.444605 S = -1790.407253 -88.534568
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 169 patterns 0:55
did 20 / 169 patterns 0:55
did 30 / 169 patterns 0:55
did 40 / 169 patterns 0:55
did 50 / 169 patterns 0:55
did 60 / 169 patterns 0:56
did 70 / 169 patterns 0:56
did 80 / 169 patterns 0:56
did 90 / 169 patterns 0:56
did 100 / 169 patterns 0:56
did 110 / 169 patterns 0:57
did 120 / 169 patterns 0:57
did 130 / 169 patterns 0:57
did 140 / 169 patterns 0:57
did 150 / 169 patterns 0:57
did 160 / 169 patterns 0:58
did 169 / 169 patterns 0:58
Time used: 0:58
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=276
D_melanogaster_Ntmt-PA MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD
D_sechellia_Ntmt-PA MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND
D_simulans_Ntmt-PA MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND
D_yakuba_Ntmt-PA MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD
D_erecta_Ntmt-PA MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD
* **** :*********: **:** : :::******** **:.**.*
D_melanogaster_Ntmt-PA SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR
D_sechellia_Ntmt-PA SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
D_simulans_Ntmt-PA SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR
D_yakuba_Ntmt-PA SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
D_erecta_Ntmt-PA STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR
*::*. *** ************:***********************.***
D_melanogaster_Ntmt-PA EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
D_sechellia_Ntmt-PA EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
D_simulans_Ntmt-PA EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT
D_yakuba_Ntmt-PA EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT
D_erecta_Ntmt-PA EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT
**************************************.***:*******
D_melanogaster_Ntmt-PA SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI
D_sechellia_Ntmt-PA SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
D_simulans_Ntmt-PA SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI
D_yakuba_Ntmt-PA SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
D_erecta_Ntmt-PA SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI
*:: ******::**********:*******:*******************
D_melanogaster_Ntmt-PA KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV
D_sechellia_Ntmt-PA KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV
D_simulans_Ntmt-PA KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV
D_yakuba_Ntmt-PA KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV
D_erecta_Ntmt-PA KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV
*******.*:*:*******:*:***::*****************:*****
D_melanogaster_Ntmt-PA RKVKQQNFPKGLFPVYMIACKPVSKE
D_sechellia_Ntmt-PA RKVKQQNFPKGLFPVYMIACKPVSKE
D_simulans_Ntmt-PA RKVKQQNFPKGLFPVYMIACKPVSKE
D_yakuba_Ntmt-PA RKVKQQNFPKGLFPVYMIACKPVSKE
D_erecta_Ntmt-PA RKVKQQNFPKGLFPVYMIACKPVSKE
**************************
>D_melanogaster_Ntmt-PA ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA CGAGACCACGGATAAGGTCCAGGGGTCGTCGAAGCAGAAGGATGATAGCA GTATAGCCGCAAGTTCAGATGCCAAGACAGCGTCCCCTTCTTCGAGCGAT AGTTCGACCAAAGTCGCCGCACCGGAGTCCGAATTTTACAATAAGGCACA AAAATATTGGTCTGAGGTACCGGCGACTGTTAACGGGATGCTCGGCGGCC TGGGCTACATTAGTGCCATAGATATACAGGGATCGAATGTGTTCCTGCGC GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT TGGTCGGGTGACTCGGAATCTCCTGATCCCCCGCTTCAGCTGCGTGGATC TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACT TCGGAAGACGGAAGCCGTGGAAAGGTGGGACAGATCTATAACGTGGGATT GCAGAAGTTTACGCCTACGCAACAGTACGACCTCGTTTGGACCCAGTGGG TCCTGGGCCATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGACGCATA AAGCAGGGACTGGCGCCCGGCGCCTTCTTGTGTCTGAAGGAGAACGTGAG CAGCTCGAAGAAGACAGTGGAAGATAGGAACGACTCGTCGGTAACGAGGC CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTCTTTCCAGTGTACAT GATAGCCTGCAAACCCGTCTCCAAGGAA >D_sechellia_Ntmt-PA ATGAGGACTACATTAGAAGAGCAGCTTTCAGACAAACTGCAGATGATGGA CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCAGAAGGAAGATAGCA GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC AGTGCGACCAAAGTCGCCGCACCTGAGATCGAATTTTACAACAAGGCTCA GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC TCGGAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG TGCTGGGACATCTCACAGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG CAGCTCGAAGAAGACAGTGGAGGATAAGAATGACTCGTCAGTTACGAGGC CTCTGGACAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTA CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT GATCGCCTGCAAACCCGTCTCCAAGGAA >D_simulans_Ntmt-PA ATGACGACTACATTAGAAGAGCAGCTTTCAGACAAGTTGCAGATGATGGA CGATACCACGGATAAGGTACAGGGGTCGTCGGAGCTGAAGGAAGATAGCA GTATAGCCGCAAGTTCAGATGCCACGACAGCGTCCCCTTCTTCCAACGAC AGTGCGACCAAAGTCGCCGCACCGGAGATCGAATTTTACAACAAGGCTCA GAAATATTGGTCTGAGGTACCGGCGACTGTCAATGGGATGCTCGGCGGCC TGGGCTACATCAGTGCCATCGATATTCAGGGATCGAATACGTTCCTGCGC GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT CGGTCGGGTGACTCGAAATCTCCTGATTCCCCGCTTCAGCTGCGTGGATC TTGTCGAGCAGGATCCCGCGTTTGCCGATAAAGCACGGGAGTACTGCACC TCGAAGGACGGGAGCCGTGGAAAGGTGGGACAGGTCTATAACGTGGGATT GCAGAAGTTTACGCCTACGCAGCAGTACGACCTCGTTTGGAGCCAGTGGG TGCTGGGACATCTCACGGACCGCGATCTGGTCTCGTTCTTTCGGCGCATC AAGCAGGGACTGGCGCCCGGCGGCTTCTTTTGTCTGAAGGAAAACGTGAG CAGCTCGAGGAAGACAGTGGAGGATAAGAATGACTCGTCGGTTACGAGGC CTCTGGACAGCTATGAACACTTCCTAAAAGAAACCGGATTTCGCATTGTA CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTGTTTCCAGTGTACAT GATCGCCTGCAAACCCGTCTCCAAGGAA >D_yakuba_Ntmt-PA ATGACGACTACATTAGAAGCCGAGCTTTCAGACAAGTTACAGATGATGGA CGAGACCACAGACAACGTCCAGGAGCTGGTGAAGCAGGAGGAAGACAGCA GTATAGCCGCAAGCTCCGATGCCCAGACAGCAACCCCTTCTTCCAGCGAT AGTGCTTCCAAAGTTGCAGCACCGGAGCCCGAGTTTTACAATAAAGCTCA GAAGTACTGGTCGGAGATTCCGGCTACTGTCAACGGGATGCTTGGCGGCC TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCTTGCGC GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT CGGTCGGGTGACTCGGAATCTCCTGATCCCACGTTTCAGCTGCGTGGATC TCGTCGAGCAGGATCCTGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC TCGGAAGACGTGAGCCGTGGAAAGGTGGGCCACATCTACAACGTCGGATT GCAAAAGTTCACGCCTTCGCAGCAGTATGACCTCGTTTGGAGCCAATGGG TGCTGGGTCATCTCACAGACCGCGACCTGGTCTCGTTCTTTCGTCGCATC AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTCTGAAGGAAAACGTGAG CAGCTCGAAGAAGGCGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC CTCTGGATAGCTATGAACACTTCCTAAAGGAAGCCGGATTTCGCATTGTG CGCAAGGTCAAACAACAAAACTTTCCCAAGGGACTTTTTCCAGTGTACAT GATCGCCTGCAAACCTGTCTCTAAGGAA >D_erecta_Ntmt-PA ATGCCGACTACATTAGAAGCCCAGCTTTCAGACAAGCTACAGATGATGGA CGAGATCACAGATAACGTCCAAGAGCCGGCGGAGCAGAAGGAAGAAAGCA GTATAGCCGCCAGTTCCGATATTAAGACAGCGTCCACTTCTTCCAGCGAT AGTACGACCAAAACTGACGCACCGGAGCCCGAATTTTACAATAAGGCCCA GAAGTACTGGTCGGAGATTCCGGCCACTGTCAACGGGATGCTCGGCGGCC TGGGCTACATCAGCGCCATCGATATACAGGGATCGAATGTGTTCCTGCGC GAGATCCGCGTGCCGGGCAACAGGTTGGCCCTCGACTGCGGAGCTGGCAT CGGTCGGGTGACTCGCAATCTCCTGATACCCCGCTTCAGCTGCGTAGATC TCGTCGAGCAGGATGCCGCCTTTGCCGAGAAAGCACGGGAGTACTGCACC TCGGAAGAAGTGAGCCGTGGAAAGGTGGGCCAGATCTACAACGTCGGATT GCAAAAGTTCACGCCTTCGCAGCAGTACGACCTCGTTTGGAGCCAATGGG TGCTAGGCCATCTCACGGATCGCGATCTGGTCTCGTTCTTTCGTCGGATC AAGCAGGGACTGGCGCCCGGAGCCTTCTTTTGTATGAAGGAGAACGTGAG CAGCTCCAAAAAGACGGTGGAGGACAAGGAGGACTCCTCCGTTACCAGGC CCCTTGACAGTTATGAGCACTTTCTAAAGGAGGCTGGATTTCGCATTGTG CGCAAGGTCAAGCAACAAAACTTTCCCAAGGGACTTTTTCCAGTATACAT GATCGCCTGCAAACCCGTCTCTAAGGAA
>D_melanogaster_Ntmt-PA MTTTLEEQLSDKLQMMDETTDKVQGSSKQKDDSSIAASSDAKTASPSSSD SSTKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLR EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT SEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRI KQGLAPGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIV RKVKQQNFPKGLFPVYMIACKPVSKE >D_sechellia_Ntmt-PA MRTTLEEQLSDKLQMMDDTTDKVQGSSEQKEDSSIAASSDATTASPSSND SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT SEDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI KQGLAPGGFFCLKENVSSSKKTVEDKNDSSVTRPLDSYEHFLKEAGFRIV RKVKQQNFPKGLFPVYMIACKPVSKE >D_simulans_Ntmt-PA MTTTLEEQLSDKLQMMDDTTDKVQGSSELKEDSSIAASSDATTASPSSND SATKVAAPEIEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNTFLR EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCT SKDGSRGKVGQVYNVGLQKFTPTQQYDLVWSQWVLGHLTDRDLVSFFRRI KQGLAPGGFFCLKENVSSSRKTVEDKNDSSVTRPLDSYEHFLKETGFRIV RKVKQQNFPKGLFPVYMIACKPVSKE >D_yakuba_Ntmt-PA MTTTLEAELSDKLQMMDETTDNVQELVKQEEDSSIAASSDAQTATPSSSD SASKVAAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFAEKAREYCT SEDVSRGKVGHIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI KQGLAPGAFFCLKENVSSSKKAVEDKEDSSVTRPLDSYEHFLKEAGFRIV RKVKQQNFPKGLFPVYMIACKPVSKE >D_erecta_Ntmt-PA MPTTLEAQLSDKLQMMDEITDNVQEPAEQKEESSIAASSDIKTASTSSSD STTKTDAPEPEFYNKAQKYWSEIPATVNGMLGGLGYISAIDIQGSNVFLR EIRVPGNRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDAAFAEKAREYCT SEEVSRGKVGQIYNVGLQKFTPSQQYDLVWSQWVLGHLTDRDLVSFFRRI KQGLAPGAFFCMKENVSSSKKTVEDKEDSSVTRPLDSYEHFLKEAGFRIV RKVKQQNFPKGLFPVYMIACKPVSKE
#NEXUS
[ID: 0932072150]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_Ntmt-PA
D_sechellia_Ntmt-PA
D_simulans_Ntmt-PA
D_yakuba_Ntmt-PA
D_erecta_Ntmt-PA
;
end;
begin trees;
translate
1 D_melanogaster_Ntmt-PA,
2 D_sechellia_Ntmt-PA,
3 D_simulans_Ntmt-PA,
4 D_yakuba_Ntmt-PA,
5 D_erecta_Ntmt-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05060668,(2:0.01109829,3:0.008306288)1.000:0.03509385,(4:0.0587753,5:0.07720141)1.000:0.1212504);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05060668,(2:0.01109829,3:0.008306288):0.03509385,(4:0.0587753,5:0.07720141):0.1212504);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1973.42 -1982.21
2 -1973.09 -1982.06
--------------------------------------
TOTAL -1973.24 -1982.14
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Ntmt-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.374933 0.003232 0.264564 0.480435 0.369938 1276.97 1325.07 1.000
r(A<->C){all} 0.101069 0.000793 0.047157 0.154629 0.098986 848.41 900.31 1.000
r(A<->G){all} 0.292450 0.002609 0.200343 0.396583 0.289384 598.36 766.17 1.001
r(A<->T){all} 0.086027 0.001031 0.027853 0.150188 0.082416 903.47 989.88 1.000
r(C<->G){all} 0.067165 0.000459 0.029942 0.111177 0.065063 890.47 936.09 1.000
r(C<->T){all} 0.385461 0.003123 0.275084 0.490260 0.384191 746.75 794.05 1.001
r(G<->T){all} 0.067828 0.000633 0.022102 0.116987 0.065419 909.67 913.00 1.000
pi(A){all} 0.249291 0.000197 0.221695 0.276218 0.249129 1048.21 1210.93 1.000
pi(C){all} 0.264683 0.000198 0.237316 0.292641 0.265031 1167.30 1207.20 1.001
pi(G){all} 0.287151 0.000221 0.260110 0.317594 0.286916 1093.32 1131.89 1.000
pi(T){all} 0.198875 0.000175 0.173127 0.224392 0.198856 820.01 959.30 1.001
alpha{1,2} 0.055882 0.001615 0.000112 0.127943 0.049388 1183.21 1312.78 1.000
alpha{3} 2.208823 0.672129 0.884970 3.891913 2.080196 1468.81 1484.90 1.000
pinvar{all} 0.289528 0.009824 0.087826 0.475587 0.298077 1212.05 1275.86 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/330/Ntmt-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 276
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 7 8 8 7 8 | Ser TCT 2 2 2 2 2 | Tyr TAT 3 3 3 2 1 | Cys TGT 1 1 1 1 1
TTC 5 5 5 6 5 | TCC 3 3 3 5 6 | TAC 5 5 5 6 7 | TGC 4 4 4 4 4
Leu TTA 1 1 1 2 1 | TCA 2 3 2 1 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 4 2 3 3 2 | TCG 10 7 8 6 5 | TAG 0 0 0 0 0 | Trp TGG 3 3 3 3 3
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 3 3 | Pro CCT 3 4 3 5 1 | His CAT 1 1 1 1 1 | Arg CGT 1 1 1 3 2
CTC 6 5 5 5 6 | CCC 5 5 5 3 6 | CAC 1 1 1 2 1 | CGC 7 7 7 6 7
CTA 1 1 1 1 3 | CCA 1 1 1 2 1 | Gln CAA 4 2 2 4 5 | CGA 1 1 1 0 0
CTG 8 10 10 8 5 | CCG 3 2 3 3 5 | CAG 11 13 12 10 10 | CGG 3 3 3 3 3
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 2 3 | Thr ACT 4 3 3 3 5 | Asn AAT 3 4 4 3 3 | Ser AGT 4 4 4 2 4
ATC 3 7 7 8 8 | ACC 3 3 4 4 3 | AAC 6 6 6 6 6 | AGC 7 7 7 10 8
ATA 5 1 1 2 3 | ACA 3 4 3 4 3 | Lys AAA 4 5 5 5 4 | Arg AGA 0 0 0 0 0
Met ATG 5 5 5 5 6 | ACG 6 6 8 2 4 | AAG 17 15 15 14 16 | AGG 3 3 3 2 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 3 2 | Ala GCT 1 2 2 4 2 | Asp GAT 11 10 10 6 8 | Gly GGT 1 1 1 2 1
GTC 7 7 7 7 7 | GCC 9 8 7 10 12 | GAC 8 9 9 11 8 | GGC 7 7 7 6 7
GTA 3 3 3 0 2 | GCA 4 3 3 5 2 | Glu GAA 7 7 7 7 7 | GGA 9 9 9 8 8
GTG 9 9 9 12 9 | GCG 4 5 5 2 3 | GAG 8 9 8 13 14 | GGG 2 3 3 1 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Ntmt-PA
position 1: T:0.18116 C:0.21014 A:0.27536 G:0.33333
position 2: T:0.25725 C:0.22826 A:0.32246 G:0.19203
position 3: T:0.17754 C:0.31159 A:0.16304 G:0.34783
Average T:0.20531 C:0.25000 A:0.25362 G:0.29106
#2: D_sechellia_Ntmt-PA
position 1: T:0.17029 C:0.21377 A:0.27536 G:0.34058
position 2: T:0.25725 C:0.22101 A:0.32609 G:0.19565
position 3: T:0.18478 C:0.32246 A:0.14855 G:0.34420
Average T:0.20411 C:0.25242 A:0.25000 G:0.29348
#3: D_simulans_Ntmt-PA
position 1: T:0.17391 C:0.21014 A:0.28261 G:0.33333
position 2: T:0.26087 C:0.22464 A:0.31884 G:0.19565
position 3: T:0.18116 C:0.32246 A:0.14130 G:0.35507
Average T:0.20531 C:0.25242 A:0.24758 G:0.29469
#4: D_yakuba_Ntmt-PA
position 1: T:0.17391 C:0.21377 A:0.26087 G:0.35145
position 2: T:0.26812 C:0.22101 A:0.32609 G:0.18478
position 3: T:0.17754 C:0.35870 A:0.14855 G:0.31522
Average T:0.20652 C:0.26449 A:0.24517 G:0.28382
#5: D_erecta_Ntmt-PA
position 1: T:0.16667 C:0.21377 A:0.28261 G:0.33696
position 2: T:0.26449 C:0.22101 A:0.32971 G:0.18478
position 3: T:0.17029 C:0.36594 A:0.14493 G:0.31884
Average T:0.20048 C:0.26691 A:0.25242 G:0.28019
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 38 | Ser S TCT 10 | Tyr Y TAT 12 | Cys C TGT 5
TTC 26 | TCC 20 | TAC 28 | TGC 20
Leu L TTA 6 | TCA 9 | *** * TAA 0 | *** * TGA 0
TTG 14 | TCG 36 | TAG 0 | Trp W TGG 15
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 16 | His H CAT 5 | Arg R CGT 8
CTC 27 | CCC 24 | CAC 6 | CGC 34
CTA 7 | CCA 6 | Gln Q CAA 17 | CGA 3
CTG 41 | CCG 16 | CAG 56 | CGG 15
------------------------------------------------------------------------------
Ile I ATT 14 | Thr T ACT 18 | Asn N AAT 17 | Ser S AGT 18
ATC 33 | ACC 17 | AAC 30 | AGC 39
ATA 12 | ACA 17 | Lys K AAA 23 | Arg R AGA 0
Met M ATG 26 | ACG 26 | AAG 77 | AGG 13
------------------------------------------------------------------------------
Val V GTT 11 | Ala A GCT 11 | Asp D GAT 45 | Gly G GGT 6
GTC 35 | GCC 46 | GAC 45 | GGC 34
GTA 11 | GCA 17 | Glu E GAA 35 | GGA 43
GTG 48 | GCG 19 | GAG 52 | GGG 10
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17319 C:0.21232 A:0.27536 G:0.33913
position 2: T:0.26159 C:0.22319 A:0.32464 G:0.19058
position 3: T:0.17826 C:0.33623 A:0.14928 G:0.33623
Average T:0.20435 C:0.25725 A:0.24976 G:0.28865
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Ntmt-PA
D_sechellia_Ntmt-PA 0.1355 (0.0258 0.1902)
D_simulans_Ntmt-PA 0.1873 (0.0307 0.1640) 0.2557 (0.0080 0.0311)
D_yakuba_Ntmt-PA 0.0959 (0.0423 0.4405) 0.1307 (0.0506 0.3874) 0.1476 (0.0558 0.3778)
D_erecta_Ntmt-PA 0.1156 (0.0497 0.4300) 0.1394 (0.0556 0.3990) 0.1602 (0.0616 0.3848) 0.1493 (0.0379 0.2540)
Model 0: one-ratio
TREE # 1: (1, (2, 3), (4, 5)); MP score: 153
lnL(ntime: 7 np: 9): -1882.665176 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.093059 0.082392 0.021430 0.019495 0.187676 0.117947 0.153539 2.271830 0.134877
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.67554
(1: 0.093059, (2: 0.021430, 3: 0.019495): 0.082392, (4: 0.117947, 5: 0.153539): 0.187676);
(D_melanogaster_Ntmt-PA: 0.093059, (D_sechellia_Ntmt-PA: 0.021430, D_simulans_Ntmt-PA: 0.019495): 0.082392, (D_yakuba_Ntmt-PA: 0.117947, D_erecta_Ntmt-PA: 0.153539): 0.187676);
Detailed output identifying parameters
kappa (ts/tv) = 2.27183
omega (dN/dS) = 0.13488
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.093 632.9 195.1 0.1349 0.0123 0.0916 7.8 17.9
6..7 0.082 632.9 195.1 0.1349 0.0109 0.0811 6.9 15.8
7..2 0.021 632.9 195.1 0.1349 0.0028 0.0211 1.8 4.1
7..3 0.019 632.9 195.1 0.1349 0.0026 0.0192 1.6 3.7
6..8 0.188 632.9 195.1 0.1349 0.0249 0.1847 15.8 36.0
8..4 0.118 632.9 195.1 0.1349 0.0157 0.1161 9.9 22.6
8..5 0.154 632.9 195.1 0.1349 0.0204 0.1511 12.9 29.5
tree length for dN: 0.0897
tree length for dS: 0.6647
Time used: 0:03
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 153
lnL(ntime: 7 np: 10): -1878.084473 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.095970 0.081003 0.021569 0.019290 0.195357 0.120974 0.154224 2.319372 0.912685 0.073951
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68839
(1: 0.095970, (2: 0.021569, 3: 0.019290): 0.081003, (4: 0.120974, 5: 0.154224): 0.195357);
(D_melanogaster_Ntmt-PA: 0.095970, (D_sechellia_Ntmt-PA: 0.021569, D_simulans_Ntmt-PA: 0.019290): 0.081003, (D_yakuba_Ntmt-PA: 0.120974, D_erecta_Ntmt-PA: 0.154224): 0.195357);
Detailed output identifying parameters
kappa (ts/tv) = 2.31937
dN/dS (w) for site classes (K=2)
p: 0.91268 0.08732
w: 0.07395 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.096 632.3 195.7 0.1548 0.0140 0.0902 8.8 17.7
6..7 0.081 632.3 195.7 0.1548 0.0118 0.0761 7.5 14.9
7..2 0.022 632.3 195.7 0.1548 0.0031 0.0203 2.0 4.0
7..3 0.019 632.3 195.7 0.1548 0.0028 0.0181 1.8 3.5
6..8 0.195 632.3 195.7 0.1548 0.0284 0.1836 18.0 35.9
8..4 0.121 632.3 195.7 0.1548 0.0176 0.1137 11.1 22.3
8..5 0.154 632.3 195.7 0.1548 0.0224 0.1450 14.2 28.4
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 153
lnL(ntime: 7 np: 12): -1878.084473 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.095970 0.081003 0.021569 0.019290 0.195357 0.120974 0.154224 2.319372 0.912685 0.015823 0.073951 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68839
(1: 0.095970, (2: 0.021569, 3: 0.019290): 0.081003, (4: 0.120974, 5: 0.154224): 0.195357);
(D_melanogaster_Ntmt-PA: 0.095970, (D_sechellia_Ntmt-PA: 0.021569, D_simulans_Ntmt-PA: 0.019290): 0.081003, (D_yakuba_Ntmt-PA: 0.120974, D_erecta_Ntmt-PA: 0.154224): 0.195357);
Detailed output identifying parameters
kappa (ts/tv) = 2.31937
dN/dS (w) for site classes (K=3)
p: 0.91268 0.01582 0.07149
w: 0.07395 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.096 632.3 195.7 0.1548 0.0140 0.0902 8.8 17.7
6..7 0.081 632.3 195.7 0.1548 0.0118 0.0761 7.5 14.9
7..2 0.022 632.3 195.7 0.1548 0.0031 0.0203 2.0 4.0
7..3 0.019 632.3 195.7 0.1548 0.0028 0.0181 1.8 3.5
6..8 0.195 632.3 195.7 0.1548 0.0284 0.1836 18.0 35.9
8..4 0.121 632.3 195.7 0.1548 0.0176 0.1137 11.1 22.3
8..5 0.154 632.3 195.7 0.1548 0.0224 0.1450 14.2 28.4
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ntmt-PA)
Pr(w>1) post mean +- SE for w
60 S 0.565 1.340 +- 0.452
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.968 0.032 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.918 0.064 0.010 0.003 0.002 0.001 0.001 0.001 0.000 0.000
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.304
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.280 0.411
sum of density on p0-p1 = 1.000000
Time used: 0:13
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 153
lnL(ntime: 7 np: 13): -1876.899906 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.094387 0.082043 0.021679 0.019185 0.192610 0.119084 0.154229 2.295148 0.413602 0.222623 0.000001 0.000001 0.387595
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68322
(1: 0.094387, (2: 0.021679, 3: 0.019185): 0.082043, (4: 0.119084, 5: 0.154229): 0.192610);
(D_melanogaster_Ntmt-PA: 0.094387, (D_sechellia_Ntmt-PA: 0.021679, D_simulans_Ntmt-PA: 0.019185): 0.082043, (D_yakuba_Ntmt-PA: 0.119084, D_erecta_Ntmt-PA: 0.154229): 0.192610);
Detailed output identifying parameters
kappa (ts/tv) = 2.29515
dN/dS (w) for site classes (K=3)
p: 0.41360 0.22262 0.36378
w: 0.00000 0.00000 0.38759
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.094 632.6 195.4 0.1410 0.0129 0.0915 8.2 17.9
6..7 0.082 632.6 195.4 0.1410 0.0112 0.0796 7.1 15.5
7..2 0.022 632.6 195.4 0.1410 0.0030 0.0210 1.9 4.1
7..3 0.019 632.6 195.4 0.1410 0.0026 0.0186 1.7 3.6
6..8 0.193 632.6 195.4 0.1410 0.0263 0.1868 16.7 36.5
8..4 0.119 632.6 195.4 0.1410 0.0163 0.1155 10.3 22.6
8..5 0.154 632.6 195.4 0.1410 0.0211 0.1496 13.3 29.2
Naive Empirical Bayes (NEB) analysis
Time used: 0:18
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 153
lnL(ntime: 7 np: 10): -1877.119905 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.094757 0.081772 0.021625 0.019228 0.193236 0.119544 0.154243 2.294044 0.256921 1.509861
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68441
(1: 0.094757, (2: 0.021625, 3: 0.019228): 0.081772, (4: 0.119544, 5: 0.154243): 0.193236);
(D_melanogaster_Ntmt-PA: 0.094757, (D_sechellia_Ntmt-PA: 0.021625, D_simulans_Ntmt-PA: 0.019228): 0.081772, (D_yakuba_Ntmt-PA: 0.119544, D_erecta_Ntmt-PA: 0.154243): 0.193236);
Detailed output identifying parameters
kappa (ts/tv) = 2.29404
Parameters in M7 (beta):
p = 0.25692 q = 1.50986
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00001 0.00036 0.00263 0.00978 0.02619 0.05794 0.11364 0.20647 0.36061 0.64263
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.095 632.6 195.4 0.1420 0.0130 0.0917 8.2 17.9
6..7 0.082 632.6 195.4 0.1420 0.0112 0.0791 7.1 15.5
7..2 0.022 632.6 195.4 0.1420 0.0030 0.0209 1.9 4.1
7..3 0.019 632.6 195.4 0.1420 0.0026 0.0186 1.7 3.6
6..8 0.193 632.6 195.4 0.1420 0.0266 0.1870 16.8 36.5
8..4 0.120 632.6 195.4 0.1420 0.0164 0.1157 10.4 22.6
8..5 0.154 632.6 195.4 0.1420 0.0212 0.1492 13.4 29.2
Time used: 0:31
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 153
check convergence..
lnL(ntime: 7 np: 12): -1877.119945 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.094757 0.081772 0.021625 0.019228 0.193236 0.119544 0.154243 2.294047 0.999990 0.256932 1.510011 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.68441
(1: 0.094757, (2: 0.021625, 3: 0.019228): 0.081772, (4: 0.119544, 5: 0.154243): 0.193236);
(D_melanogaster_Ntmt-PA: 0.094757, (D_sechellia_Ntmt-PA: 0.021625, D_simulans_Ntmt-PA: 0.019228): 0.081772, (D_yakuba_Ntmt-PA: 0.119544, D_erecta_Ntmt-PA: 0.154243): 0.193236);
Detailed output identifying parameters
kappa (ts/tv) = 2.29405
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.25693 q = 1.51001
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00001 0.00036 0.00263 0.00978 0.02619 0.05794 0.11364 0.20646 0.36058 0.64260 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.095 632.6 195.4 0.1420 0.0130 0.0917 8.2 17.9
6..7 0.082 632.6 195.4 0.1420 0.0112 0.0791 7.1 15.5
7..2 0.022 632.6 195.4 0.1420 0.0030 0.0209 1.9 4.1
7..3 0.019 632.6 195.4 0.1420 0.0026 0.0186 1.7 3.6
6..8 0.193 632.6 195.4 0.1420 0.0266 0.1870 16.8 36.5
8..4 0.120 632.6 195.4 0.1420 0.0164 0.1157 10.4 22.6
8..5 0.154 632.6 195.4 0.1420 0.0212 0.1492 13.4 29.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ntmt-PA)
Pr(w>1) post mean +- SE for w
26 S 0.565 1.090 +- 0.567
27 S 0.558 1.081 +- 0.570
41 A 0.508 1.020 +- 0.578
52 S 0.527 1.043 +- 0.578
55 V 0.561 1.085 +- 0.569
60 S 0.783 1.351 +- 0.434
97 V 0.519 1.033 +- 0.578
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.973 0.027 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.001 0.025 0.090 0.154 0.185 0.189 0.181 0.174
ws: 0.961 0.036 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000
Time used: 0:58
Model 1: NearlyNeutral -1878.084473 Model 2: PositiveSelection -1878.084473 Model 0: one-ratio -1882.665176 Model 3: discrete -1876.899906 Model 7: beta -1877.119905 Model 8: beta&w>1 -1877.119945 Model 0 vs 1 9.16140600000017 Model 2 vs 1 0.0 Model 8 vs 7 7.999999979801942E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
