--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Nov 24 15:36:19 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/330/Ntf-2r-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1075.67 -1084.97
2 -1075.93 -1088.14
--------------------------------------
TOTAL -1075.79 -1087.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.355865 0.002350 0.263453 0.451483 0.352930 1423.38 1457.80 1.000
r(A<->C){all} 0.166155 0.001634 0.089403 0.242955 0.162820 703.43 786.80 1.000
r(A<->G){all} 0.176313 0.001952 0.091315 0.259524 0.172833 697.67 824.54 1.000
r(A<->T){all} 0.100932 0.001293 0.034550 0.170886 0.097050 809.10 829.66 1.001
r(C<->G){all} 0.119717 0.001234 0.053541 0.186046 0.116557 844.10 971.15 1.000
r(C<->T){all} 0.361729 0.003250 0.249884 0.468734 0.358848 827.51 874.50 1.004
r(G<->T){all} 0.075154 0.000922 0.023789 0.137031 0.071469 831.66 851.40 1.002
pi(A){all} 0.254300 0.000416 0.213083 0.293189 0.253775 979.68 1175.25 1.000
pi(C){all} 0.270257 0.000409 0.233519 0.311621 0.269294 1049.58 1080.26 1.004
pi(G){all} 0.240103 0.000413 0.200019 0.279843 0.239742 1293.32 1397.16 1.001
pi(T){all} 0.235340 0.000413 0.196213 0.274689 0.235092 1282.18 1363.09 1.000
alpha{1,2} 0.318771 0.051775 0.000518 0.719519 0.265575 1389.31 1442.13 1.000
alpha{3} 1.734423 0.529780 0.568419 3.193125 1.597159 1367.20 1384.34 1.000
pinvar{all} 0.103088 0.006910 0.000016 0.262699 0.083518 1243.91 1360.80 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1023.443183
Model 2: PositiveSelection -1023.376892
Model 0: one-ratio -1026.986289
Model 3: discrete -1023.376892
Model 7: beta -1024.6302
Model 8: beta&w>1 -1023.421887
Model 0 vs 1 7.086211999999932
Model 2 vs 1 0.13258199999995668
Model 8 vs 7 2.4166260000001785
>C1
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA
>C2
MSLNPQYEEIGKGFVQQYYAILDDLANRENAVNFYSVTDSFMTFEGHQIQ
GAPKILEKVQSLRFQKISIVITTVDSQPTFDGGVLIFVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C3
MSLNPQYEEIGKGFVQQYYAIFDDPVNRENVVHFYSATDSFMTFEGRQIQ
GAPKILEKVQSLSFQKISIVITTVDSQPTFDGGVLISVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C4
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AYSQVFVLKANAGTFFVAHDIFRLNIHNSA
>C5
MSLNPQYEDIGKGFVQQFYGIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSA
>C6
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFLLKANAGTFFVAHDIFRLNIHNSA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
C1 MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
C2 MSLNPQYEEIGKGFVQQYYAILDDLANRENAVNFYSVTDSFMTFEGHQIQ
C3 MSLNPQYEEIGKGFVQQYYAIFDDPVNRENVVHFYSATDSFMTFEGRQIQ
C4 MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
C5 MSLNPQYEDIGKGFVQQFYGIFDDPANRANVVNFYSATDSFMTFEGHQIQ
C6 MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
**** ***:*** ****:*.*:** .** *.::**..*********.***
C1 GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
C2 GAPKILEKVQSLRFQKISIVITTVDSQPTFDGGVLIFVLGRLKCDDDPPH
C3 GAPKILEKVQSLSFQKISIVITTVDSQPTFDGGVLISVLGRLKCDDDPPH
C4 GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
C5 GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
C6 GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
************ **** ********** ****** *****:*******
C1 AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA
C2 SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
C3 SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
C4 AYSQVFVLKANAGTFFVAHDIFRLNIHNSA
C5 AFSQVFFLKANAGTFFVAHDIFRLNIHNSA
C6 AFSQVFLLKANAGTFFVAHDIFRLNIHNSA
::**:*.**.*.*:::**************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 130 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 130 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3900]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [3900]--->[3900]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.306 Mb, Max= 30.513 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA
>C2
MSLNPQYEEIGKGFVQQYYAILDDLANRENAVNFYSVTDSFMTFEGHQIQ
GAPKILEKVQSLRFQKISIVITTVDSQPTFDGGVLIFVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C3
MSLNPQYEEIGKGFVQQYYAIFDDPVNRENVVHFYSATDSFMTFEGRQIQ
GAPKILEKVQSLSFQKISIVITTVDSQPTFDGGVLISVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C4
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AYSQVFVLKANAGTFFVAHDIFRLNIHNSA
>C5
MSLNPQYEDIGKGFVQQFYGIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSA
>C6
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFLLKANAGTFFVAHDIFRLNIHNSA
FORMAT of file /tmp/tmp2729306783521256550aln Not Supported[FATAL:T-COFFEE]
>C1
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA
>C2
MSLNPQYEEIGKGFVQQYYAILDDLANRENAVNFYSVTDSFMTFEGHQIQ
GAPKILEKVQSLRFQKISIVITTVDSQPTFDGGVLIFVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C3
MSLNPQYEEIGKGFVQQYYAIFDDPVNRENVVHFYSATDSFMTFEGRQIQ
GAPKILEKVQSLSFQKISIVITTVDSQPTFDGGVLISVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C4
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AYSQVFVLKANAGTFFVAHDIFRLNIHNSA
>C5
MSLNPQYEDIGKGFVQQFYGIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSA
>C6
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFLLKANAGTFFVAHDIFRLNIHNSA
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:130 S:100 BS:130
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 86.15 C1 C2 86.15
TOP 1 0 86.15 C2 C1 86.15
BOT 0 2 88.46 C1 C3 88.46
TOP 2 0 88.46 C3 C1 88.46
BOT 0 3 86.92 C1 C4 86.92
TOP 3 0 86.92 C4 C1 86.92
BOT 0 4 86.15 C1 C5 86.15
TOP 4 0 86.15 C5 C1 86.15
BOT 0 5 88.46 C1 C6 88.46
TOP 5 0 88.46 C6 C1 88.46
BOT 1 2 93.08 C2 C3 93.08
TOP 2 1 93.08 C3 C2 93.08
BOT 1 3 85.38 C2 C4 85.38
TOP 3 1 85.38 C4 C2 85.38
BOT 1 4 84.62 C2 C5 84.62
TOP 4 1 84.62 C5 C2 84.62
BOT 1 5 86.92 C2 C6 86.92
TOP 5 1 86.92 C6 C2 86.92
BOT 2 3 86.92 C3 C4 86.92
TOP 3 2 86.92 C4 C3 86.92
BOT 2 4 86.15 C3 C5 86.15
TOP 4 2 86.15 C5 C3 86.15
BOT 2 5 88.46 C3 C6 88.46
TOP 5 2 88.46 C6 C3 88.46
BOT 3 4 96.15 C4 C5 96.15
TOP 4 3 96.15 C5 C4 96.15
BOT 3 5 97.69 C4 C6 97.69
TOP 5 3 97.69 C6 C4 97.69
BOT 4 5 97.69 C5 C6 97.69
TOP 5 4 97.69 C6 C5 97.69
AVG 0 C1 * 87.23
AVG 1 C2 * 87.23
AVG 2 C3 * 88.62
AVG 3 C4 * 90.62
AVG 4 C5 * 90.15
AVG 5 C6 * 91.85
TOT TOT * 89.28
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCTCTGAATCTGCAGTACGAGGACATTGGCAAGGAATTTGTCCAGCA
C2 ATGTCGCTGAATCCGCAGTACGAGGAAATTGGAAAGGGATTTGTCCAGCA
C3 ATGTCGCTGAATCCGCAGTACGAGGAAATTGGAAAGGGGTTTGTCCAGCA
C4 ATGTCGCTGAATCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA
C5 ATGTCGCTGAACCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA
C6 ATGTCGCTGAATCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA
***** ***** * ************.*****.****..***** *****
C1 GTACTACGCCATATTCGATGACCCGGCGAATCGGGAGAACGTGATTAATT
C2 GTACTACGCCATATTGGATGACCTGGCGAATCGGGAGAACGCGGTTAATT
C3 GTACTACGCCATATTCGATGACCCGGTGAATCGGGAGAACGTGGTTCATT
C4 GTACTATGCGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT
C5 GTTCTATGGGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT
C6 GTACTATGCGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT
**:*** * ***** ******* ** ********.***** *.**.***
C1 TCTATAACGCTACCGACTCTTTCATGACCTTTGAAGGCAACCAAATACAG
C2 TCTATAGCGTTACCGACTCTTTCATGACCTTTGAAGGCCACCAAATACAG
C3 TCTATAGCGCTACCGACTCTTTCATGACCTTTGAAGGCCGCCAAATACAG
C4 TCTACAGCGCTACAGACTCTTTCATGACCTTTGAGGGCCACCAAATACAG
C5 TCTACAGCGCTACCGACTCGTTCATGACCTTTGAAGGCCACCAAATTCAG
C6 TCTACAGCGCTACCGACTCCTTCATGACCTTTGAAGGTCACCAAATTCAG
**** *.** ***.***** **************.** ..******:***
C1 GGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
C2 GGAGCACCCAAGATTTTGGAAAAAGTTCAGAGCCTGAGATTTCAGAAGAT
C3 GGAGCACCCAAGATTTTGGAAAAAGTTCAGAGCCTGAGCTTTCAGAAGAT
C4 GGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
C5 GGCGCGCCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
C6 GGTGCACCTAAGATCCTCGAGAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
** **.** ***** * **.*********** *****.***********
C1 TGCCAGAGTGATAACCACAGTGGATTCGCAGCCAACTTCCGATGGCGGAG
C2 TAGCATAGTGATAACCACAGTGGATTCGCAGCCAACTTTCGATGGCGGAG
C3 TAGCATAGTGATAACCACAGTGGATTCGCAGCCAACTTTCGATGGCGGAG
C4 TACCAGAGTGATAACCACAGTGGACTCGCAGCCTACCTTCGATGGCGGAG
C5 TAACAGAGTGATAACCACAGTGGACTCGCAGCCTACTTTCGATGGCGGGG
C6 CAACCGTGTGATAACCACAGTGGATTCGCAGCCCACATTCGACGGTGGAG
. *. :***************** ******** ** * *** ** **.*
C1 TTCTGATCATCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT
C2 TTCTGATCTTCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT
C3 TTCTGATCTCCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT
C4 TTCTGATCAACGTCCTTGGAAGACTACAGTGCGATGACGATCCCCCACAC
C5 TTTTGATCAACGTCCTTGGAAGACTGCAGTGCGATGACGATCCACCACAC
C6 TGCTAATCAATGTCCTCGGAAGACTACAGTGCGATGATGATCCCCCGCAC
* *.***: ***** ********..*.******** *****.**.**
C1 GCATTCTCGCAGATCTTTTTGCTGAAGCCCAACGGAGGATCCCTCTTCGT
C2 TCCTTCTCGCAGATCTTTTTGCTGAAGCCGAACGGAGGATCCTTCTTGGT
C3 TCCTTCTCGCAGATCTTTTTGCTGAAGCCGAACGGAGGATCCTTCCTTGT
C4 GCCTACTCGCAGGTCTTTGTCCTGAAGGCCAACGCAGGCACCTTCTTCGT
C5 GCCTTCTCACAGGTCTTCTTCCTGAAGGCCAACGCAGGAACATTCTTCGT
C6 GCCTTCTCGCAGGTATTTTTGCTAAAGGCCAACGCCGGCACCTTCTTCGT
*.*:***.***.*.** * **.*** * **** .**.:*. ** * **
C1 GGCTCACGACATCTTCCGTCTGAACATCCACAACTCTGCC
C2 GGCCCACGACATCTTCCGCCTCAACATCCACAACTCTGCC
C3 GGCCCACGACATCTTCCGTCTCAACATCCACAACTCTGCC
C4 GGCCCACGACATCTTCCGCCTGAACATCCACAACTCTGCC
C5 GGCCCACGACATCTTCCGCCTCAACATCCACAACTCTGCC
C6 GGCCCACGACATCTTCCGTCTCAACATCCACAACTCTGCC
*** ************** ** ******************
>C1
ATGTCTCTGAATCTGCAGTACGAGGACATTGGCAAGGAATTTGTCCAGCA
GTACTACGCCATATTCGATGACCCGGCGAATCGGGAGAACGTGATTAATT
TCTATAACGCTACCGACTCTTTCATGACCTTTGAAGGCAACCAAATACAG
GGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
TGCCAGAGTGATAACCACAGTGGATTCGCAGCCAACTTCCGATGGCGGAG
TTCTGATCATCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT
GCATTCTCGCAGATCTTTTTGCTGAAGCCCAACGGAGGATCCCTCTTCGT
GGCTCACGACATCTTCCGTCTGAACATCCACAACTCTGCC
>C2
ATGTCGCTGAATCCGCAGTACGAGGAAATTGGAAAGGGATTTGTCCAGCA
GTACTACGCCATATTGGATGACCTGGCGAATCGGGAGAACGCGGTTAATT
TCTATAGCGTTACCGACTCTTTCATGACCTTTGAAGGCCACCAAATACAG
GGAGCACCCAAGATTTTGGAAAAAGTTCAGAGCCTGAGATTTCAGAAGAT
TAGCATAGTGATAACCACAGTGGATTCGCAGCCAACTTTCGATGGCGGAG
TTCTGATCTTCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT
TCCTTCTCGCAGATCTTTTTGCTGAAGCCGAACGGAGGATCCTTCTTGGT
GGCCCACGACATCTTCCGCCTCAACATCCACAACTCTGCC
>C3
ATGTCGCTGAATCCGCAGTACGAGGAAATTGGAAAGGGGTTTGTCCAGCA
GTACTACGCCATATTCGATGACCCGGTGAATCGGGAGAACGTGGTTCATT
TCTATAGCGCTACCGACTCTTTCATGACCTTTGAAGGCCGCCAAATACAG
GGAGCACCCAAGATTTTGGAAAAAGTTCAGAGCCTGAGCTTTCAGAAGAT
TAGCATAGTGATAACCACAGTGGATTCGCAGCCAACTTTCGATGGCGGAG
TTCTGATCTCCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT
TCCTTCTCGCAGATCTTTTTGCTGAAGCCGAACGGAGGATCCTTCCTTGT
GGCCCACGACATCTTCCGTCTCAACATCCACAACTCTGCC
>C4
ATGTCGCTGAATCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA
GTACTATGCGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT
TCTACAGCGCTACAGACTCTTTCATGACCTTTGAGGGCCACCAAATACAG
GGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
TACCAGAGTGATAACCACAGTGGACTCGCAGCCTACCTTCGATGGCGGAG
TTCTGATCAACGTCCTTGGAAGACTACAGTGCGATGACGATCCCCCACAC
GCCTACTCGCAGGTCTTTGTCCTGAAGGCCAACGCAGGCACCTTCTTCGT
GGCCCACGACATCTTCCGCCTGAACATCCACAACTCTGCC
>C5
ATGTCGCTGAACCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA
GTTCTATGGGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT
TCTACAGCGCTACCGACTCGTTCATGACCTTTGAAGGCCACCAAATTCAG
GGCGCGCCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
TAACAGAGTGATAACCACAGTGGACTCGCAGCCTACTTTCGATGGCGGGG
TTTTGATCAACGTCCTTGGAAGACTGCAGTGCGATGACGATCCACCACAC
GCCTTCTCACAGGTCTTCTTCCTGAAGGCCAACGCAGGAACATTCTTCGT
GGCCCACGACATCTTCCGCCTCAACATCCACAACTCTGCC
>C6
ATGTCGCTGAATCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA
GTACTATGCGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT
TCTACAGCGCTACCGACTCCTTCATGACCTTTGAAGGTCACCAAATTCAG
GGTGCACCTAAGATCCTCGAGAAAGTTCAGAGTCTGAGCTTTCAGAAGAT
CAACCGTGTGATAACCACAGTGGATTCGCAGCCCACATTCGACGGTGGAG
TGCTAATCAATGTCCTCGGAAGACTACAGTGCGATGATGATCCCCCGCAC
GCCTTCTCGCAGGTATTTTTGCTAAAGGCCAACGCCGGCACCTTCTTCGT
GGCCCACGACATCTTCCGTCTCAACATCCACAACTCTGCC
>C1
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA
>C2
MSLNPQYEEIGKGFVQQYYAILDDLANRENAVNFYSVTDSFMTFEGHQIQ
GAPKILEKVQSLRFQKISIVITTVDSQPTFDGGVLIFVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C3
MSLNPQYEEIGKGFVQQYYAIFDDPVNRENVVHFYSATDSFMTFEGRQIQ
GAPKILEKVQSLSFQKISIVITTVDSQPTFDGGVLISVLGRLKCDDDPPH
SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
>C4
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AYSQVFVLKANAGTFFVAHDIFRLNIHNSA
>C5
MSLNPQYEDIGKGFVQQFYGIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFFLKANAGTFFVAHDIFRLNIHNSA
>C6
MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
AFSQVFLLKANAGTFFVAHDIFRLNIHNSA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 390 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480001509
Setting output file names to "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 485003761
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0903319364
Seed = 1179249799
Swapseed = 1480001509
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 20 unique site patterns
Division 2 has 19 unique site patterns
Division 3 has 43 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1316.749312 -- -24.965149
Chain 2 -- -1241.468941 -- -24.965149
Chain 3 -- -1229.620139 -- -24.965149
Chain 4 -- -1312.196680 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1271.202922 -- -24.965149
Chain 2 -- -1316.749312 -- -24.965149
Chain 3 -- -1309.149250 -- -24.965149
Chain 4 -- -1272.552136 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1316.749] (-1241.469) (-1229.620) (-1312.197) * [-1271.203] (-1316.749) (-1309.149) (-1272.552)
500 -- [-1084.260] (-1087.943) (-1084.848) (-1092.390) * [-1086.703] (-1088.937) (-1093.698) (-1088.072) -- 0:00:00
1000 -- (-1079.735) (-1084.195) [-1088.902] (-1088.017) * (-1085.901) (-1083.122) (-1089.489) [-1079.164] -- 0:00:00
1500 -- (-1079.930) (-1081.350) [-1084.464] (-1078.991) * (-1080.337) (-1081.971) (-1086.988) [-1084.532] -- 0:00:00
2000 -- (-1080.035) (-1080.526) [-1078.899] (-1078.991) * [-1084.132] (-1085.285) (-1081.147) (-1085.380) -- 0:00:00
2500 -- [-1074.233] (-1085.175) (-1083.667) (-1076.988) * [-1079.501] (-1082.524) (-1084.822) (-1083.013) -- 0:00:00
3000 -- [-1084.562] (-1074.242) (-1080.390) (-1080.955) * (-1086.347) [-1078.037] (-1084.304) (-1084.889) -- 0:00:00
3500 -- [-1079.601] (-1081.341) (-1087.098) (-1083.870) * (-1079.562) (-1077.912) (-1081.782) [-1079.608] -- 0:00:00
4000 -- (-1081.956) [-1078.077] (-1090.290) (-1084.159) * (-1080.829) (-1079.999) [-1080.177] (-1081.422) -- 0:04:09
4500 -- (-1077.490) (-1083.923) (-1083.706) [-1078.669] * (-1080.599) [-1073.123] (-1081.253) (-1079.237) -- 0:03:41
5000 -- (-1077.302) (-1081.423) (-1081.366) [-1076.982] * (-1087.947) (-1081.300) (-1077.241) [-1079.887] -- 0:03:19
Average standard deviation of split frequencies: 0.062854
5500 -- (-1074.633) [-1078.433] (-1088.317) (-1079.764) * (-1081.037) [-1077.242] (-1074.278) (-1082.371) -- 0:03:00
6000 -- (-1079.192) (-1078.941) (-1084.123) [-1080.889] * [-1081.752] (-1078.316) (-1076.288) (-1084.192) -- 0:02:45
6500 -- (-1081.068) [-1077.422] (-1083.412) (-1080.554) * (-1085.129) (-1080.577) [-1077.897] (-1083.400) -- 0:02:32
7000 -- (-1080.317) (-1091.371) [-1078.368] (-1082.396) * (-1088.432) (-1076.847) (-1075.472) [-1081.818] -- 0:02:21
7500 -- (-1074.325) (-1076.627) (-1088.553) [-1084.732] * (-1082.176) (-1085.249) (-1075.677) [-1080.312] -- 0:02:12
8000 -- (-1087.360) (-1075.996) [-1080.353] (-1081.932) * (-1079.058) (-1078.678) (-1082.728) [-1075.241] -- 0:02:04
8500 -- (-1077.088) [-1076.825] (-1081.216) (-1084.729) * (-1075.104) [-1084.275] (-1076.566) (-1082.813) -- 0:01:56
9000 -- (-1079.220) [-1075.594] (-1083.481) (-1074.540) * [-1076.686] (-1089.256) (-1075.879) (-1078.730) -- 0:03:40
9500 -- (-1080.480) [-1078.815] (-1079.528) (-1082.124) * [-1077.313] (-1084.612) (-1081.412) (-1081.175) -- 0:03:28
10000 -- (-1086.339) [-1077.465] (-1082.109) (-1084.069) * (-1075.042) (-1081.489) (-1080.362) [-1088.681] -- 0:03:18
Average standard deviation of split frequencies: 0.035355
10500 -- (-1081.320) (-1075.255) [-1084.590] (-1078.639) * (-1083.002) (-1077.643) [-1077.710] (-1085.415) -- 0:03:08
11000 -- (-1081.448) (-1074.682) (-1087.743) [-1079.788] * (-1078.327) (-1080.112) (-1079.038) [-1080.774] -- 0:02:59
11500 -- (-1080.121) (-1078.252) (-1086.707) [-1088.603] * (-1084.348) [-1081.291] (-1086.601) (-1082.373) -- 0:02:51
12000 -- [-1079.948] (-1077.702) (-1085.693) (-1085.134) * (-1078.115) (-1084.461) (-1080.493) [-1080.858] -- 0:02:44
12500 -- (-1081.637) (-1080.066) [-1086.166] (-1092.304) * (-1085.428) (-1087.757) [-1081.935] (-1085.692) -- 0:02:38
13000 -- [-1082.517] (-1082.415) (-1091.177) (-1081.825) * [-1080.887] (-1087.126) (-1080.121) (-1086.727) -- 0:02:31
13500 -- (-1090.643) [-1081.191] (-1082.035) (-1088.206) * (-1081.867) [-1087.698] (-1074.922) (-1084.389) -- 0:02:26
14000 -- (-1078.685) (-1079.047) [-1077.881] (-1086.449) * (-1093.302) (-1088.682) (-1080.245) [-1073.349] -- 0:02:20
14500 -- (-1084.990) [-1078.442] (-1078.116) (-1080.225) * (-1084.813) (-1086.261) [-1074.164] (-1076.873) -- 0:03:23
15000 -- (-1082.275) [-1076.871] (-1083.755) (-1085.865) * (-1080.240) [-1079.664] (-1083.009) (-1073.345) -- 0:03:17
Average standard deviation of split frequencies: 0.035355
15500 -- (-1078.041) [-1079.936] (-1079.771) (-1077.228) * [-1078.588] (-1080.293) (-1080.350) (-1077.241) -- 0:03:10
16000 -- (-1077.193) (-1080.797) (-1077.906) [-1079.513] * [-1076.513] (-1079.536) (-1080.217) (-1083.109) -- 0:03:04
16500 -- (-1083.400) (-1078.489) (-1080.612) [-1079.778] * [-1083.187] (-1086.886) (-1083.925) (-1081.329) -- 0:02:58
17000 -- (-1075.543) (-1079.411) [-1075.477] (-1085.764) * (-1094.168) (-1077.684) [-1073.790] (-1079.558) -- 0:02:53
17500 -- (-1083.462) (-1076.850) [-1079.505] (-1082.570) * (-1073.289) [-1078.381] (-1079.394) (-1075.682) -- 0:02:48
18000 -- [-1077.462] (-1080.796) (-1080.374) (-1086.920) * (-1076.599) [-1073.885] (-1082.159) (-1076.807) -- 0:02:43
18500 -- (-1075.302) (-1081.408) [-1080.095] (-1080.005) * (-1082.762) (-1082.089) [-1083.896] (-1080.131) -- 0:02:39
19000 -- (-1078.776) [-1082.557] (-1075.923) (-1081.198) * [-1075.576] (-1077.958) (-1085.705) (-1076.873) -- 0:02:34
19500 -- (-1074.715) [-1078.995] (-1078.162) (-1080.773) * [-1076.430] (-1080.032) (-1085.268) (-1083.420) -- 0:03:21
20000 -- (-1084.424) [-1081.953] (-1087.624) (-1079.558) * (-1074.902) (-1090.665) [-1079.693] (-1089.099) -- 0:03:16
Average standard deviation of split frequencies: 0.036496
20500 -- (-1083.043) (-1085.157) (-1079.815) [-1079.825] * (-1076.546) [-1080.485] (-1080.440) (-1085.289) -- 0:03:11
21000 -- (-1076.255) (-1075.687) (-1078.492) [-1075.191] * [-1079.845] (-1077.618) (-1072.906) (-1078.879) -- 0:03:06
21500 -- [-1077.210] (-1083.134) (-1078.282) (-1077.119) * (-1082.781) [-1075.868] (-1074.264) (-1082.367) -- 0:03:02
22000 -- (-1078.110) [-1081.207] (-1079.761) (-1081.749) * [-1080.255] (-1078.416) (-1083.380) (-1078.801) -- 0:02:57
22500 -- [-1076.091] (-1081.254) (-1077.469) (-1075.665) * (-1075.435) [-1078.406] (-1081.873) (-1079.798) -- 0:02:53
23000 -- (-1080.499) (-1077.597) [-1089.711] (-1082.974) * (-1077.803) [-1082.080] (-1082.046) (-1086.002) -- 0:02:49
23500 -- (-1082.414) [-1074.387] (-1081.217) (-1079.274) * (-1083.638) [-1076.654] (-1080.121) (-1083.915) -- 0:02:46
24000 -- (-1078.571) (-1079.618) (-1078.893) [-1078.601] * (-1086.630) [-1076.483] (-1083.811) (-1084.557) -- 0:02:42
24500 -- (-1079.962) [-1080.909] (-1077.431) (-1081.696) * (-1082.079) (-1080.708) (-1083.737) [-1076.468] -- 0:03:19
25000 -- [-1079.889] (-1078.943) (-1077.859) (-1083.396) * [-1080.847] (-1082.094) (-1090.406) (-1084.215) -- 0:03:15
Average standard deviation of split frequencies: 0.043514
25500 -- (-1080.663) (-1078.048) [-1082.310] (-1080.539) * (-1082.754) [-1077.062] (-1082.341) (-1084.502) -- 0:03:11
26000 -- (-1077.737) (-1088.201) [-1077.773] (-1081.225) * (-1083.111) (-1078.609) (-1078.599) [-1075.475] -- 0:03:07
26500 -- (-1081.005) [-1077.195] (-1079.964) (-1082.228) * [-1077.103] (-1080.331) (-1078.264) (-1080.056) -- 0:03:03
27000 -- [-1076.278] (-1083.427) (-1081.314) (-1072.621) * (-1078.620) [-1074.396] (-1076.539) (-1077.258) -- 0:03:00
27500 -- (-1077.005) [-1078.767] (-1075.549) (-1077.767) * (-1076.581) (-1078.170) [-1078.598] (-1080.343) -- 0:02:56
28000 -- (-1073.975) (-1088.607) (-1075.532) [-1078.708] * (-1076.694) [-1079.464] (-1077.920) (-1094.083) -- 0:02:53
28500 -- [-1073.652] (-1084.904) (-1084.149) (-1078.293) * (-1075.971) [-1083.548] (-1081.323) (-1100.717) -- 0:02:50
29000 -- (-1075.749) (-1085.660) (-1084.892) [-1076.266] * [-1072.587] (-1083.748) (-1084.869) (-1082.974) -- 0:02:47
29500 -- [-1076.634] (-1083.226) (-1082.054) (-1075.064) * (-1086.516) (-1080.951) (-1077.398) [-1084.803] -- 0:03:17
30000 -- [-1076.453] (-1084.494) (-1080.289) (-1081.593) * [-1075.553] (-1082.842) (-1078.597) (-1084.446) -- 0:03:14
Average standard deviation of split frequencies: 0.024595
30500 -- (-1083.196) (-1078.568) (-1085.387) [-1078.553] * (-1078.860) [-1081.214] (-1085.004) (-1079.584) -- 0:03:10
31000 -- (-1078.128) (-1079.759) [-1080.309] (-1082.181) * [-1080.705] (-1081.169) (-1076.867) (-1079.195) -- 0:03:07
31500 -- [-1084.823] (-1081.589) (-1079.800) (-1081.475) * (-1075.348) (-1085.335) (-1075.878) [-1079.849] -- 0:03:04
32000 -- [-1080.812] (-1077.617) (-1084.128) (-1085.636) * [-1074.993] (-1081.511) (-1076.937) (-1081.154) -- 0:03:01
32500 -- (-1079.088) (-1088.276) (-1078.086) [-1077.863] * (-1079.211) [-1077.368] (-1082.814) (-1095.292) -- 0:02:58
33000 -- [-1089.557] (-1079.903) (-1079.297) (-1087.852) * [-1076.180] (-1075.827) (-1079.898) (-1087.977) -- 0:02:55
33500 -- (-1081.800) (-1077.388) (-1083.972) [-1082.290] * (-1077.826) (-1080.822) (-1082.682) [-1078.022] -- 0:02:53
34000 -- (-1083.410) (-1086.198) [-1082.042] (-1077.711) * (-1083.933) [-1080.658] (-1085.640) (-1083.993) -- 0:02:50
34500 -- [-1073.374] (-1078.319) (-1082.117) (-1082.414) * (-1085.191) (-1081.530) [-1084.018] (-1083.509) -- 0:02:47
35000 -- (-1081.272) [-1079.705] (-1085.671) (-1087.328) * [-1081.507] (-1081.409) (-1081.520) (-1077.618) -- 0:03:13
Average standard deviation of split frequencies: 0.031427
35500 -- (-1086.553) [-1081.259] (-1076.703) (-1085.563) * [-1075.434] (-1085.377) (-1081.587) (-1080.235) -- 0:03:10
36000 -- (-1081.518) (-1079.353) (-1080.602) [-1083.424] * (-1074.397) [-1080.420] (-1080.225) (-1088.921) -- 0:03:07
36500 -- (-1080.138) (-1074.576) [-1078.244] (-1075.943) * [-1077.324] (-1086.429) (-1080.733) (-1087.780) -- 0:03:04
37000 -- (-1078.236) [-1073.299] (-1078.249) (-1080.939) * (-1076.981) (-1084.442) [-1078.483] (-1083.890) -- 0:03:02
37500 -- (-1078.229) (-1078.611) (-1080.835) [-1077.788] * (-1079.660) (-1087.700) [-1080.158] (-1084.533) -- 0:02:59
38000 -- (-1075.454) (-1081.475) (-1082.372) [-1085.752] * (-1082.518) (-1078.302) (-1077.202) [-1077.562] -- 0:02:57
38500 -- [-1079.314] (-1083.901) (-1087.008) (-1076.400) * (-1074.715) [-1083.434] (-1082.771) (-1085.933) -- 0:02:54
39000 -- (-1078.886) [-1086.766] (-1079.251) (-1087.447) * (-1078.636) (-1081.378) [-1077.181] (-1084.735) -- 0:02:52
39500 -- (-1077.658) [-1079.553] (-1083.101) (-1075.822) * (-1074.420) [-1078.379] (-1082.384) (-1079.957) -- 0:02:50
40000 -- [-1076.556] (-1078.529) (-1082.136) (-1075.601) * [-1077.732] (-1079.230) (-1086.446) (-1078.229) -- 0:03:12
Average standard deviation of split frequencies: 0.032457
40500 -- (-1081.773) (-1074.855) [-1076.547] (-1076.149) * (-1086.741) (-1089.652) [-1076.914] (-1079.975) -- 0:03:09
41000 -- (-1077.510) [-1072.470] (-1081.817) (-1077.979) * (-1085.855) (-1088.831) (-1075.537) [-1078.353] -- 0:03:07
41500 -- [-1073.803] (-1077.633) (-1080.328) (-1075.443) * (-1077.175) (-1077.058) [-1078.540] (-1079.282) -- 0:03:04
42000 -- [-1074.125] (-1080.187) (-1088.711) (-1083.139) * (-1081.745) [-1077.741] (-1075.230) (-1080.020) -- 0:03:02
42500 -- [-1079.125] (-1081.281) (-1084.668) (-1081.997) * [-1085.651] (-1083.366) (-1081.499) (-1081.146) -- 0:03:00
43000 -- (-1074.711) [-1083.785] (-1087.115) (-1080.739) * (-1085.506) (-1077.823) (-1079.161) [-1076.042] -- 0:02:58
43500 -- [-1077.294] (-1077.123) (-1082.392) (-1086.233) * (-1079.225) (-1078.071) [-1080.332] (-1079.675) -- 0:02:55
44000 -- [-1077.100] (-1080.076) (-1086.779) (-1075.006) * (-1082.448) (-1085.264) (-1086.187) [-1073.661] -- 0:02:53
44500 -- [-1074.129] (-1079.167) (-1077.439) (-1084.702) * (-1076.311) (-1080.163) (-1080.948) [-1076.394] -- 0:02:51
45000 -- (-1081.357) [-1077.948] (-1075.651) (-1085.005) * [-1074.672] (-1078.483) (-1082.865) (-1080.861) -- 0:03:11
Average standard deviation of split frequencies: 0.032793
45500 -- (-1077.814) (-1080.766) [-1079.040] (-1086.688) * [-1077.475] (-1083.274) (-1082.670) (-1081.361) -- 0:03:08
46000 -- (-1077.526) [-1081.248] (-1083.792) (-1088.260) * (-1079.714) (-1075.213) [-1082.311] (-1082.991) -- 0:03:06
46500 -- (-1088.542) (-1074.668) [-1078.508] (-1090.798) * [-1076.906] (-1078.756) (-1080.705) (-1077.717) -- 0:03:04
47000 -- [-1079.019] (-1075.179) (-1077.245) (-1089.317) * (-1085.804) (-1075.362) [-1079.122] (-1080.216) -- 0:03:02
47500 -- [-1080.652] (-1077.602) (-1086.570) (-1084.635) * (-1088.441) [-1079.341] (-1081.451) (-1075.936) -- 0:03:00
48000 -- (-1078.158) (-1076.845) [-1079.128] (-1078.557) * (-1077.097) [-1080.259] (-1084.239) (-1079.567) -- 0:02:58
48500 -- (-1084.497) (-1074.716) [-1082.983] (-1078.783) * [-1075.204] (-1081.614) (-1088.338) (-1082.577) -- 0:02:56
49000 -- [-1081.640] (-1082.367) (-1076.730) (-1078.604) * (-1080.734) (-1083.582) (-1079.581) [-1080.063] -- 0:02:54
49500 -- (-1079.750) [-1078.154] (-1081.352) (-1082.962) * (-1079.750) (-1077.568) [-1077.845] (-1080.862) -- 0:02:52
50000 -- (-1079.374) (-1078.450) (-1084.378) [-1080.659] * (-1077.597) [-1079.028] (-1081.384) (-1080.086) -- 0:02:51
Average standard deviation of split frequencies: 0.033495
50500 -- [-1083.187] (-1078.607) (-1086.545) (-1080.742) * (-1080.572) [-1079.592] (-1089.476) (-1081.752) -- 0:03:08
51000 -- (-1076.585) (-1081.223) [-1081.341] (-1077.306) * [-1071.589] (-1080.688) (-1088.998) (-1083.042) -- 0:03:06
51500 -- (-1079.968) (-1075.379) (-1084.027) [-1077.308] * (-1077.334) [-1081.014] (-1087.959) (-1076.826) -- 0:03:04
52000 -- (-1090.934) (-1079.121) (-1078.520) [-1080.248] * (-1080.889) (-1076.996) (-1087.912) [-1083.953] -- 0:03:02
52500 -- (-1082.523) [-1078.567] (-1083.492) (-1090.039) * (-1081.060) [-1076.515] (-1083.264) (-1077.848) -- 0:03:00
53000 -- (-1078.338) (-1079.617) (-1085.721) [-1082.805] * (-1077.837) (-1077.899) (-1086.312) [-1087.932] -- 0:02:58
53500 -- (-1076.222) [-1075.871] (-1083.958) (-1084.508) * [-1075.387] (-1074.648) (-1081.214) (-1087.169) -- 0:02:56
54000 -- [-1080.779] (-1075.692) (-1077.746) (-1079.832) * (-1078.889) (-1078.629) (-1084.147) [-1083.610] -- 0:02:55
54500 -- [-1081.109] (-1077.265) (-1077.678) (-1078.065) * (-1081.378) (-1082.934) (-1085.152) [-1082.227] -- 0:02:53
55000 -- (-1081.086) (-1078.293) [-1078.669] (-1090.614) * (-1082.977) (-1076.556) (-1080.801) [-1080.674] -- 0:02:51
Average standard deviation of split frequencies: 0.023570
55500 -- [-1076.261] (-1077.938) (-1078.674) (-1075.013) * [-1080.276] (-1077.448) (-1094.340) (-1083.143) -- 0:03:07
56000 -- (-1082.686) (-1079.638) (-1077.204) [-1088.859] * [-1076.928] (-1080.232) (-1079.777) (-1082.221) -- 0:03:05
56500 -- (-1076.833) (-1082.548) [-1074.426] (-1080.480) * (-1078.429) (-1078.343) [-1079.472] (-1087.900) -- 0:03:03
57000 -- (-1081.588) (-1077.821) (-1077.546) [-1075.008] * [-1076.952] (-1077.213) (-1079.371) (-1081.937) -- 0:03:01
57500 -- (-1084.349) [-1074.288] (-1073.517) (-1080.947) * (-1084.978) (-1080.771) [-1078.825] (-1076.296) -- 0:03:00
58000 -- (-1082.471) [-1075.250] (-1082.183) (-1083.232) * (-1077.304) [-1075.271] (-1079.001) (-1076.287) -- 0:02:58
58500 -- (-1082.328) (-1077.720) [-1078.596] (-1084.032) * (-1080.844) (-1074.787) [-1081.846] (-1077.998) -- 0:02:57
59000 -- (-1083.039) [-1074.941] (-1076.892) (-1078.555) * [-1082.327] (-1080.363) (-1086.689) (-1082.433) -- 0:02:55
59500 -- [-1080.073] (-1076.887) (-1080.591) (-1079.086) * (-1075.917) (-1082.687) (-1085.032) [-1078.650] -- 0:02:53
60000 -- (-1079.483) [-1081.254] (-1081.716) (-1080.739) * [-1077.919] (-1082.509) (-1080.230) (-1078.702) -- 0:02:52
Average standard deviation of split frequencies: 0.024865
60500 -- (-1085.144) [-1077.963] (-1079.791) (-1082.065) * [-1073.774] (-1084.062) (-1079.480) (-1079.435) -- 0:03:06
61000 -- (-1081.280) [-1076.410] (-1078.637) (-1083.918) * (-1080.512) (-1076.933) [-1076.259] (-1082.631) -- 0:03:04
61500 -- (-1085.910) (-1078.156) (-1080.864) [-1077.500] * [-1083.203] (-1083.118) (-1078.925) (-1081.654) -- 0:03:03
62000 -- (-1084.807) [-1081.591] (-1083.846) (-1085.169) * (-1080.209) (-1080.007) (-1081.917) [-1074.152] -- 0:03:01
62500 -- (-1091.642) (-1073.421) (-1083.863) [-1074.426] * (-1077.365) (-1076.759) [-1083.964] (-1080.765) -- 0:03:00
63000 -- (-1086.838) (-1084.520) [-1082.989] (-1081.752) * [-1073.494] (-1081.384) (-1081.339) (-1079.948) -- 0:02:58
63500 -- (-1080.674) (-1082.674) (-1078.573) [-1087.137] * [-1080.654] (-1076.012) (-1086.384) (-1080.567) -- 0:02:56
64000 -- (-1080.082) (-1080.369) (-1077.343) [-1081.133] * (-1087.260) (-1082.866) [-1085.158] (-1085.775) -- 0:02:55
64500 -- [-1079.233] (-1076.874) (-1075.231) (-1075.984) * (-1079.140) [-1085.286] (-1083.263) (-1081.286) -- 0:02:54
65000 -- (-1078.233) [-1075.187] (-1089.734) (-1077.015) * (-1079.073) (-1082.291) [-1078.360] (-1079.954) -- 0:02:52
Average standard deviation of split frequencies: 0.019999
65500 -- [-1077.249] (-1080.998) (-1083.312) (-1081.191) * (-1084.938) [-1076.987] (-1083.008) (-1078.145) -- 0:03:05
66000 -- (-1085.842) [-1078.158] (-1086.343) (-1073.651) * [-1074.975] (-1080.619) (-1078.396) (-1079.855) -- 0:03:03
66500 -- (-1082.328) (-1080.205) [-1078.304] (-1078.920) * [-1079.431] (-1076.262) (-1082.543) (-1077.363) -- 0:03:02
67000 -- (-1082.100) [-1077.551] (-1089.303) (-1077.772) * (-1075.393) (-1082.228) [-1080.576] (-1076.032) -- 0:03:01
67500 -- (-1078.206) (-1088.344) (-1082.096) [-1076.336] * (-1083.767) (-1077.742) (-1082.021) [-1074.799] -- 0:02:59
68000 -- (-1080.435) (-1082.649) (-1074.789) [-1076.490] * (-1079.762) (-1072.911) [-1082.540] (-1082.234) -- 0:02:58
68500 -- [-1076.657] (-1078.820) (-1074.731) (-1077.738) * (-1078.280) [-1075.478] (-1081.398) (-1077.720) -- 0:02:56
69000 -- (-1077.858) (-1079.375) (-1079.731) [-1076.095] * (-1076.859) [-1081.551] (-1078.744) (-1085.713) -- 0:02:55
69500 -- (-1084.462) [-1076.531] (-1078.599) (-1079.579) * (-1081.838) (-1077.886) [-1081.753] (-1077.861) -- 0:02:54
70000 -- (-1081.427) [-1074.065] (-1078.677) (-1080.111) * [-1082.275] (-1080.422) (-1082.317) (-1076.370) -- 0:02:52
Average standard deviation of split frequencies: 0.013342
70500 -- (-1084.373) (-1080.092) (-1077.670) [-1073.923] * (-1077.473) (-1078.932) [-1082.963] (-1077.763) -- 0:02:51
71000 -- (-1080.108) (-1082.370) (-1082.815) [-1075.016] * (-1079.548) [-1076.279] (-1084.370) (-1079.273) -- 0:03:03
71500 -- (-1084.593) [-1081.281] (-1083.382) (-1086.619) * (-1083.480) (-1080.380) [-1075.695] (-1079.670) -- 0:03:01
72000 -- (-1076.291) (-1078.391) [-1086.704] (-1076.879) * (-1075.962) (-1080.430) (-1088.863) [-1076.166] -- 0:03:00
72500 -- [-1076.131] (-1079.490) (-1084.943) (-1079.377) * (-1078.509) [-1077.064] (-1082.087) (-1080.526) -- 0:02:59
73000 -- [-1078.437] (-1091.112) (-1091.965) (-1077.914) * (-1079.795) (-1078.175) (-1077.907) [-1083.219] -- 0:02:57
73500 -- (-1085.968) [-1087.119] (-1083.534) (-1081.422) * (-1074.918) (-1075.457) (-1078.171) [-1079.423] -- 0:02:56
74000 -- (-1084.906) (-1091.431) (-1083.725) [-1080.171] * (-1079.489) (-1084.358) [-1075.365] (-1084.388) -- 0:02:55
74500 -- (-1081.845) [-1082.109] (-1079.888) (-1079.756) * (-1081.010) (-1079.305) (-1079.243) [-1080.054] -- 0:02:53
75000 -- [-1078.016] (-1081.460) (-1081.022) (-1078.512) * [-1077.231] (-1082.703) (-1074.611) (-1079.357) -- 0:02:52
Average standard deviation of split frequencies: 0.014886
75500 -- (-1080.221) (-1081.404) [-1077.461] (-1096.083) * (-1079.118) (-1080.764) [-1074.437] (-1080.500) -- 0:02:51
76000 -- (-1084.426) [-1078.834] (-1080.563) (-1088.853) * (-1085.312) (-1079.889) [-1080.520] (-1079.042) -- 0:03:02
76500 -- (-1078.057) (-1081.154) [-1080.024] (-1082.686) * (-1083.505) [-1083.831] (-1076.917) (-1074.447) -- 0:03:01
77000 -- [-1078.802] (-1077.340) (-1081.486) (-1081.253) * [-1075.196] (-1078.697) (-1079.547) (-1078.042) -- 0:02:59
77500 -- (-1086.607) (-1082.611) [-1083.503] (-1082.096) * (-1084.172) (-1081.344) (-1076.823) [-1075.876] -- 0:02:58
78000 -- (-1080.901) [-1075.733] (-1075.008) (-1093.630) * (-1077.402) [-1080.431] (-1083.421) (-1077.070) -- 0:02:57
78500 -- (-1077.568) [-1082.535] (-1081.105) (-1078.941) * (-1077.958) [-1074.909] (-1082.671) (-1078.272) -- 0:02:56
79000 -- (-1083.019) [-1080.280] (-1075.585) (-1081.229) * (-1081.165) (-1078.018) (-1079.062) [-1078.080] -- 0:02:54
79500 -- (-1083.352) (-1076.959) (-1083.625) [-1074.271] * (-1081.557) [-1083.860] (-1081.442) (-1079.657) -- 0:02:53
80000 -- (-1077.635) [-1080.263] (-1075.004) (-1086.787) * (-1088.384) (-1079.039) (-1074.807) [-1077.549] -- 0:02:52
Average standard deviation of split frequencies: 0.011688
80500 -- (-1084.554) [-1076.314] (-1077.292) (-1087.954) * [-1076.250] (-1081.998) (-1080.702) (-1077.806) -- 0:02:51
81000 -- [-1075.369] (-1086.429) (-1077.824) (-1074.045) * (-1074.323) (-1086.076) (-1077.834) [-1074.951] -- 0:03:01
81500 -- [-1083.725] (-1080.589) (-1082.732) (-1074.642) * (-1086.212) (-1089.196) (-1092.572) [-1077.646] -- 0:03:00
82000 -- (-1078.975) (-1076.332) (-1078.563) [-1076.708] * (-1078.568) (-1085.914) (-1077.952) [-1080.871] -- 0:02:59
82500 -- (-1079.882) (-1077.777) (-1075.858) [-1078.402] * [-1081.078] (-1086.724) (-1076.848) (-1075.932) -- 0:02:57
83000 -- (-1081.289) [-1081.993] (-1080.032) (-1081.095) * (-1094.428) (-1076.868) [-1075.868] (-1078.389) -- 0:02:56
83500 -- [-1079.371] (-1085.594) (-1074.758) (-1079.983) * (-1086.143) (-1076.533) [-1076.984] (-1076.618) -- 0:02:55
84000 -- [-1073.667] (-1082.395) (-1082.160) (-1080.724) * (-1085.276) (-1079.639) (-1085.455) [-1077.856] -- 0:02:54
84500 -- (-1081.468) (-1084.073) [-1079.568] (-1083.044) * (-1078.632) (-1080.803) (-1077.023) [-1077.404] -- 0:02:53
85000 -- [-1072.937] (-1084.525) (-1085.242) (-1082.641) * (-1081.890) [-1080.767] (-1073.771) (-1083.438) -- 0:02:52
Average standard deviation of split frequencies: 0.013155
85500 -- (-1075.398) (-1080.974) [-1085.951] (-1082.177) * (-1081.078) [-1081.992] (-1078.826) (-1079.532) -- 0:02:51
86000 -- (-1076.172) (-1079.611) (-1075.811) [-1079.521] * [-1082.494] (-1083.540) (-1086.023) (-1076.573) -- 0:02:50
86500 -- [-1078.571] (-1082.530) (-1082.796) (-1080.279) * [-1079.378] (-1095.033) (-1082.088) (-1079.823) -- 0:02:59
87000 -- (-1085.862) (-1088.102) (-1083.958) [-1078.468] * (-1080.327) (-1083.045) (-1080.821) [-1075.756] -- 0:02:58
87500 -- (-1075.959) (-1079.292) (-1080.389) [-1075.520] * (-1081.421) (-1078.848) [-1080.281] (-1077.443) -- 0:02:57
88000 -- (-1076.488) (-1083.529) (-1084.209) [-1079.736] * (-1081.268) (-1088.205) [-1077.119] (-1079.778) -- 0:02:56
88500 -- (-1077.839) [-1075.439] (-1080.587) (-1079.928) * [-1082.899] (-1080.110) (-1077.924) (-1080.422) -- 0:02:55
89000 -- [-1074.575] (-1079.565) (-1087.603) (-1079.184) * (-1085.906) [-1079.136] (-1079.563) (-1077.901) -- 0:02:54
89500 -- (-1080.634) (-1082.888) [-1080.647] (-1075.619) * [-1079.102] (-1077.522) (-1078.958) (-1078.510) -- 0:02:52
90000 -- (-1083.940) (-1080.746) (-1081.784) [-1077.185] * (-1078.540) (-1078.287) [-1076.902] (-1076.758) -- 0:02:51
Average standard deviation of split frequencies: 0.018718
90500 -- [-1078.285] (-1081.259) (-1088.715) (-1085.955) * (-1077.402) [-1074.490] (-1087.088) (-1078.593) -- 0:02:50
91000 -- (-1086.046) (-1083.298) (-1090.340) [-1077.279] * (-1085.068) (-1080.729) (-1081.721) [-1078.090] -- 0:02:49
91500 -- (-1084.793) (-1082.562) [-1078.214] (-1088.004) * (-1075.220) (-1078.616) (-1076.685) [-1083.543] -- 0:02:58
92000 -- (-1080.065) [-1081.077] (-1082.900) (-1090.356) * (-1080.267) (-1081.915) (-1077.800) [-1075.711] -- 0:02:57
92500 -- (-1081.792) (-1076.287) (-1081.510) [-1082.313] * (-1080.438) (-1076.952) (-1082.381) [-1074.800] -- 0:02:56
93000 -- (-1077.423) (-1081.056) (-1079.690) [-1084.804] * [-1076.454] (-1083.646) (-1081.464) (-1090.097) -- 0:02:55
93500 -- [-1078.457] (-1081.109) (-1077.524) (-1076.978) * [-1074.470] (-1081.916) (-1078.643) (-1081.765) -- 0:02:54
94000 -- (-1086.798) (-1086.430) [-1078.758] (-1084.993) * (-1084.003) (-1077.080) (-1082.596) [-1084.858] -- 0:02:53
94500 -- (-1080.435) (-1086.150) (-1081.956) [-1083.438] * (-1078.852) (-1075.557) (-1086.135) [-1077.009] -- 0:02:52
95000 -- (-1078.631) (-1086.111) [-1073.100] (-1079.079) * (-1076.135) (-1081.249) (-1084.549) [-1076.287] -- 0:02:51
Average standard deviation of split frequencies: 0.013749
95500 -- (-1080.560) [-1081.622] (-1081.330) (-1082.064) * [-1078.694] (-1079.640) (-1077.684) (-1083.601) -- 0:02:50
96000 -- (-1081.323) (-1082.476) [-1078.086] (-1083.070) * (-1087.344) (-1083.799) (-1074.053) [-1077.507] -- 0:02:49
96500 -- (-1081.934) [-1080.684] (-1078.274) (-1078.792) * (-1088.138) [-1085.717] (-1081.896) (-1078.420) -- 0:02:57
97000 -- (-1078.794) (-1083.946) (-1085.818) [-1077.552] * (-1080.564) (-1078.739) [-1077.665] (-1085.056) -- 0:02:56
97500 -- (-1078.677) [-1074.864] (-1077.775) (-1082.591) * (-1081.032) [-1075.208] (-1081.500) (-1080.984) -- 0:02:55
98000 -- [-1074.903] (-1083.780) (-1079.773) (-1074.744) * (-1076.403) (-1076.771) [-1076.445] (-1078.607) -- 0:02:54
98500 -- (-1082.741) (-1081.732) [-1077.696] (-1075.493) * (-1080.196) (-1076.482) (-1077.673) [-1081.221] -- 0:02:53
99000 -- (-1078.750) (-1079.491) [-1077.890] (-1076.454) * (-1081.583) [-1077.855] (-1075.865) (-1079.852) -- 0:02:52
99500 -- (-1073.662) (-1077.546) [-1075.253] (-1079.671) * (-1075.718) (-1076.952) [-1075.405] (-1078.314) -- 0:02:51
100000 -- [-1080.668] (-1084.749) (-1076.755) (-1086.439) * (-1078.118) (-1074.614) [-1074.361] (-1083.535) -- 0:02:51
Average standard deviation of split frequencies: 0.014985
100500 -- (-1074.533) (-1080.257) [-1077.699] (-1080.674) * (-1077.017) [-1072.982] (-1076.819) (-1084.953) -- 0:02:50
101000 -- (-1084.061) (-1081.604) [-1081.555] (-1086.182) * [-1079.666] (-1077.306) (-1083.015) (-1087.796) -- 0:02:49
101500 -- (-1075.025) [-1079.281] (-1081.536) (-1094.399) * [-1080.291] (-1080.155) (-1078.645) (-1087.163) -- 0:02:48
102000 -- (-1080.901) [-1075.321] (-1080.792) (-1089.808) * (-1082.483) (-1078.026) (-1083.141) [-1080.147] -- 0:02:56
102500 -- (-1075.644) (-1082.183) (-1080.708) [-1083.498] * [-1077.072] (-1077.473) (-1082.018) (-1078.053) -- 0:02:55
103000 -- (-1078.277) (-1082.745) [-1074.947] (-1079.599) * (-1082.320) (-1081.777) (-1075.723) [-1074.599] -- 0:02:54
103500 -- [-1079.267] (-1079.949) (-1075.007) (-1088.202) * (-1077.429) [-1081.887] (-1082.109) (-1086.140) -- 0:02:53
104000 -- [-1076.773] (-1087.337) (-1089.726) (-1091.382) * (-1078.958) (-1078.806) [-1075.694] (-1078.897) -- 0:02:52
104500 -- (-1077.179) (-1079.975) (-1085.953) [-1082.627] * (-1079.349) (-1093.389) [-1080.493] (-1077.315) -- 0:02:51
105000 -- (-1077.878) [-1079.261] (-1089.477) (-1091.366) * [-1077.185] (-1081.625) (-1085.360) (-1078.237) -- 0:02:50
Average standard deviation of split frequencies: 0.016010
105500 -- (-1077.118) (-1086.302) [-1078.476] (-1081.749) * (-1080.552) (-1079.984) (-1086.759) [-1073.827] -- 0:02:49
106000 -- (-1080.909) [-1081.431] (-1079.391) (-1081.418) * (-1081.076) (-1079.227) (-1080.560) [-1076.492] -- 0:02:48
106500 -- (-1080.156) [-1079.929] (-1087.352) (-1081.878) * (-1076.573) (-1081.408) (-1084.489) [-1075.268] -- 0:02:47
107000 -- (-1078.599) [-1079.060] (-1079.090) (-1091.050) * (-1080.703) (-1078.058) (-1083.858) [-1075.316] -- 0:02:55
107500 -- (-1080.894) (-1079.803) [-1084.586] (-1078.610) * (-1082.913) (-1077.972) (-1077.545) [-1078.604] -- 0:02:54
108000 -- (-1076.974) (-1078.761) (-1081.279) [-1077.689] * (-1084.296) (-1082.179) (-1080.474) [-1080.563] -- 0:02:53
108500 -- (-1078.561) (-1079.059) [-1081.405] (-1083.028) * (-1078.851) (-1077.532) [-1079.209] (-1087.296) -- 0:02:52
109000 -- [-1082.061] (-1080.921) (-1080.544) (-1085.272) * (-1074.680) [-1078.657] (-1089.410) (-1076.768) -- 0:02:51
109500 -- (-1080.371) (-1078.180) [-1078.788] (-1081.561) * [-1078.021] (-1080.092) (-1079.047) (-1079.061) -- 0:02:50
110000 -- [-1076.494] (-1074.995) (-1077.450) (-1089.921) * (-1084.621) (-1084.999) (-1072.777) [-1076.872] -- 0:02:49
Average standard deviation of split frequencies: 0.013631
110500 -- [-1078.966] (-1081.805) (-1081.362) (-1084.219) * [-1074.491] (-1080.859) (-1076.762) (-1077.428) -- 0:02:49
111000 -- [-1076.868] (-1086.780) (-1079.314) (-1088.536) * (-1073.168) [-1086.959] (-1080.198) (-1072.801) -- 0:02:48
111500 -- (-1080.726) [-1082.078] (-1082.621) (-1075.946) * (-1076.911) (-1090.564) [-1074.448] (-1078.544) -- 0:02:47
112000 -- (-1080.913) (-1085.405) (-1080.390) [-1075.639] * (-1078.645) (-1084.631) [-1075.886] (-1082.807) -- 0:02:54
112500 -- (-1074.525) (-1087.966) (-1087.013) [-1083.078] * (-1086.950) (-1082.491) [-1075.878] (-1078.043) -- 0:02:53
113000 -- [-1076.284] (-1077.886) (-1080.988) (-1086.384) * (-1076.492) (-1081.939) [-1082.056] (-1081.187) -- 0:02:52
113500 -- (-1084.035) (-1082.690) (-1081.121) [-1079.213] * (-1071.958) [-1080.733] (-1084.162) (-1078.304) -- 0:02:51
114000 -- (-1080.821) [-1073.525] (-1082.190) (-1082.223) * (-1078.662) [-1075.770] (-1074.869) (-1081.165) -- 0:02:50
114500 -- (-1078.755) [-1073.873] (-1086.395) (-1087.129) * (-1083.272) (-1078.834) (-1083.035) [-1084.300] -- 0:02:50
115000 -- (-1082.449) [-1073.506] (-1080.711) (-1079.152) * (-1078.769) (-1078.631) [-1077.645] (-1079.422) -- 0:02:49
Average standard deviation of split frequencies: 0.014630
115500 -- [-1075.273] (-1081.220) (-1083.331) (-1082.783) * (-1086.264) (-1081.028) [-1078.107] (-1077.539) -- 0:02:48
116000 -- (-1075.818) (-1073.925) (-1080.769) [-1076.601] * (-1082.374) (-1076.568) [-1081.258] (-1077.307) -- 0:02:47
116500 -- (-1082.968) (-1074.154) [-1078.278] (-1077.240) * (-1084.488) [-1082.032] (-1081.654) (-1081.320) -- 0:02:46
117000 -- [-1074.929] (-1074.042) (-1086.851) (-1079.260) * (-1077.817) (-1085.866) [-1076.036] (-1076.072) -- 0:02:53
117500 -- [-1075.855] (-1078.925) (-1086.965) (-1080.940) * [-1082.347] (-1079.634) (-1082.099) (-1084.740) -- 0:02:52
118000 -- [-1079.793] (-1083.161) (-1088.661) (-1082.029) * (-1080.457) (-1084.719) [-1075.974] (-1089.071) -- 0:02:51
118500 -- [-1076.082] (-1090.109) (-1083.247) (-1074.442) * (-1084.923) [-1075.639] (-1079.115) (-1089.108) -- 0:02:51
119000 -- [-1078.005] (-1084.922) (-1082.944) (-1081.005) * (-1088.077) (-1076.393) [-1075.270] (-1081.183) -- 0:02:50
119500 -- (-1086.677) (-1079.534) (-1080.514) [-1074.634] * (-1079.101) (-1077.369) [-1079.875] (-1081.680) -- 0:02:49
120000 -- (-1080.757) (-1079.287) (-1076.948) [-1085.635] * (-1074.297) (-1075.873) (-1075.468) [-1077.783] -- 0:02:48
Average standard deviation of split frequencies: 0.017189
120500 -- (-1080.089) (-1076.076) (-1078.498) [-1075.359] * (-1084.464) [-1080.105] (-1075.357) (-1084.673) -- 0:02:47
121000 -- (-1080.103) (-1078.149) [-1077.166] (-1079.653) * (-1088.014) (-1077.793) [-1080.023] (-1075.961) -- 0:02:47
121500 -- [-1077.454] (-1082.676) (-1077.050) (-1078.357) * (-1083.488) [-1078.911] (-1085.312) (-1076.305) -- 0:02:46
122000 -- [-1085.947] (-1086.687) (-1074.358) (-1086.649) * (-1085.984) (-1073.906) [-1073.703] (-1078.140) -- 0:02:45
122500 -- (-1080.724) (-1080.835) (-1081.782) [-1084.925] * (-1081.938) (-1077.899) (-1076.674) [-1072.841] -- 0:02:51
123000 -- [-1086.259] (-1086.077) (-1075.488) (-1079.526) * (-1085.771) (-1076.333) (-1084.387) [-1078.089] -- 0:02:51
123500 -- (-1084.258) (-1080.163) (-1078.944) [-1079.279] * [-1076.808] (-1076.920) (-1081.873) (-1072.515) -- 0:02:50
124000 -- (-1087.444) (-1081.623) (-1085.451) [-1074.630] * (-1082.024) (-1079.940) [-1082.888] (-1083.429) -- 0:02:49
124500 -- (-1078.619) (-1075.582) [-1083.658] (-1081.883) * [-1076.887] (-1076.155) (-1083.509) (-1075.021) -- 0:02:48
125000 -- (-1076.718) (-1079.618) (-1083.049) [-1077.394] * [-1078.123] (-1081.506) (-1087.762) (-1081.247) -- 0:02:48
Average standard deviation of split frequencies: 0.016462
125500 -- [-1076.667] (-1079.333) (-1083.273) (-1082.009) * (-1078.782) [-1077.824] (-1085.787) (-1073.199) -- 0:02:47
126000 -- (-1085.619) [-1073.406] (-1080.414) (-1088.536) * (-1079.726) [-1078.452] (-1078.657) (-1076.233) -- 0:02:46
126500 -- [-1081.011] (-1077.428) (-1080.004) (-1085.765) * (-1080.913) (-1077.482) [-1077.066] (-1076.032) -- 0:02:45
127000 -- (-1076.768) (-1079.243) [-1079.359] (-1084.206) * (-1088.281) [-1075.599] (-1081.485) (-1083.062) -- 0:02:44
127500 -- (-1075.182) [-1081.453] (-1077.623) (-1095.059) * (-1078.758) (-1077.263) [-1074.325] (-1085.418) -- 0:02:51
128000 -- (-1082.509) [-1076.740] (-1092.483) (-1083.824) * (-1080.580) (-1078.698) [-1078.469] (-1079.523) -- 0:02:50
128500 -- (-1078.367) [-1074.157] (-1080.159) (-1079.111) * (-1074.246) [-1075.328] (-1086.548) (-1080.557) -- 0:02:49
129000 -- (-1079.587) (-1074.693) [-1076.440] (-1076.626) * (-1080.247) (-1079.566) [-1082.925] (-1076.946) -- 0:02:48
129500 -- (-1076.293) (-1082.535) (-1082.458) [-1078.221] * (-1086.923) (-1079.571) (-1089.322) [-1077.866] -- 0:02:48
130000 -- (-1082.644) (-1084.331) (-1083.610) [-1074.904] * (-1089.400) (-1082.895) [-1077.759] (-1089.145) -- 0:02:47
Average standard deviation of split frequencies: 0.011545
130500 -- [-1081.444] (-1081.160) (-1074.054) (-1075.859) * (-1079.982) (-1083.475) [-1085.930] (-1085.362) -- 0:02:46
131000 -- (-1076.680) [-1081.529] (-1079.822) (-1077.029) * [-1080.306] (-1079.936) (-1079.858) (-1079.714) -- 0:02:45
131500 -- (-1077.259) (-1088.965) (-1080.886) [-1074.498] * (-1080.318) (-1077.768) (-1085.333) [-1075.644] -- 0:02:45
132000 -- (-1084.816) (-1084.163) (-1079.336) [-1079.127] * (-1081.180) (-1080.769) (-1098.541) [-1077.539] -- 0:02:44
132500 -- (-1089.396) (-1081.817) [-1075.542] (-1082.590) * [-1085.491] (-1078.147) (-1089.257) (-1077.688) -- 0:02:50
133000 -- (-1084.727) (-1080.495) (-1091.404) [-1074.708] * (-1086.189) (-1076.965) [-1081.267] (-1080.331) -- 0:02:49
133500 -- (-1077.832) (-1081.418) (-1083.582) [-1076.903] * (-1083.265) (-1081.384) [-1076.815] (-1074.062) -- 0:02:48
134000 -- (-1077.288) (-1079.903) [-1080.551] (-1085.785) * (-1082.466) (-1076.855) [-1080.975] (-1076.566) -- 0:02:48
134500 -- [-1073.057] (-1086.608) (-1075.030) (-1089.801) * (-1081.051) (-1078.015) (-1080.779) [-1076.899] -- 0:02:47
135000 -- (-1079.060) (-1082.844) [-1075.257] (-1081.218) * [-1075.979] (-1087.357) (-1082.749) (-1083.481) -- 0:02:46
Average standard deviation of split frequencies: 0.009705
135500 -- (-1081.605) [-1095.793] (-1080.896) (-1079.220) * (-1081.654) (-1080.053) [-1074.471] (-1083.472) -- 0:02:45
136000 -- (-1081.311) (-1078.843) (-1080.795) [-1080.145] * (-1080.490) (-1080.077) (-1080.213) [-1074.966] -- 0:02:45
136500 -- (-1075.478) [-1077.642] (-1081.638) (-1080.415) * [-1079.783] (-1082.255) (-1087.931) (-1079.367) -- 0:02:44
137000 -- (-1080.166) [-1075.789] (-1076.412) (-1080.319) * (-1086.739) (-1076.676) [-1080.285] (-1081.845) -- 0:02:43
137500 -- (-1076.470) [-1076.651] (-1083.606) (-1079.691) * (-1086.503) (-1075.366) (-1079.306) [-1077.160] -- 0:02:43
138000 -- [-1079.723] (-1081.924) (-1081.882) (-1081.609) * (-1082.994) (-1079.526) (-1082.059) [-1079.944] -- 0:02:48
138500 -- (-1074.676) (-1088.593) [-1076.846] (-1089.022) * [-1074.925] (-1077.361) (-1083.109) (-1079.862) -- 0:02:47
139000 -- (-1074.750) [-1077.489] (-1084.834) (-1077.369) * [-1079.758] (-1081.791) (-1080.439) (-1075.770) -- 0:02:47
139500 -- (-1081.719) (-1081.096) (-1082.659) [-1078.825] * (-1081.867) (-1084.873) (-1079.639) [-1078.218] -- 0:02:46
140000 -- (-1080.052) (-1077.935) [-1079.813] (-1081.127) * [-1073.831] (-1077.730) (-1078.004) (-1081.048) -- 0:02:45
Average standard deviation of split frequencies: 0.009383
140500 -- [-1074.409] (-1077.412) (-1084.754) (-1086.858) * (-1079.074) (-1077.311) [-1075.552] (-1079.758) -- 0:02:45
141000 -- [-1079.197] (-1077.681) (-1077.929) (-1087.479) * (-1078.311) [-1079.171] (-1078.633) (-1079.615) -- 0:02:44
141500 -- (-1077.670) (-1076.400) (-1086.712) [-1078.382] * (-1084.012) (-1076.448) (-1078.938) [-1079.330] -- 0:02:43
142000 -- (-1077.345) [-1074.281] (-1088.555) (-1080.726) * (-1081.893) [-1085.121] (-1091.105) (-1078.385) -- 0:02:43
142500 -- (-1078.381) [-1080.165] (-1081.078) (-1082.230) * (-1077.646) [-1078.109] (-1075.890) (-1079.420) -- 0:02:42
143000 -- [-1076.849] (-1078.930) (-1075.269) (-1085.912) * (-1084.540) (-1082.320) [-1076.990] (-1088.736) -- 0:02:47
143500 -- (-1082.446) [-1078.794] (-1081.115) (-1075.001) * (-1077.487) [-1080.972] (-1084.115) (-1077.390) -- 0:02:47
144000 -- (-1082.804) (-1078.345) (-1084.999) [-1076.895] * (-1082.054) (-1089.884) [-1082.186] (-1085.677) -- 0:02:46
144500 -- (-1081.503) (-1076.176) [-1076.447] (-1081.708) * (-1081.628) (-1081.429) (-1082.775) [-1083.947] -- 0:02:45
145000 -- [-1079.577] (-1077.129) (-1081.984) (-1074.409) * (-1081.258) (-1080.474) (-1078.366) [-1078.852] -- 0:02:45
Average standard deviation of split frequencies: 0.007749
145500 -- [-1081.258] (-1080.735) (-1079.732) (-1079.387) * (-1087.404) (-1082.003) (-1075.233) [-1079.489] -- 0:02:44
146000 -- (-1080.095) (-1080.203) [-1082.652] (-1078.919) * (-1087.987) (-1086.481) [-1083.098] (-1076.089) -- 0:02:43
146500 -- (-1084.823) (-1085.960) (-1081.329) [-1080.270] * [-1079.618] (-1082.828) (-1076.686) (-1081.081) -- 0:02:43
147000 -- [-1077.759] (-1084.538) (-1084.854) (-1082.035) * [-1080.087] (-1077.342) (-1077.672) (-1077.528) -- 0:02:42
147500 -- [-1075.960] (-1084.052) (-1082.298) (-1078.960) * (-1082.289) [-1083.900] (-1080.436) (-1083.296) -- 0:02:41
148000 -- (-1077.491) [-1081.402] (-1086.169) (-1080.254) * [-1082.352] (-1081.300) (-1078.657) (-1082.620) -- 0:02:46
148500 -- [-1074.439] (-1080.508) (-1087.939) (-1080.736) * [-1071.839] (-1079.763) (-1078.041) (-1083.863) -- 0:02:46
149000 -- (-1078.284) [-1074.105] (-1082.072) (-1077.736) * (-1079.601) (-1079.088) [-1074.578] (-1078.979) -- 0:02:45
149500 -- [-1076.978] (-1076.482) (-1078.461) (-1089.355) * (-1079.699) (-1079.464) (-1083.360) [-1080.692] -- 0:02:44
150000 -- (-1078.529) [-1077.506] (-1076.575) (-1073.770) * (-1076.619) [-1077.679] (-1078.656) (-1083.371) -- 0:02:44
Average standard deviation of split frequencies: 0.008761
150500 -- (-1076.150) (-1083.420) [-1078.406] (-1080.297) * [-1076.131] (-1076.684) (-1076.868) (-1084.757) -- 0:02:43
151000 -- [-1074.684] (-1076.752) (-1082.403) (-1083.861) * [-1077.611] (-1080.561) (-1079.285) (-1079.941) -- 0:02:43
151500 -- (-1080.362) (-1077.970) (-1075.053) [-1079.099] * (-1091.401) [-1080.334] (-1084.777) (-1082.351) -- 0:02:42
152000 -- (-1075.935) [-1080.425] (-1087.331) (-1078.239) * (-1091.946) [-1082.001] (-1082.780) (-1078.169) -- 0:02:41
152500 -- (-1081.414) (-1085.351) [-1079.524] (-1076.475) * (-1088.193) (-1082.566) (-1080.361) [-1075.254] -- 0:02:41
153000 -- (-1082.566) (-1079.725) (-1079.958) [-1079.316] * (-1081.107) (-1082.425) (-1078.128) [-1073.038] -- 0:02:40
153500 -- (-1089.384) (-1076.731) (-1078.393) [-1082.963] * (-1084.214) (-1079.138) [-1079.310] (-1080.002) -- 0:02:45
154000 -- (-1084.305) (-1076.284) (-1082.895) [-1078.687] * (-1083.766) (-1080.691) [-1081.693] (-1083.253) -- 0:02:44
154500 -- (-1087.363) [-1078.769] (-1083.463) (-1082.810) * (-1076.220) (-1079.257) [-1076.882] (-1081.053) -- 0:02:44
155000 -- (-1088.019) (-1079.215) [-1075.828] (-1083.839) * (-1082.233) [-1078.389] (-1078.481) (-1080.031) -- 0:02:43
Average standard deviation of split frequencies: 0.009670
155500 -- (-1086.548) (-1080.302) (-1081.864) [-1075.684] * (-1075.286) [-1078.456] (-1078.632) (-1080.901) -- 0:02:42
156000 -- (-1081.813) (-1076.312) (-1082.881) [-1086.044] * (-1088.509) [-1078.794] (-1088.650) (-1087.534) -- 0:02:42
156500 -- [-1083.099] (-1074.448) (-1078.792) (-1077.106) * (-1086.512) (-1083.820) (-1077.675) [-1078.872] -- 0:02:41
157000 -- (-1075.506) [-1075.812] (-1079.337) (-1075.957) * (-1080.023) [-1076.778] (-1071.224) (-1080.697) -- 0:02:41
157500 -- (-1077.146) (-1076.353) [-1083.384] (-1078.028) * (-1077.167) (-1083.243) [-1075.189] (-1078.055) -- 0:02:40
158000 -- (-1085.054) (-1080.120) (-1081.576) [-1080.173] * (-1078.525) (-1077.640) (-1085.926) [-1077.674] -- 0:02:39
158500 -- (-1077.003) [-1077.423] (-1077.995) (-1079.526) * (-1080.151) (-1084.827) [-1078.535] (-1083.238) -- 0:02:44
159000 -- (-1076.282) (-1075.903) (-1075.946) [-1083.172] * (-1081.330) (-1074.088) (-1080.868) [-1077.541] -- 0:02:43
159500 -- (-1080.662) (-1078.660) [-1076.944] (-1081.778) * (-1077.342) [-1076.806] (-1081.971) (-1086.278) -- 0:02:43
160000 -- (-1077.603) (-1088.083) (-1078.178) [-1075.791] * [-1076.297] (-1075.963) (-1077.769) (-1085.156) -- 0:02:42
Average standard deviation of split frequencies: 0.004694
160500 -- [-1075.322] (-1076.817) (-1075.809) (-1081.513) * (-1084.757) (-1084.774) [-1077.487] (-1081.267) -- 0:02:42
161000 -- (-1078.119) [-1079.276] (-1084.008) (-1080.420) * (-1074.062) [-1075.434] (-1077.081) (-1080.169) -- 0:02:41
161500 -- (-1079.683) [-1077.718] (-1081.821) (-1079.855) * (-1078.881) (-1079.949) [-1074.585] (-1080.781) -- 0:02:40
162000 -- (-1076.714) (-1074.008) [-1078.375] (-1082.593) * (-1075.372) (-1080.500) [-1076.900] (-1079.759) -- 0:02:40
162500 -- (-1079.133) (-1078.541) (-1080.528) [-1082.043] * [-1076.265] (-1077.301) (-1081.633) (-1087.419) -- 0:02:39
163000 -- [-1074.304] (-1089.232) (-1082.462) (-1080.121) * (-1082.065) [-1077.607] (-1074.682) (-1083.111) -- 0:02:39
163500 -- [-1081.496] (-1080.990) (-1085.360) (-1084.356) * [-1076.866] (-1075.216) (-1077.527) (-1080.588) -- 0:02:43
164000 -- [-1077.033] (-1078.936) (-1076.481) (-1082.394) * [-1076.534] (-1075.856) (-1084.514) (-1086.121) -- 0:02:43
164500 -- (-1080.731) (-1074.678) (-1077.677) [-1080.940] * (-1084.480) (-1076.952) [-1084.543] (-1082.671) -- 0:02:42
165000 -- (-1074.838) [-1078.352] (-1078.093) (-1078.367) * (-1076.855) (-1078.504) [-1082.175] (-1083.022) -- 0:02:41
Average standard deviation of split frequencies: 0.003408
165500 -- (-1081.841) (-1084.954) (-1076.508) [-1083.485] * [-1078.219] (-1077.749) (-1077.951) (-1088.121) -- 0:02:41
166000 -- (-1082.658) (-1081.044) [-1086.720] (-1085.200) * [-1076.387] (-1080.560) (-1082.926) (-1080.572) -- 0:02:40
166500 -- [-1077.841] (-1077.924) (-1078.298) (-1089.911) * (-1075.986) [-1083.569] (-1084.446) (-1081.173) -- 0:02:40
167000 -- [-1080.014] (-1079.499) (-1081.115) (-1086.484) * (-1081.184) [-1083.642] (-1086.776) (-1080.059) -- 0:02:39
167500 -- (-1080.747) [-1077.828] (-1081.587) (-1096.254) * [-1073.069] (-1079.716) (-1086.383) (-1076.400) -- 0:02:39
168000 -- (-1081.729) (-1075.471) (-1083.747) [-1085.726] * [-1081.575] (-1082.028) (-1086.872) (-1072.756) -- 0:02:38
168500 -- (-1079.538) [-1073.687] (-1083.495) (-1076.470) * [-1081.409] (-1085.610) (-1089.734) (-1079.657) -- 0:02:42
169000 -- (-1076.043) (-1080.405) (-1079.816) [-1083.729] * [-1079.769] (-1081.938) (-1084.585) (-1080.457) -- 0:02:42
169500 -- [-1077.497] (-1081.458) (-1079.871) (-1074.114) * (-1087.038) (-1081.798) [-1080.216] (-1082.760) -- 0:02:41
170000 -- [-1081.339] (-1077.312) (-1081.371) (-1077.191) * (-1081.817) (-1079.211) (-1089.184) [-1074.684] -- 0:02:41
Average standard deviation of split frequencies: 0.004419
170500 -- (-1086.920) (-1079.277) (-1081.041) [-1077.068] * (-1079.386) (-1078.853) (-1086.287) [-1076.053] -- 0:02:40
171000 -- (-1085.864) (-1079.747) [-1076.327] (-1083.134) * (-1082.206) [-1079.132] (-1081.612) (-1076.317) -- 0:02:39
171500 -- (-1097.914) (-1075.955) [-1074.925] (-1085.871) * (-1079.346) [-1078.206] (-1082.057) (-1087.735) -- 0:02:39
172000 -- (-1081.072) [-1074.301] (-1078.510) (-1078.710) * [-1076.594] (-1076.721) (-1088.154) (-1079.923) -- 0:02:38
172500 -- (-1080.359) (-1075.230) (-1074.561) [-1077.232] * [-1076.264] (-1078.440) (-1084.927) (-1076.576) -- 0:02:38
173000 -- (-1081.733) [-1073.749] (-1078.373) (-1082.505) * (-1079.778) (-1091.792) [-1081.797] (-1081.370) -- 0:02:37
173500 -- (-1084.832) (-1080.270) (-1085.099) [-1074.741] * (-1082.498) [-1077.117] (-1080.105) (-1077.534) -- 0:02:37
174000 -- (-1079.281) (-1081.148) [-1075.421] (-1076.843) * (-1080.344) (-1074.753) [-1073.750] (-1080.493) -- 0:02:41
174500 -- [-1082.058] (-1087.252) (-1080.215) (-1083.167) * (-1079.951) (-1085.691) [-1077.678] (-1082.919) -- 0:02:40
175000 -- (-1078.716) (-1081.706) (-1086.657) [-1079.774] * (-1087.232) (-1079.177) (-1087.130) [-1078.189] -- 0:02:40
Average standard deviation of split frequencies: 0.003214
175500 -- (-1088.210) (-1082.158) (-1078.388) [-1076.291] * (-1083.560) [-1076.592] (-1085.016) (-1081.398) -- 0:02:39
176000 -- (-1084.623) (-1077.135) [-1081.139] (-1084.661) * (-1083.787) [-1076.636] (-1082.513) (-1075.295) -- 0:02:39
176500 -- (-1079.076) (-1074.709) [-1076.213] (-1072.563) * (-1084.794) (-1079.887) [-1076.894] (-1078.618) -- 0:02:38
177000 -- [-1075.468] (-1085.626) (-1084.386) (-1083.426) * (-1081.444) [-1079.454] (-1075.550) (-1083.309) -- 0:02:38
177500 -- (-1078.767) [-1074.918] (-1085.328) (-1079.081) * (-1086.055) (-1077.056) [-1081.882] (-1080.949) -- 0:02:37
178000 -- (-1079.323) (-1076.782) (-1079.385) [-1080.909] * (-1095.438) [-1082.796] (-1082.279) (-1078.189) -- 0:02:37
178500 -- (-1076.297) (-1083.768) [-1075.935] (-1075.512) * (-1081.293) (-1082.523) [-1076.209] (-1076.308) -- 0:02:36
179000 -- [-1076.241] (-1084.935) (-1076.626) (-1077.898) * [-1077.067] (-1081.036) (-1078.642) (-1075.151) -- 0:02:40
179500 -- [-1080.748] (-1081.712) (-1072.873) (-1074.459) * (-1082.474) [-1077.738] (-1077.405) (-1079.539) -- 0:02:39
180000 -- (-1076.201) (-1079.218) [-1081.252] (-1076.211) * (-1084.079) [-1082.044] (-1084.007) (-1080.328) -- 0:02:39
Average standard deviation of split frequencies: 0.005871
180500 -- (-1080.997) [-1081.898] (-1079.353) (-1081.297) * (-1078.379) (-1074.522) (-1086.292) [-1083.581] -- 0:02:38
181000 -- (-1078.055) (-1092.653) (-1083.222) [-1079.996] * (-1080.555) (-1076.971) (-1076.648) [-1081.369] -- 0:02:38
181500 -- [-1079.054] (-1077.576) (-1082.608) (-1077.347) * (-1087.437) [-1078.359] (-1078.148) (-1087.482) -- 0:02:37
182000 -- [-1080.817] (-1082.478) (-1084.190) (-1081.813) * [-1083.431] (-1078.227) (-1079.242) (-1074.993) -- 0:02:37
182500 -- (-1077.866) (-1079.966) [-1078.268] (-1092.129) * (-1084.473) (-1076.363) (-1078.224) [-1078.959] -- 0:02:36
183000 -- (-1079.638) (-1073.596) [-1077.953] (-1082.276) * (-1080.654) [-1077.604] (-1075.155) (-1086.219) -- 0:02:36
183500 -- (-1077.283) (-1077.104) (-1075.989) [-1078.715] * (-1083.811) (-1076.475) [-1078.597] (-1083.204) -- 0:02:35
184000 -- [-1075.447] (-1083.674) (-1084.659) (-1078.733) * [-1083.034] (-1080.774) (-1079.792) (-1080.015) -- 0:02:35
184500 -- [-1080.610] (-1084.033) (-1080.988) (-1079.260) * (-1079.030) (-1078.585) (-1077.011) [-1078.391] -- 0:02:39
185000 -- [-1075.267] (-1078.417) (-1078.268) (-1080.581) * [-1077.815] (-1076.526) (-1077.985) (-1081.716) -- 0:02:38
Average standard deviation of split frequencies: 0.005069
185500 -- (-1081.938) (-1075.664) [-1084.708] (-1081.178) * (-1087.539) (-1077.685) (-1080.205) [-1081.617] -- 0:02:38
186000 -- (-1083.182) [-1078.003] (-1087.819) (-1080.553) * (-1085.759) [-1076.021] (-1081.957) (-1076.958) -- 0:02:37
186500 -- [-1081.125] (-1079.536) (-1100.836) (-1079.183) * [-1076.579] (-1087.683) (-1079.402) (-1079.923) -- 0:02:37
187000 -- (-1075.613) (-1077.939) [-1077.834] (-1081.981) * (-1077.416) (-1077.292) [-1077.924] (-1076.523) -- 0:02:36
187500 -- [-1078.152] (-1080.246) (-1079.078) (-1087.435) * (-1082.565) (-1081.884) [-1072.934] (-1085.150) -- 0:02:36
188000 -- [-1077.382] (-1075.949) (-1081.385) (-1087.426) * (-1083.439) (-1083.112) [-1077.584] (-1081.170) -- 0:02:35
188500 -- [-1077.144] (-1078.534) (-1085.770) (-1085.080) * (-1080.632) (-1083.478) (-1081.440) [-1078.526] -- 0:02:34
189000 -- (-1076.708) [-1075.570] (-1080.711) (-1084.973) * [-1073.748] (-1078.489) (-1076.932) (-1081.502) -- 0:02:34
189500 -- (-1078.398) (-1077.947) (-1080.574) [-1076.326] * (-1073.205) (-1078.348) (-1086.396) [-1077.764] -- 0:02:38
190000 -- (-1084.866) (-1079.161) (-1077.999) [-1079.312] * (-1077.095) (-1076.302) [-1082.940] (-1082.855) -- 0:02:37
Average standard deviation of split frequencies: 0.005563
190500 -- [-1080.384] (-1081.728) (-1081.072) (-1090.548) * (-1086.040) (-1076.827) (-1078.928) [-1077.814] -- 0:02:37
191000 -- (-1085.537) (-1083.365) [-1080.396] (-1079.074) * (-1074.870) [-1084.382] (-1075.869) (-1084.065) -- 0:02:36
191500 -- (-1084.858) [-1082.073] (-1076.079) (-1077.311) * [-1073.816] (-1076.690) (-1082.027) (-1084.426) -- 0:02:36
192000 -- (-1080.254) (-1081.977) [-1076.155] (-1078.580) * (-1075.852) (-1080.848) [-1077.070] (-1082.503) -- 0:02:35
192500 -- [-1079.934] (-1084.966) (-1082.561) (-1079.529) * (-1087.277) (-1079.929) (-1080.242) [-1080.234] -- 0:02:35
193000 -- [-1076.791] (-1081.244) (-1081.248) (-1078.230) * (-1082.499) (-1082.879) (-1085.937) [-1080.796] -- 0:02:34
193500 -- (-1080.127) (-1076.418) [-1084.209] (-1078.480) * (-1079.990) [-1077.325] (-1085.923) (-1073.125) -- 0:02:34
194000 -- (-1076.737) (-1077.403) (-1074.762) [-1076.958] * (-1080.047) (-1074.416) (-1090.354) [-1081.541] -- 0:02:33
194500 -- (-1076.317) (-1080.056) [-1079.366] (-1077.769) * (-1077.512) (-1083.164) [-1079.817] (-1074.049) -- 0:02:37
195000 -- (-1077.437) (-1079.877) (-1084.617) [-1080.455] * [-1079.787] (-1080.177) (-1080.299) (-1078.341) -- 0:02:36
Average standard deviation of split frequencies: 0.009621
195500 -- (-1078.539) (-1077.729) (-1087.060) [-1084.136] * (-1074.348) [-1091.452] (-1086.903) (-1077.595) -- 0:02:36
196000 -- (-1078.829) (-1083.995) (-1078.304) [-1079.150] * (-1077.692) [-1085.049] (-1074.963) (-1083.441) -- 0:02:35
196500 -- [-1075.210] (-1080.155) (-1082.142) (-1080.418) * (-1083.994) (-1084.873) [-1083.376] (-1082.422) -- 0:02:35
197000 -- (-1075.914) [-1075.384] (-1085.092) (-1091.834) * (-1074.888) (-1084.507) (-1080.739) [-1084.188] -- 0:02:34
197500 -- (-1084.613) (-1073.873) [-1085.749] (-1082.934) * [-1079.246] (-1080.565) (-1082.146) (-1082.742) -- 0:02:34
198000 -- [-1080.915] (-1082.039) (-1083.616) (-1084.270) * (-1077.769) [-1080.068] (-1088.178) (-1091.799) -- 0:02:33
198500 -- (-1081.545) [-1083.485] (-1077.863) (-1081.551) * (-1080.287) [-1072.592] (-1090.259) (-1087.900) -- 0:02:33
199000 -- (-1084.647) (-1082.948) [-1080.620] (-1077.447) * [-1075.792] (-1084.331) (-1080.152) (-1084.751) -- 0:02:32
199500 -- [-1081.939] (-1081.829) (-1079.218) (-1081.606) * (-1083.292) (-1075.797) [-1078.501] (-1091.117) -- 0:02:36
200000 -- (-1074.245) (-1077.751) (-1082.922) [-1076.647] * (-1076.826) [-1082.728] (-1073.745) (-1082.778) -- 0:02:36
Average standard deviation of split frequencies: 0.008222
200500 -- (-1080.592) (-1086.580) [-1080.015] (-1087.639) * (-1080.101) (-1078.487) (-1081.238) [-1077.825] -- 0:02:35
201000 -- (-1077.710) (-1080.305) [-1078.514] (-1079.922) * (-1079.344) [-1074.164] (-1073.734) (-1077.495) -- 0:02:35
201500 -- (-1083.692) (-1088.855) (-1079.438) [-1076.841] * [-1081.010] (-1078.830) (-1082.673) (-1083.074) -- 0:02:34
202000 -- (-1083.089) [-1080.817] (-1078.786) (-1081.777) * [-1076.004] (-1075.538) (-1082.115) (-1078.179) -- 0:02:34
202500 -- (-1080.558) (-1075.905) (-1081.174) [-1082.315] * (-1073.308) (-1073.960) (-1083.495) [-1077.785] -- 0:02:33
203000 -- (-1082.360) [-1076.127] (-1076.100) (-1080.996) * (-1080.640) [-1079.526] (-1078.950) (-1077.213) -- 0:02:33
203500 -- (-1079.109) [-1079.177] (-1083.197) (-1079.545) * (-1080.875) (-1083.648) (-1077.204) [-1078.429] -- 0:02:32
204000 -- (-1083.128) [-1082.026] (-1080.423) (-1080.998) * (-1078.904) (-1085.081) [-1079.992] (-1075.443) -- 0:02:32
204500 -- (-1078.301) (-1083.090) (-1080.926) [-1079.281] * (-1085.964) (-1083.780) [-1074.582] (-1082.497) -- 0:02:31
205000 -- (-1087.574) [-1078.102] (-1087.132) (-1073.313) * (-1074.595) (-1090.475) [-1082.061] (-1080.845) -- 0:02:35
Average standard deviation of split frequencies: 0.011900
205500 -- (-1082.738) [-1084.628] (-1087.395) (-1083.176) * [-1075.565] (-1081.373) (-1077.507) (-1078.378) -- 0:02:34
206000 -- (-1084.276) [-1072.716] (-1083.870) (-1081.672) * (-1076.493) [-1076.245] (-1079.345) (-1078.541) -- 0:02:34
206500 -- (-1080.033) (-1072.325) (-1078.360) [-1077.846] * (-1081.259) [-1074.964] (-1078.102) (-1077.930) -- 0:02:33
207000 -- [-1073.411] (-1080.416) (-1079.141) (-1084.559) * (-1082.564) (-1077.000) (-1077.543) [-1074.738] -- 0:02:33
207500 -- [-1076.529] (-1083.926) (-1078.435) (-1084.621) * (-1075.510) (-1077.709) (-1074.193) [-1081.558] -- 0:02:32
208000 -- (-1079.210) [-1079.370] (-1081.341) (-1074.936) * (-1076.012) [-1082.864] (-1088.872) (-1084.544) -- 0:02:32
208500 -- (-1088.202) (-1078.661) [-1076.209] (-1080.145) * (-1075.625) (-1082.463) (-1072.326) [-1081.855] -- 0:02:31
209000 -- (-1080.676) (-1079.531) [-1078.222] (-1091.617) * [-1080.666] (-1084.254) (-1079.372) (-1073.028) -- 0:02:31
209500 -- (-1084.027) (-1078.535) (-1080.690) [-1076.231] * (-1078.550) (-1079.333) [-1081.011] (-1086.977) -- 0:02:30
210000 -- [-1082.241] (-1081.114) (-1078.120) (-1076.845) * (-1082.495) (-1084.011) [-1076.801] (-1083.056) -- 0:02:34
Average standard deviation of split frequencies: 0.008951
210500 -- (-1086.229) (-1074.288) (-1090.402) [-1076.116] * (-1081.850) (-1079.073) (-1077.271) [-1077.668] -- 0:02:33
211000 -- (-1087.859) (-1077.738) [-1084.691] (-1073.322) * (-1077.705) (-1078.509) (-1088.860) [-1072.974] -- 0:02:33
211500 -- (-1082.721) (-1077.212) (-1078.719) [-1072.905] * (-1078.006) (-1081.168) [-1080.036] (-1076.283) -- 0:02:32
212000 -- (-1084.457) [-1078.901] (-1080.765) (-1082.734) * (-1079.659) [-1080.991] (-1084.603) (-1077.221) -- 0:02:32
212500 -- (-1078.646) (-1076.788) [-1081.318] (-1075.608) * (-1078.714) (-1085.617) (-1087.073) [-1074.014] -- 0:02:31
213000 -- (-1080.306) [-1078.157] (-1086.714) (-1082.137) * [-1078.499] (-1080.879) (-1083.759) (-1077.046) -- 0:02:31
213500 -- [-1078.651] (-1077.795) (-1084.957) (-1084.911) * [-1083.667] (-1084.881) (-1078.929) (-1076.371) -- 0:02:31
214000 -- [-1082.593] (-1073.459) (-1085.084) (-1072.480) * [-1078.661] (-1084.434) (-1074.975) (-1081.515) -- 0:02:30
214500 -- (-1081.163) [-1084.369] (-1081.939) (-1076.726) * (-1077.558) (-1081.049) [-1076.981] (-1083.532) -- 0:02:30
215000 -- (-1080.127) [-1075.728] (-1079.201) (-1073.855) * [-1076.958] (-1078.441) (-1075.101) (-1075.336) -- 0:02:33
Average standard deviation of split frequencies: 0.010476
215500 -- (-1078.344) (-1076.908) (-1078.176) [-1077.512] * (-1081.095) [-1072.806] (-1081.920) (-1075.646) -- 0:02:32
216000 -- [-1076.257] (-1080.419) (-1086.349) (-1081.029) * (-1079.740) [-1078.333] (-1078.907) (-1079.848) -- 0:02:32
216500 -- [-1076.075] (-1086.698) (-1082.777) (-1081.115) * (-1078.414) [-1076.515] (-1081.493) (-1080.455) -- 0:02:31
217000 -- (-1079.720) (-1079.375) (-1078.365) [-1087.268] * (-1078.927) (-1080.515) (-1082.270) [-1078.369] -- 0:02:31
217500 -- [-1076.439] (-1085.303) (-1074.924) (-1089.956) * (-1078.899) (-1077.702) [-1076.497] (-1077.918) -- 0:02:31
218000 -- [-1073.859] (-1077.671) (-1079.072) (-1085.065) * (-1077.904) [-1077.518] (-1076.614) (-1080.937) -- 0:02:30
218500 -- [-1082.551] (-1080.223) (-1081.674) (-1077.933) * (-1076.255) (-1083.300) [-1075.567] (-1080.200) -- 0:02:30
219000 -- [-1078.435] (-1077.250) (-1083.067) (-1078.317) * (-1083.193) (-1077.150) [-1080.440] (-1077.125) -- 0:02:29
219500 -- (-1080.086) [-1083.493] (-1089.114) (-1081.229) * (-1084.777) (-1079.959) (-1079.403) [-1079.285] -- 0:02:29
220000 -- (-1077.804) (-1087.689) (-1075.745) [-1078.990] * (-1079.983) [-1074.722] (-1080.252) (-1076.384) -- 0:02:28
Average standard deviation of split frequencies: 0.007691
220500 -- (-1077.833) (-1079.093) [-1076.692] (-1080.232) * (-1076.231) (-1076.388) [-1080.878] (-1079.730) -- 0:02:32
221000 -- (-1078.468) (-1080.694) [-1078.109] (-1083.331) * (-1079.622) [-1081.846] (-1086.565) (-1076.742) -- 0:02:31
221500 -- [-1082.238] (-1083.735) (-1081.342) (-1079.224) * (-1080.145) (-1082.174) (-1078.610) [-1082.781] -- 0:02:31
222000 -- (-1079.067) [-1077.218] (-1081.910) (-1083.412) * (-1079.035) (-1079.590) (-1073.513) [-1085.380] -- 0:02:30
222500 -- (-1073.597) (-1082.720) (-1078.348) [-1079.405] * (-1079.625) (-1081.512) [-1074.319] (-1081.349) -- 0:02:30
223000 -- (-1079.275) (-1082.864) (-1081.607) [-1079.155] * (-1080.088) [-1085.473] (-1081.561) (-1082.720) -- 0:02:29
223500 -- (-1082.788) (-1082.107) (-1083.865) [-1081.519] * (-1083.399) (-1084.578) [-1076.818] (-1081.747) -- 0:02:29
224000 -- (-1079.419) [-1084.501] (-1081.421) (-1079.640) * (-1079.835) (-1083.034) (-1079.955) [-1074.921] -- 0:02:28
224500 -- [-1074.521] (-1085.461) (-1084.425) (-1082.016) * (-1077.981) [-1075.758] (-1087.660) (-1078.414) -- 0:02:28
225000 -- (-1094.493) (-1084.638) [-1083.487] (-1083.564) * (-1076.320) [-1081.208] (-1082.046) (-1079.143) -- 0:02:28
Average standard deviation of split frequencies: 0.006675
225500 -- (-1090.113) [-1077.339] (-1080.973) (-1076.506) * (-1077.421) [-1080.164] (-1075.819) (-1079.545) -- 0:02:31
226000 -- (-1088.960) (-1080.590) [-1081.268] (-1076.365) * (-1078.790) [-1078.933] (-1084.530) (-1079.440) -- 0:02:30
226500 -- (-1082.517) (-1079.863) [-1075.317] (-1081.911) * (-1081.366) (-1076.407) (-1076.774) [-1078.562] -- 0:02:30
227000 -- (-1081.411) [-1073.899] (-1076.542) (-1084.413) * (-1078.176) (-1081.597) [-1079.296] (-1080.389) -- 0:02:29
227500 -- (-1091.847) [-1077.606] (-1077.333) (-1081.319) * (-1082.433) (-1082.882) (-1075.362) [-1082.218] -- 0:02:29
228000 -- [-1083.566] (-1078.138) (-1081.691) (-1083.375) * (-1086.578) (-1076.124) [-1078.899] (-1080.655) -- 0:02:28
228500 -- (-1080.850) [-1074.092] (-1077.197) (-1080.488) * (-1086.307) [-1077.025] (-1078.741) (-1078.094) -- 0:02:28
229000 -- (-1088.705) (-1078.925) [-1077.009] (-1078.585) * (-1090.692) [-1073.449] (-1071.934) (-1076.579) -- 0:02:28
229500 -- (-1087.119) (-1080.501) [-1078.030] (-1079.455) * (-1082.481) [-1086.598] (-1075.972) (-1075.627) -- 0:02:27
230000 -- [-1079.281] (-1074.949) (-1084.496) (-1081.479) * [-1088.693] (-1085.104) (-1088.892) (-1076.752) -- 0:02:27
Average standard deviation of split frequencies: 0.010627
230500 -- (-1086.627) (-1080.279) [-1080.763] (-1077.434) * (-1077.252) (-1087.935) [-1082.465] (-1084.900) -- 0:02:30
231000 -- (-1077.943) [-1081.554] (-1078.156) (-1086.255) * (-1079.306) (-1086.222) (-1080.475) [-1080.313] -- 0:02:29
231500 -- [-1081.284] (-1083.074) (-1088.154) (-1079.986) * (-1083.745) (-1086.776) [-1076.489] (-1084.490) -- 0:02:29
232000 -- (-1078.859) (-1079.450) (-1082.354) [-1076.875] * (-1080.046) (-1085.769) [-1078.344] (-1084.777) -- 0:02:28
232500 -- [-1077.808] (-1077.422) (-1077.822) (-1075.183) * [-1082.988] (-1087.908) (-1080.868) (-1077.303) -- 0:02:28
233000 -- (-1078.547) (-1076.791) [-1079.976] (-1075.356) * [-1077.806] (-1077.916) (-1080.432) (-1080.728) -- 0:02:28
233500 -- (-1081.944) (-1084.261) (-1079.449) [-1081.153] * (-1084.386) (-1085.636) [-1077.517] (-1084.651) -- 0:02:27
234000 -- (-1084.672) (-1081.532) [-1077.446] (-1079.185) * (-1077.071) (-1081.751) (-1084.891) [-1077.553] -- 0:02:27
234500 -- (-1078.365) (-1075.464) [-1078.971] (-1080.160) * [-1077.015] (-1077.136) (-1076.616) (-1077.080) -- 0:02:26
235000 -- (-1074.954) (-1076.605) [-1075.177] (-1078.979) * (-1082.958) [-1077.213] (-1079.334) (-1079.052) -- 0:02:26
Average standard deviation of split frequencies: 0.008789
235500 -- (-1082.521) [-1081.352] (-1076.637) (-1080.245) * (-1077.731) [-1082.083] (-1078.033) (-1076.604) -- 0:02:26
236000 -- [-1077.864] (-1084.918) (-1077.563) (-1079.236) * [-1080.342] (-1085.858) (-1083.418) (-1079.880) -- 0:02:28
236500 -- (-1077.637) (-1082.371) [-1076.784] (-1075.247) * [-1075.384] (-1079.774) (-1080.648) (-1088.398) -- 0:02:28
237000 -- [-1073.476] (-1082.334) (-1085.200) (-1075.275) * (-1078.067) (-1081.976) [-1077.068] (-1082.050) -- 0:02:28
237500 -- (-1078.027) (-1079.464) (-1082.826) [-1077.066] * [-1075.603] (-1082.824) (-1088.673) (-1081.619) -- 0:02:27
238000 -- (-1077.521) (-1078.516) (-1082.813) [-1081.949] * (-1075.568) (-1079.003) (-1076.896) [-1085.277] -- 0:02:27
238500 -- (-1078.112) (-1087.894) [-1079.196] (-1077.037) * [-1081.754] (-1085.436) (-1084.657) (-1085.776) -- 0:02:26
239000 -- (-1084.769) [-1078.522] (-1077.156) (-1078.787) * [-1078.201] (-1087.473) (-1083.741) (-1075.037) -- 0:02:26
239500 -- [-1076.394] (-1080.353) (-1078.961) (-1081.400) * [-1075.730] (-1090.259) (-1078.338) (-1078.779) -- 0:02:26
240000 -- (-1078.470) (-1074.989) [-1076.165] (-1082.891) * [-1080.494] (-1087.295) (-1080.468) (-1081.196) -- 0:02:25
Average standard deviation of split frequencies: 0.009402
240500 -- (-1075.941) [-1074.699] (-1085.254) (-1081.137) * (-1075.415) (-1082.571) (-1073.924) [-1087.569] -- 0:02:25
241000 -- (-1074.627) (-1080.992) (-1076.086) [-1079.697] * (-1079.295) (-1083.947) [-1078.881] (-1081.302) -- 0:02:28
241500 -- (-1084.620) [-1077.261] (-1079.316) (-1085.503) * (-1083.462) (-1085.057) [-1072.348] (-1075.621) -- 0:02:27
242000 -- [-1075.822] (-1077.396) (-1078.683) (-1080.891) * (-1084.429) (-1079.637) [-1075.725] (-1086.812) -- 0:02:27
242500 -- [-1077.835] (-1086.325) (-1084.451) (-1080.537) * [-1084.645] (-1075.985) (-1082.622) (-1076.624) -- 0:02:26
243000 -- [-1080.867] (-1079.402) (-1082.831) (-1083.208) * (-1080.817) (-1077.684) (-1083.284) [-1083.228] -- 0:02:26
243500 -- [-1076.572] (-1077.233) (-1081.385) (-1079.052) * (-1077.952) [-1073.615] (-1078.264) (-1085.831) -- 0:02:26
244000 -- (-1079.894) (-1085.284) (-1085.627) [-1079.306] * [-1076.509] (-1075.822) (-1095.525) (-1083.941) -- 0:02:25
244500 -- (-1076.899) [-1078.419] (-1082.958) (-1085.670) * (-1078.347) (-1076.235) [-1081.150] (-1086.834) -- 0:02:25
245000 -- (-1086.211) (-1080.693) (-1082.646) [-1080.770] * (-1074.601) (-1083.529) [-1077.868] (-1086.019) -- 0:02:24
Average standard deviation of split frequencies: 0.008432
245500 -- (-1083.291) [-1078.302] (-1082.076) (-1085.685) * (-1077.157) (-1078.113) (-1076.062) [-1081.946] -- 0:02:24
246000 -- (-1076.786) (-1080.250) [-1075.938] (-1079.387) * (-1077.650) [-1083.412] (-1077.930) (-1082.007) -- 0:02:27
246500 -- (-1083.176) [-1079.314] (-1079.818) (-1084.276) * (-1077.994) [-1078.557] (-1091.240) (-1083.159) -- 0:02:26
247000 -- [-1082.090] (-1072.968) (-1075.955) (-1082.752) * (-1081.031) (-1074.800) [-1077.311] (-1090.350) -- 0:02:26
247500 -- (-1082.992) (-1079.826) [-1078.669] (-1082.371) * (-1079.577) (-1079.039) [-1074.653] (-1090.054) -- 0:02:25
248000 -- [-1085.674] (-1082.076) (-1081.956) (-1083.856) * [-1083.865] (-1077.280) (-1084.916) (-1083.467) -- 0:02:25
248500 -- (-1083.656) (-1092.056) [-1076.935] (-1078.724) * (-1080.956) (-1079.330) [-1073.705] (-1080.250) -- 0:02:25
249000 -- (-1077.697) (-1079.797) (-1078.407) [-1079.470] * (-1075.406) (-1084.979) [-1075.649] (-1080.967) -- 0:02:24
249500 -- (-1087.185) (-1083.044) (-1078.151) [-1081.582] * (-1078.646) [-1077.886] (-1081.518) (-1078.973) -- 0:02:24
250000 -- (-1083.813) [-1078.885] (-1075.916) (-1086.294) * (-1077.547) (-1079.023) [-1076.048] (-1084.090) -- 0:02:24
Average standard deviation of split frequencies: 0.006770
250500 -- [-1080.500] (-1078.408) (-1075.245) (-1090.792) * (-1080.961) (-1083.612) [-1079.440] (-1077.243) -- 0:02:23
251000 -- [-1082.688] (-1075.647) (-1078.632) (-1078.664) * [-1077.052] (-1084.210) (-1077.100) (-1077.040) -- 0:02:26
251500 -- (-1085.318) [-1077.410] (-1076.741) (-1082.249) * (-1085.454) (-1077.039) [-1080.309] (-1083.852) -- 0:02:25
252000 -- (-1085.554) [-1079.586] (-1077.763) (-1078.744) * (-1081.440) (-1088.056) [-1078.504] (-1080.758) -- 0:02:25
252500 -- (-1090.426) (-1080.846) (-1079.285) [-1082.000] * (-1079.610) (-1079.052) [-1081.840] (-1076.154) -- 0:02:25
253000 -- (-1090.127) (-1077.268) [-1081.116] (-1078.361) * (-1081.366) (-1081.353) (-1080.041) [-1074.106] -- 0:02:24
253500 -- (-1085.553) (-1077.293) (-1076.408) [-1079.975] * [-1080.098] (-1085.715) (-1083.224) (-1080.951) -- 0:02:24
254000 -- (-1076.985) [-1079.759] (-1079.037) (-1085.890) * (-1079.332) [-1076.587] (-1083.574) (-1085.829) -- 0:02:23
254500 -- (-1079.204) (-1080.015) (-1079.153) [-1080.816] * [-1077.306] (-1078.853) (-1085.601) (-1076.773) -- 0:02:23
255000 -- (-1081.452) [-1083.073] (-1078.206) (-1080.349) * [-1078.220] (-1078.037) (-1093.675) (-1077.320) -- 0:02:23
Average standard deviation of split frequencies: 0.006629
255500 -- (-1083.720) (-1081.952) [-1081.399] (-1086.060) * (-1079.276) (-1088.890) [-1087.428] (-1076.683) -- 0:02:22
256000 -- [-1078.049] (-1082.003) (-1076.514) (-1089.748) * [-1079.120] (-1081.254) (-1081.950) (-1085.864) -- 0:02:22
256500 -- (-1083.674) [-1080.361] (-1083.827) (-1081.780) * [-1074.866] (-1078.419) (-1084.026) (-1081.401) -- 0:02:24
257000 -- (-1082.633) (-1085.772) [-1082.400] (-1078.089) * (-1080.195) [-1076.175] (-1086.704) (-1080.490) -- 0:02:24
257500 -- (-1088.436) [-1079.709] (-1075.822) (-1084.576) * (-1078.666) (-1085.602) (-1086.108) [-1080.626] -- 0:02:24
258000 -- (-1079.332) (-1081.377) [-1076.738] (-1080.525) * (-1083.858) (-1081.522) (-1081.157) [-1076.187] -- 0:02:23
258500 -- (-1083.129) (-1082.766) [-1079.411] (-1077.598) * (-1087.051) (-1079.840) [-1079.129] (-1073.751) -- 0:02:23
259000 -- (-1074.588) (-1084.064) [-1079.891] (-1086.793) * [-1076.047] (-1076.954) (-1087.786) (-1077.761) -- 0:02:23
259500 -- (-1080.489) (-1080.855) [-1082.878] (-1091.495) * (-1077.440) (-1084.288) (-1084.698) [-1072.435] -- 0:02:22
260000 -- [-1078.684] (-1079.042) (-1079.958) (-1091.049) * (-1083.487) (-1082.605) [-1085.763] (-1076.496) -- 0:02:22
Average standard deviation of split frequencies: 0.003617
260500 -- [-1080.684] (-1079.526) (-1086.406) (-1088.139) * (-1082.829) [-1078.755] (-1089.108) (-1082.287) -- 0:02:21
261000 -- [-1082.018] (-1078.955) (-1085.564) (-1087.806) * (-1078.040) [-1085.401] (-1080.815) (-1079.118) -- 0:02:21
261500 -- [-1075.223] (-1075.309) (-1085.476) (-1078.533) * (-1076.239) [-1081.256] (-1085.587) (-1078.387) -- 0:02:24
262000 -- [-1077.565] (-1079.097) (-1092.665) (-1082.482) * (-1079.565) (-1081.625) [-1075.227] (-1081.829) -- 0:02:23
262500 -- (-1080.933) (-1081.490) (-1086.794) [-1078.395] * [-1081.447] (-1075.174) (-1090.361) (-1080.473) -- 0:02:23
263000 -- (-1078.610) (-1079.066) [-1081.792] (-1079.666) * [-1081.363] (-1077.033) (-1088.810) (-1078.183) -- 0:02:22
263500 -- [-1077.284] (-1079.180) (-1079.291) (-1080.147) * [-1076.845] (-1075.610) (-1077.475) (-1075.248) -- 0:02:22
264000 -- [-1078.674] (-1078.748) (-1077.230) (-1077.765) * (-1080.697) [-1078.806] (-1078.195) (-1090.487) -- 0:02:22
264500 -- (-1082.293) (-1073.995) [-1080.484] (-1079.119) * (-1076.482) (-1081.589) [-1078.957] (-1075.057) -- 0:02:21
265000 -- (-1075.861) [-1074.443] (-1075.398) (-1079.901) * (-1084.568) [-1079.404] (-1075.102) (-1075.805) -- 0:02:21
Average standard deviation of split frequencies: 0.001418
265500 -- (-1079.489) [-1078.685] (-1075.590) (-1076.626) * (-1076.660) (-1079.463) [-1078.026] (-1081.091) -- 0:02:21
266000 -- (-1075.519) (-1077.933) [-1078.636] (-1093.022) * (-1081.130) (-1082.147) (-1078.163) [-1081.734] -- 0:02:20
266500 -- [-1083.397] (-1085.110) (-1075.740) (-1077.318) * [-1075.302] (-1080.228) (-1084.657) (-1086.101) -- 0:02:23
267000 -- (-1084.935) [-1076.008] (-1082.698) (-1079.568) * [-1074.812] (-1080.640) (-1088.874) (-1077.879) -- 0:02:22
267500 -- (-1078.252) (-1080.402) (-1093.501) [-1073.171] * [-1075.984] (-1082.233) (-1075.821) (-1083.219) -- 0:02:22
268000 -- (-1078.128) [-1075.019] (-1078.557) (-1076.923) * (-1080.547) (-1080.222) [-1076.339] (-1079.766) -- 0:02:22
268500 -- (-1075.863) (-1082.802) (-1076.919) [-1078.123] * [-1076.182] (-1083.259) (-1079.792) (-1083.064) -- 0:02:21
269000 -- [-1080.229] (-1079.111) (-1077.837) (-1075.087) * (-1084.000) (-1076.855) (-1091.330) [-1079.373] -- 0:02:21
269500 -- [-1078.057] (-1082.704) (-1074.797) (-1078.141) * [-1086.763] (-1082.441) (-1085.962) (-1079.004) -- 0:02:20
270000 -- (-1079.527) (-1079.136) [-1074.599] (-1083.320) * (-1090.326) (-1077.358) (-1080.138) [-1083.881] -- 0:02:20
Average standard deviation of split frequencies: 0.001393
270500 -- (-1078.424) (-1073.682) (-1079.122) [-1080.314] * (-1095.475) [-1077.725] (-1091.876) (-1080.901) -- 0:02:20
271000 -- (-1080.494) (-1077.947) [-1076.427] (-1079.873) * (-1079.606) (-1078.131) [-1084.722] (-1081.352) -- 0:02:19
271500 -- (-1080.270) [-1078.740] (-1078.098) (-1085.211) * (-1077.376) [-1080.320] (-1076.985) (-1084.167) -- 0:02:19
272000 -- (-1082.646) (-1081.236) [-1079.450] (-1078.977) * [-1080.126] (-1078.272) (-1078.591) (-1081.831) -- 0:02:21
272500 -- (-1082.596) [-1078.595] (-1081.970) (-1079.406) * (-1090.093) (-1077.832) (-1075.453) [-1079.759] -- 0:02:21
273000 -- [-1078.519] (-1081.242) (-1082.266) (-1085.666) * [-1076.384] (-1075.671) (-1081.702) (-1084.517) -- 0:02:21
273500 -- (-1082.096) [-1076.988] (-1079.522) (-1081.788) * (-1081.226) (-1078.203) (-1084.958) [-1081.652] -- 0:02:20
274000 -- (-1077.340) (-1082.147) [-1081.298] (-1079.847) * (-1075.321) (-1075.261) [-1076.728] (-1084.723) -- 0:02:20
274500 -- (-1079.281) [-1080.457] (-1084.787) (-1081.904) * [-1077.411] (-1077.177) (-1082.455) (-1092.490) -- 0:02:20
275000 -- [-1077.718] (-1078.879) (-1081.637) (-1084.898) * (-1078.676) [-1079.337] (-1080.956) (-1083.007) -- 0:02:19
Average standard deviation of split frequencies: 0.001366
275500 -- (-1081.503) [-1076.270] (-1086.836) (-1081.137) * [-1079.793] (-1075.173) (-1079.349) (-1084.077) -- 0:02:19
276000 -- [-1072.776] (-1084.103) (-1081.606) (-1080.751) * (-1079.927) [-1080.161] (-1087.383) (-1083.994) -- 0:02:19
276500 -- (-1081.628) (-1079.823) [-1078.073] (-1079.184) * (-1081.353) (-1080.355) [-1077.464] (-1075.282) -- 0:02:18
277000 -- [-1076.837] (-1083.522) (-1078.386) (-1080.764) * (-1083.559) [-1075.168] (-1076.617) (-1082.222) -- 0:02:20
277500 -- [-1078.021] (-1085.178) (-1079.785) (-1078.593) * [-1074.929] (-1076.718) (-1080.444) (-1079.195) -- 0:02:20
278000 -- (-1074.136) (-1084.175) (-1079.206) [-1083.341] * [-1080.167] (-1081.312) (-1078.400) (-1087.233) -- 0:02:20
278500 -- (-1083.186) (-1079.216) (-1087.127) [-1073.937] * (-1081.742) (-1084.164) [-1076.872] (-1082.252) -- 0:02:19
279000 -- (-1080.042) [-1077.050] (-1088.567) (-1074.266) * (-1074.490) [-1075.748] (-1076.494) (-1080.147) -- 0:02:19
279500 -- (-1089.693) (-1088.070) [-1083.059] (-1079.144) * (-1078.265) (-1077.011) (-1082.775) [-1079.792] -- 0:02:19
280000 -- (-1077.002) [-1080.203] (-1082.079) (-1075.664) * (-1078.373) (-1079.420) (-1082.024) [-1075.146] -- 0:02:18
Average standard deviation of split frequencies: 0.002016
280500 -- (-1080.731) [-1077.141] (-1086.498) (-1078.168) * (-1078.706) (-1077.958) [-1077.528] (-1083.529) -- 0:02:18
281000 -- [-1080.005] (-1082.149) (-1086.507) (-1084.810) * [-1079.444] (-1073.583) (-1077.876) (-1078.109) -- 0:02:18
281500 -- (-1082.168) [-1077.345] (-1081.648) (-1085.341) * (-1078.752) [-1083.320] (-1076.562) (-1078.603) -- 0:02:17
282000 -- [-1081.420] (-1079.507) (-1075.766) (-1079.263) * [-1078.163] (-1081.175) (-1078.322) (-1083.387) -- 0:02:20
282500 -- (-1097.704) (-1080.927) (-1082.956) [-1080.016] * (-1077.134) [-1083.492] (-1076.620) (-1086.060) -- 0:02:19
283000 -- (-1076.758) (-1078.560) (-1085.738) [-1079.258] * [-1076.308] (-1077.186) (-1074.327) (-1092.167) -- 0:02:19
283500 -- [-1072.897] (-1078.296) (-1080.218) (-1076.781) * (-1076.593) (-1084.087) [-1080.920] (-1078.842) -- 0:02:19
284000 -- (-1084.542) (-1082.820) [-1079.451] (-1075.787) * [-1079.335] (-1080.979) (-1076.973) (-1081.603) -- 0:02:18
284500 -- (-1089.695) (-1080.215) (-1077.043) [-1083.009] * (-1075.807) (-1080.445) [-1076.853] (-1088.612) -- 0:02:18
285000 -- (-1081.013) [-1075.232] (-1079.265) (-1079.129) * (-1082.147) (-1076.912) (-1078.589) [-1079.728] -- 0:02:17
Average standard deviation of split frequencies: 0.002637
285500 -- (-1078.396) (-1078.291) (-1086.278) [-1082.921] * (-1078.463) (-1076.208) (-1077.053) [-1079.405] -- 0:02:17
286000 -- (-1079.358) [-1077.270] (-1082.206) (-1088.133) * [-1078.431] (-1075.121) (-1082.925) (-1080.057) -- 0:02:17
286500 -- (-1084.492) (-1073.109) [-1081.519] (-1080.241) * (-1083.273) [-1076.144] (-1082.740) (-1081.314) -- 0:02:16
287000 -- (-1086.140) [-1078.128] (-1081.651) (-1090.891) * (-1079.502) (-1083.338) (-1084.657) [-1081.730] -- 0:02:19
287500 -- (-1088.918) (-1082.533) [-1076.359] (-1079.202) * (-1075.264) (-1083.694) [-1075.224] (-1081.472) -- 0:02:18
288000 -- (-1076.441) (-1086.038) [-1075.505] (-1085.083) * (-1080.721) [-1078.961] (-1079.258) (-1085.633) -- 0:02:18
288500 -- (-1077.450) [-1081.044] (-1080.256) (-1082.283) * (-1079.983) [-1079.902] (-1077.822) (-1080.900) -- 0:02:18
289000 -- (-1077.619) [-1078.128] (-1081.020) (-1081.219) * (-1075.426) [-1075.622] (-1079.849) (-1081.886) -- 0:02:17
289500 -- [-1078.793] (-1077.887) (-1080.600) (-1078.999) * (-1081.169) [-1077.695] (-1076.141) (-1076.642) -- 0:02:17
290000 -- [-1074.357] (-1080.416) (-1089.711) (-1081.775) * [-1085.353] (-1079.772) (-1078.001) (-1092.272) -- 0:02:17
Average standard deviation of split frequencies: 0.005190
290500 -- [-1076.012] (-1080.111) (-1079.176) (-1083.019) * [-1079.803] (-1080.280) (-1077.179) (-1090.442) -- 0:02:16
291000 -- [-1077.776] (-1078.313) (-1085.904) (-1076.089) * (-1080.118) [-1080.562] (-1084.104) (-1080.525) -- 0:02:16
291500 -- (-1082.885) (-1081.677) (-1084.328) [-1077.971] * (-1078.595) [-1075.899] (-1085.972) (-1077.106) -- 0:02:16
292000 -- (-1086.565) (-1084.625) (-1084.156) [-1079.744] * [-1079.072] (-1080.061) (-1077.804) (-1084.402) -- 0:02:18
292500 -- [-1081.039] (-1077.208) (-1089.788) (-1086.206) * (-1076.684) (-1081.487) (-1081.936) [-1080.367] -- 0:02:17
293000 -- (-1083.529) (-1076.197) [-1084.415] (-1081.836) * (-1078.879) [-1079.368] (-1082.803) (-1080.715) -- 0:02:17
293500 -- (-1083.696) [-1074.812] (-1083.443) (-1080.891) * (-1076.990) [-1080.381] (-1075.803) (-1082.049) -- 0:02:17
294000 -- (-1079.055) [-1076.244] (-1081.293) (-1079.783) * (-1080.345) (-1082.358) [-1076.720] (-1082.619) -- 0:02:16
294500 -- [-1075.218] (-1085.417) (-1081.232) (-1084.125) * (-1086.564) [-1082.970] (-1082.167) (-1082.221) -- 0:02:16
295000 -- (-1090.710) [-1076.899] (-1090.614) (-1083.714) * (-1077.698) (-1083.351) [-1083.021] (-1082.740) -- 0:02:16
Average standard deviation of split frequencies: 0.005096
295500 -- (-1083.146) [-1081.438] (-1079.293) (-1086.914) * [-1075.127] (-1079.473) (-1080.831) (-1082.009) -- 0:02:15
296000 -- (-1082.197) [-1079.845] (-1078.975) (-1080.548) * (-1077.571) [-1081.815] (-1085.946) (-1077.929) -- 0:02:15
296500 -- (-1081.017) [-1081.387] (-1079.208) (-1082.902) * [-1080.873] (-1079.717) (-1090.829) (-1087.804) -- 0:02:15
297000 -- (-1083.683) [-1080.827] (-1078.647) (-1089.516) * [-1078.116] (-1086.232) (-1088.683) (-1078.874) -- 0:02:17
297500 -- [-1081.498] (-1079.034) (-1075.742) (-1081.213) * (-1084.954) (-1081.529) (-1088.168) [-1080.890] -- 0:02:16
298000 -- (-1082.673) (-1088.883) [-1080.601] (-1076.367) * (-1087.837) [-1077.377] (-1083.997) (-1079.193) -- 0:02:16
298500 -- (-1075.167) (-1079.941) (-1076.087) [-1078.804] * (-1088.082) (-1078.964) [-1082.577] (-1083.378) -- 0:02:16
299000 -- (-1076.936) (-1076.065) (-1081.618) [-1080.880] * [-1075.646] (-1080.938) (-1078.753) (-1083.701) -- 0:02:15
299500 -- (-1082.061) (-1083.912) (-1082.058) [-1076.788] * (-1075.376) [-1083.240] (-1082.145) (-1080.314) -- 0:02:15
300000 -- [-1073.373] (-1072.339) (-1084.498) (-1081.710) * (-1083.763) (-1084.656) [-1076.927] (-1076.251) -- 0:02:15
Average standard deviation of split frequencies: 0.006271
300500 -- (-1082.814) (-1080.226) [-1080.890] (-1086.887) * [-1082.455] (-1082.593) (-1076.579) (-1092.252) -- 0:02:15
301000 -- [-1078.653] (-1080.366) (-1081.643) (-1083.062) * (-1080.156) (-1086.476) (-1075.739) [-1077.691] -- 0:02:14
301500 -- [-1080.222] (-1077.407) (-1081.437) (-1083.614) * [-1076.292] (-1082.448) (-1080.840) (-1080.563) -- 0:02:14
302000 -- [-1077.345] (-1078.741) (-1079.967) (-1079.581) * (-1077.928) (-1081.745) (-1081.670) [-1078.848] -- 0:02:16
302500 -- (-1077.200) (-1076.473) [-1080.600] (-1089.252) * (-1081.765) (-1081.969) (-1077.765) [-1077.428] -- 0:02:16
303000 -- (-1080.916) [-1076.827] (-1080.193) (-1079.763) * [-1080.324] (-1082.265) (-1075.874) (-1083.686) -- 0:02:15
303500 -- (-1087.600) [-1077.629] (-1077.881) (-1084.333) * (-1087.758) (-1087.611) (-1082.608) [-1084.356] -- 0:02:15
304000 -- (-1079.997) [-1079.038] (-1083.892) (-1081.656) * [-1081.935] (-1079.867) (-1075.785) (-1078.761) -- 0:02:15
304500 -- (-1085.003) [-1079.487] (-1080.637) (-1084.087) * (-1079.277) [-1080.250] (-1081.523) (-1075.730) -- 0:02:14
305000 -- (-1082.289) [-1080.442] (-1082.640) (-1090.753) * [-1081.375] (-1077.786) (-1082.321) (-1082.024) -- 0:02:14
Average standard deviation of split frequencies: 0.006778
305500 -- (-1080.423) (-1077.940) [-1083.133] (-1086.420) * (-1076.033) [-1076.409] (-1084.565) (-1081.663) -- 0:02:14
306000 -- (-1079.976) (-1080.027) [-1079.264] (-1081.946) * (-1075.370) (-1082.796) [-1086.958] (-1083.133) -- 0:02:13
306500 -- (-1076.979) [-1076.525] (-1075.479) (-1077.736) * (-1082.899) (-1077.518) (-1084.687) [-1077.937] -- 0:02:13
307000 -- (-1077.177) (-1084.007) [-1077.390] (-1080.402) * [-1078.404] (-1078.537) (-1078.992) (-1083.957) -- 0:02:15
307500 -- (-1084.425) (-1075.769) (-1085.652) [-1077.759] * [-1076.042] (-1082.218) (-1082.644) (-1084.210) -- 0:02:15
308000 -- (-1080.588) [-1083.462] (-1079.641) (-1091.478) * (-1082.680) [-1077.676] (-1080.175) (-1084.735) -- 0:02:14
308500 -- [-1083.445] (-1078.477) (-1077.221) (-1084.806) * (-1077.671) [-1080.513] (-1079.169) (-1082.403) -- 0:02:14
309000 -- (-1079.305) (-1083.126) [-1079.094] (-1083.585) * (-1077.886) (-1081.189) [-1079.213] (-1078.832) -- 0:02:14
309500 -- (-1081.645) (-1083.374) [-1079.893] (-1081.814) * [-1083.505] (-1076.119) (-1085.754) (-1078.838) -- 0:02:13
310000 -- [-1075.847] (-1082.478) (-1081.780) (-1080.022) * (-1072.707) [-1077.292] (-1079.916) (-1073.365) -- 0:02:13
Average standard deviation of split frequencies: 0.010925
310500 -- [-1074.558] (-1083.355) (-1076.370) (-1080.409) * [-1083.809] (-1080.434) (-1085.515) (-1084.083) -- 0:02:13
311000 -- (-1074.376) (-1078.626) (-1083.556) [-1088.428] * [-1080.159] (-1075.890) (-1080.336) (-1079.508) -- 0:02:12
311500 -- [-1074.021] (-1079.678) (-1084.377) (-1078.757) * (-1076.021) (-1074.762) (-1084.282) [-1075.180] -- 0:02:12
312000 -- [-1076.826] (-1083.119) (-1078.541) (-1082.959) * (-1080.821) (-1080.292) (-1085.855) [-1077.318] -- 0:02:12
312500 -- (-1079.878) (-1093.279) (-1082.657) [-1076.769] * [-1085.995] (-1080.808) (-1082.856) (-1079.738) -- 0:02:14
313000 -- [-1076.930] (-1088.729) (-1083.273) (-1079.021) * [-1076.468] (-1078.851) (-1077.810) (-1080.069) -- 0:02:13
313500 -- [-1075.561] (-1080.043) (-1082.670) (-1076.765) * (-1082.483) [-1077.995] (-1076.639) (-1076.736) -- 0:02:13
314000 -- (-1078.815) (-1079.898) [-1077.315] (-1078.328) * (-1080.920) (-1077.933) [-1075.146] (-1077.731) -- 0:02:13
314500 -- (-1085.344) (-1079.801) (-1083.261) [-1081.357] * [-1080.468] (-1087.708) (-1079.928) (-1077.977) -- 0:02:12
315000 -- (-1079.637) (-1081.463) [-1080.486] (-1078.429) * [-1078.768] (-1082.777) (-1077.134) (-1083.921) -- 0:02:12
Average standard deviation of split frequencies: 0.008354
315500 -- (-1077.065) [-1084.732] (-1083.857) (-1083.429) * (-1075.545) (-1077.779) [-1086.577] (-1081.182) -- 0:02:12
316000 -- [-1078.436] (-1074.195) (-1088.496) (-1081.811) * [-1076.058] (-1077.362) (-1084.850) (-1086.607) -- 0:02:12
316500 -- (-1074.905) [-1077.426] (-1084.164) (-1091.388) * (-1080.644) (-1080.881) (-1078.004) [-1076.707] -- 0:02:11
317000 -- [-1080.959] (-1075.218) (-1082.693) (-1084.012) * (-1076.903) (-1082.089) [-1074.938] (-1076.995) -- 0:02:11
317500 -- (-1085.677) (-1075.276) [-1075.363] (-1084.140) * (-1076.576) (-1080.388) [-1078.113] (-1081.957) -- 0:02:13
318000 -- [-1077.914] (-1079.389) (-1077.778) (-1086.283) * [-1072.781] (-1080.992) (-1082.431) (-1077.497) -- 0:02:12
318500 -- [-1080.307] (-1084.964) (-1076.992) (-1081.165) * (-1086.212) [-1081.931] (-1076.570) (-1075.911) -- 0:02:12
319000 -- [-1080.411] (-1081.117) (-1080.647) (-1083.712) * [-1076.336] (-1078.130) (-1083.939) (-1085.435) -- 0:02:12
319500 -- (-1073.511) (-1091.541) [-1076.796] (-1077.376) * [-1080.205] (-1083.269) (-1081.669) (-1079.059) -- 0:02:12
320000 -- [-1077.646] (-1082.603) (-1084.662) (-1077.998) * (-1082.351) (-1078.261) (-1077.054) [-1079.658] -- 0:02:11
Average standard deviation of split frequencies: 0.007056
320500 -- (-1082.063) (-1086.012) [-1075.319] (-1079.855) * (-1075.866) [-1075.657] (-1086.257) (-1082.268) -- 0:02:11
321000 -- (-1081.191) (-1082.759) (-1079.605) [-1078.335] * [-1074.508] (-1081.506) (-1080.031) (-1080.797) -- 0:02:11
321500 -- (-1080.786) (-1077.915) [-1079.817] (-1084.021) * (-1082.638) [-1076.133] (-1079.498) (-1077.760) -- 0:02:10
322000 -- [-1079.242] (-1077.542) (-1077.374) (-1081.689) * (-1078.349) [-1076.508] (-1079.813) (-1077.609) -- 0:02:10
322500 -- (-1076.731) (-1085.439) [-1071.593] (-1084.115) * (-1084.272) (-1079.438) [-1081.970] (-1077.973) -- 0:02:12
323000 -- [-1078.087] (-1084.474) (-1080.837) (-1087.969) * [-1076.936] (-1085.355) (-1086.268) (-1076.240) -- 0:02:12
323500 -- (-1083.771) [-1079.843] (-1081.016) (-1091.631) * (-1077.202) (-1079.623) [-1078.860] (-1077.812) -- 0:02:11
324000 -- (-1084.942) (-1077.572) [-1077.832] (-1078.756) * [-1076.617] (-1079.586) (-1071.437) (-1074.768) -- 0:02:11
324500 -- (-1084.293) [-1078.288] (-1077.767) (-1086.110) * (-1079.277) (-1073.089) [-1084.100] (-1077.399) -- 0:02:11
325000 -- (-1081.200) (-1079.155) [-1081.949] (-1082.394) * (-1080.476) (-1085.625) (-1079.481) [-1074.827] -- 0:02:10
Average standard deviation of split frequencies: 0.008098
325500 -- (-1075.769) [-1080.543] (-1075.023) (-1078.026) * (-1075.598) (-1079.253) (-1077.530) [-1081.303] -- 0:02:10
326000 -- [-1082.403] (-1076.511) (-1081.319) (-1083.460) * (-1078.892) (-1075.697) (-1078.526) [-1077.587] -- 0:02:10
326500 -- (-1076.208) (-1078.909) (-1084.758) [-1078.370] * (-1079.108) (-1079.904) (-1082.329) [-1080.920] -- 0:02:09
327000 -- (-1079.154) [-1080.794] (-1084.461) (-1081.882) * (-1086.406) [-1075.091] (-1079.720) (-1079.439) -- 0:02:09
327500 -- (-1072.308) [-1076.460] (-1089.352) (-1084.015) * (-1085.166) [-1078.190] (-1077.677) (-1080.348) -- 0:02:11
328000 -- (-1077.065) [-1075.130] (-1085.411) (-1082.603) * (-1074.194) [-1079.754] (-1078.771) (-1086.444) -- 0:02:11
328500 -- (-1084.097) (-1087.487) (-1085.833) [-1081.179] * (-1091.072) (-1085.465) [-1080.088] (-1084.137) -- 0:02:10
329000 -- [-1076.009] (-1081.380) (-1083.248) (-1087.987) * [-1077.501] (-1087.255) (-1082.947) (-1082.051) -- 0:02:10
329500 -- [-1084.655] (-1083.061) (-1086.535) (-1088.745) * (-1079.684) (-1084.123) [-1077.406] (-1082.492) -- 0:02:10
330000 -- (-1089.206) [-1075.985] (-1077.711) (-1079.704) * [-1075.835] (-1081.332) (-1079.893) (-1088.487) -- 0:02:09
Average standard deviation of split frequencies: 0.007983
330500 -- (-1085.623) (-1077.915) [-1082.459] (-1078.075) * (-1083.136) (-1078.917) (-1081.855) [-1084.628] -- 0:02:09
331000 -- (-1086.577) [-1077.834] (-1083.863) (-1083.718) * (-1084.753) (-1080.061) [-1080.023] (-1084.557) -- 0:02:09
331500 -- (-1083.404) (-1076.978) [-1083.978] (-1080.194) * (-1080.513) (-1081.077) [-1080.349] (-1077.801) -- 0:02:09
332000 -- [-1083.747] (-1078.961) (-1081.019) (-1082.138) * (-1083.633) [-1075.463] (-1080.863) (-1084.959) -- 0:02:08
332500 -- (-1077.600) [-1079.655] (-1078.655) (-1085.983) * (-1078.884) [-1077.483] (-1086.900) (-1077.659) -- 0:02:10
333000 -- (-1079.372) (-1079.349) [-1075.647] (-1084.424) * (-1094.277) (-1078.843) [-1075.157] (-1080.201) -- 0:02:10
333500 -- (-1078.934) [-1072.718] (-1078.361) (-1085.151) * (-1076.022) [-1079.656] (-1077.448) (-1084.508) -- 0:02:09
334000 -- [-1074.531] (-1076.202) (-1073.862) (-1085.032) * [-1079.939] (-1088.446) (-1075.274) (-1083.442) -- 0:02:09
334500 -- (-1076.641) (-1081.911) (-1079.672) [-1072.891] * [-1077.947] (-1081.836) (-1073.957) (-1082.475) -- 0:02:09
335000 -- (-1077.641) (-1077.785) (-1081.828) [-1074.755] * (-1086.029) (-1075.838) [-1078.631] (-1082.712) -- 0:02:09
Average standard deviation of split frequencies: 0.005612
335500 -- (-1078.404) (-1079.641) (-1084.861) [-1080.691] * (-1079.355) [-1076.829] (-1083.901) (-1097.940) -- 0:02:08
336000 -- (-1079.138) (-1092.460) [-1072.887] (-1086.802) * (-1076.499) [-1080.152] (-1083.718) (-1082.579) -- 0:02:08
336500 -- (-1073.161) (-1084.195) (-1072.013) [-1076.807] * (-1076.282) (-1078.597) (-1077.553) [-1077.486] -- 0:02:08
337000 -- [-1079.489] (-1077.643) (-1077.869) (-1073.730) * (-1090.333) (-1076.518) [-1083.228] (-1075.049) -- 0:02:07
337500 -- (-1085.134) (-1075.752) [-1078.755] (-1078.004) * (-1090.480) (-1079.532) (-1080.658) [-1075.267] -- 0:02:09
338000 -- (-1081.714) (-1076.001) (-1078.159) [-1079.875] * (-1092.497) (-1082.104) (-1073.134) [-1074.277] -- 0:02:09
338500 -- (-1083.945) [-1079.109] (-1081.692) (-1078.735) * (-1090.301) [-1080.909] (-1074.263) (-1079.588) -- 0:02:08
339000 -- (-1084.023) (-1077.141) [-1078.373] (-1075.129) * (-1088.744) (-1075.258) (-1077.034) [-1092.418] -- 0:02:08
339500 -- [-1083.978] (-1075.610) (-1090.411) (-1083.665) * (-1075.417) (-1078.632) [-1078.186] (-1079.884) -- 0:02:08
340000 -- [-1077.643] (-1077.543) (-1086.685) (-1076.600) * (-1081.036) [-1080.802] (-1083.577) (-1082.106) -- 0:02:08
Average standard deviation of split frequencies: 0.006642
340500 -- (-1087.774) (-1074.020) [-1081.417] (-1084.225) * [-1077.281] (-1081.651) (-1081.102) (-1085.745) -- 0:02:07
341000 -- (-1082.072) (-1078.109) [-1082.242] (-1079.292) * (-1079.375) [-1078.132] (-1073.542) (-1083.762) -- 0:02:07
341500 -- (-1082.281) (-1076.487) (-1085.816) [-1074.209] * (-1081.269) (-1080.845) (-1075.309) [-1077.704] -- 0:02:07
342000 -- (-1082.912) [-1078.205] (-1074.379) (-1082.779) * [-1075.572] (-1079.219) (-1078.538) (-1081.707) -- 0:02:06
342500 -- (-1087.145) (-1086.791) [-1075.161] (-1077.139) * (-1078.670) [-1081.209] (-1075.018) (-1077.797) -- 0:02:06
343000 -- (-1079.216) (-1078.701) [-1086.678] (-1079.057) * [-1078.795] (-1079.634) (-1079.058) (-1078.721) -- 0:02:08
343500 -- (-1079.133) [-1074.766] (-1081.831) (-1083.407) * [-1083.213] (-1077.979) (-1076.286) (-1081.612) -- 0:02:08
344000 -- (-1080.156) (-1084.598) (-1078.472) [-1081.216] * (-1076.258) (-1082.106) (-1075.203) [-1080.683] -- 0:02:07
344500 -- (-1079.102) [-1081.649] (-1078.884) (-1088.484) * (-1083.496) (-1078.246) (-1081.426) [-1077.400] -- 0:02:07
345000 -- [-1076.764] (-1078.910) (-1081.439) (-1075.640) * (-1083.952) (-1084.918) (-1081.343) [-1082.890] -- 0:02:07
Average standard deviation of split frequencies: 0.008175
345500 -- [-1083.056] (-1078.746) (-1084.927) (-1072.232) * [-1079.714] (-1082.750) (-1081.109) (-1074.578) -- 0:02:06
346000 -- [-1077.154] (-1082.620) (-1083.056) (-1074.617) * (-1079.930) (-1086.889) (-1081.439) [-1079.208] -- 0:02:06
346500 -- [-1079.047] (-1083.972) (-1085.741) (-1075.211) * (-1081.229) [-1082.877] (-1080.203) (-1078.411) -- 0:02:06
347000 -- (-1088.660) [-1078.435] (-1080.889) (-1077.953) * [-1078.382] (-1081.108) (-1076.339) (-1081.347) -- 0:02:06
347500 -- [-1076.794] (-1075.122) (-1083.644) (-1078.621) * (-1088.911) (-1086.975) [-1079.135] (-1075.017) -- 0:02:05
348000 -- (-1082.941) [-1078.270] (-1080.584) (-1079.064) * (-1078.247) [-1078.657] (-1081.244) (-1077.996) -- 0:02:07
348500 -- (-1082.823) (-1082.167) [-1079.383] (-1078.185) * (-1080.263) (-1073.562) [-1078.883] (-1081.511) -- 0:02:07
349000 -- (-1080.408) (-1081.066) (-1079.990) [-1077.342] * (-1077.495) (-1074.697) (-1084.772) [-1080.400] -- 0:02:06
349500 -- (-1083.788) (-1079.968) [-1075.092] (-1079.150) * (-1079.514) (-1082.993) (-1079.157) [-1080.320] -- 0:02:06
350000 -- [-1078.943] (-1081.321) (-1076.492) (-1080.518) * [-1078.037] (-1080.510) (-1077.943) (-1083.596) -- 0:02:06
Average standard deviation of split frequencies: 0.008066
350500 -- (-1079.950) [-1086.883] (-1077.661) (-1081.139) * [-1078.052] (-1076.388) (-1088.031) (-1082.583) -- 0:02:06
351000 -- (-1078.795) (-1084.061) [-1077.504] (-1075.663) * [-1080.249] (-1079.282) (-1081.301) (-1081.456) -- 0:02:05
351500 -- (-1086.648) (-1079.239) [-1076.875] (-1082.065) * [-1084.141] (-1086.675) (-1075.908) (-1083.540) -- 0:02:05
352000 -- (-1079.590) (-1079.780) (-1075.527) [-1080.584] * (-1078.445) (-1076.412) (-1081.997) [-1085.609] -- 0:02:05
352500 -- (-1087.976) (-1077.084) (-1078.709) [-1075.070] * (-1081.625) (-1079.733) (-1085.047) [-1083.214] -- 0:02:04
353000 -- (-1087.830) [-1077.253] (-1077.217) (-1078.773) * (-1084.346) [-1080.776] (-1080.227) (-1078.195) -- 0:02:06
353500 -- (-1079.100) [-1080.478] (-1080.990) (-1076.720) * (-1090.265) (-1079.982) (-1081.181) [-1082.104] -- 0:02:06
354000 -- (-1081.960) [-1077.401] (-1087.849) (-1083.960) * [-1079.669] (-1080.164) (-1079.311) (-1076.309) -- 0:02:05
354500 -- [-1081.183] (-1079.481) (-1081.305) (-1089.403) * [-1082.109] (-1076.084) (-1080.071) (-1082.847) -- 0:02:05
355000 -- (-1078.325) (-1079.262) (-1079.744) [-1087.619] * [-1080.765] (-1076.448) (-1081.355) (-1081.084) -- 0:02:05
Average standard deviation of split frequencies: 0.005826
355500 -- [-1077.079] (-1085.188) (-1085.084) (-1078.676) * (-1075.680) (-1082.833) [-1082.556] (-1075.275) -- 0:02:05
356000 -- [-1077.221] (-1077.700) (-1076.483) (-1080.792) * (-1086.122) (-1083.479) (-1082.973) [-1080.008] -- 0:02:04
356500 -- [-1076.325] (-1076.797) (-1079.500) (-1087.871) * [-1072.921] (-1078.120) (-1083.996) (-1079.579) -- 0:02:04
357000 -- (-1079.121) [-1075.855] (-1076.995) (-1083.391) * (-1080.047) (-1076.798) [-1082.138] (-1079.572) -- 0:02:04
357500 -- (-1083.996) [-1080.401] (-1076.878) (-1084.095) * (-1084.885) [-1076.175] (-1076.387) (-1077.415) -- 0:02:04
358000 -- (-1080.512) (-1075.264) (-1093.488) [-1080.839] * (-1082.357) (-1083.527) (-1083.025) [-1080.072] -- 0:02:05
358500 -- [-1079.357] (-1079.254) (-1081.449) (-1076.213) * (-1078.517) [-1079.286] (-1084.918) (-1080.086) -- 0:02:05
359000 -- (-1081.356) (-1080.820) [-1076.181] (-1086.650) * (-1077.866) [-1078.999] (-1082.295) (-1074.900) -- 0:02:04
359500 -- (-1080.671) (-1088.226) (-1073.613) [-1084.440] * (-1080.519) (-1083.221) (-1074.141) [-1081.943] -- 0:02:04
360000 -- (-1082.003) (-1080.264) (-1078.763) [-1079.542] * (-1080.408) (-1090.439) (-1073.955) [-1079.435] -- 0:02:04
Average standard deviation of split frequencies: 0.004705
360500 -- (-1075.834) [-1080.517] (-1081.921) (-1080.055) * (-1077.743) [-1078.792] (-1076.028) (-1084.717) -- 0:02:04
361000 -- (-1077.518) (-1082.024) (-1077.987) [-1080.311] * [-1077.515] (-1079.479) (-1076.818) (-1079.069) -- 0:02:03
361500 -- (-1078.578) (-1075.948) [-1085.031] (-1077.402) * (-1074.606) (-1079.077) (-1083.703) [-1076.809] -- 0:02:03
362000 -- [-1083.133] (-1076.944) (-1088.439) (-1084.743) * (-1079.670) (-1088.786) (-1079.551) [-1077.072] -- 0:02:03
362500 -- [-1082.351] (-1089.123) (-1092.123) (-1081.306) * [-1075.144] (-1083.820) (-1076.488) (-1082.981) -- 0:02:03
363000 -- [-1081.487] (-1078.744) (-1082.634) (-1083.805) * (-1082.264) [-1084.652] (-1080.368) (-1079.806) -- 0:02:04
363500 -- (-1087.853) (-1075.384) [-1073.740] (-1077.929) * [-1076.717] (-1082.657) (-1081.225) (-1076.286) -- 0:02:04
364000 -- (-1073.853) (-1084.227) [-1075.432] (-1078.239) * [-1080.354] (-1083.086) (-1081.583) (-1078.034) -- 0:02:04
364500 -- [-1080.871] (-1077.221) (-1084.725) (-1081.173) * (-1079.448) (-1083.342) (-1078.396) [-1076.233] -- 0:02:03
365000 -- [-1079.455] (-1073.150) (-1080.436) (-1076.043) * (-1081.703) (-1085.225) (-1081.482) [-1078.312] -- 0:02:03
Average standard deviation of split frequencies: 0.003606
365500 -- (-1084.143) (-1084.644) [-1077.834] (-1077.159) * [-1078.950] (-1080.956) (-1084.398) (-1079.095) -- 0:02:03
366000 -- [-1079.471] (-1083.104) (-1080.429) (-1086.133) * [-1078.728] (-1085.260) (-1086.056) (-1080.722) -- 0:02:02
366500 -- [-1078.039] (-1080.266) (-1080.726) (-1078.885) * (-1079.865) [-1082.501] (-1088.726) (-1081.386) -- 0:02:02
367000 -- (-1078.065) (-1080.245) [-1077.066] (-1079.877) * [-1081.105] (-1081.386) (-1083.891) (-1077.089) -- 0:02:02
367500 -- (-1074.549) (-1077.207) [-1078.206] (-1073.803) * [-1078.195] (-1088.317) (-1080.476) (-1079.103) -- 0:02:02
368000 -- (-1090.038) (-1090.493) (-1083.013) [-1081.478] * (-1082.472) (-1084.769) [-1081.909] (-1078.308) -- 0:02:01
368500 -- (-1087.527) (-1088.999) [-1077.798] (-1077.964) * (-1075.150) (-1086.660) (-1082.387) [-1086.288] -- 0:02:03
369000 -- (-1075.410) (-1081.355) [-1078.512] (-1075.015) * [-1081.203] (-1077.198) (-1084.400) (-1075.660) -- 0:02:03
369500 -- (-1079.123) [-1076.477] (-1078.120) (-1084.766) * (-1078.175) (-1079.361) [-1088.062] (-1077.986) -- 0:02:02
370000 -- [-1076.970] (-1083.314) (-1079.572) (-1076.176) * (-1081.658) (-1078.187) (-1085.806) [-1081.573] -- 0:02:02
Average standard deviation of split frequencies: 0.003052
370500 -- (-1079.602) (-1079.288) (-1087.032) [-1079.061] * [-1075.311] (-1076.135) (-1083.852) (-1081.041) -- 0:02:02
371000 -- (-1077.933) [-1082.261] (-1075.051) (-1080.419) * (-1077.991) (-1083.130) [-1079.539] (-1077.429) -- 0:02:02
371500 -- [-1078.387] (-1078.514) (-1076.104) (-1083.339) * (-1085.261) [-1080.249] (-1079.949) (-1081.775) -- 0:02:01
372000 -- (-1080.606) [-1079.680] (-1079.208) (-1077.090) * [-1079.552] (-1080.118) (-1090.757) (-1080.330) -- 0:02:01
372500 -- (-1088.855) (-1077.614) (-1077.840) [-1081.225] * (-1080.006) (-1085.216) (-1078.636) [-1075.820] -- 0:02:01
373000 -- (-1086.701) (-1084.895) (-1085.924) [-1080.686] * (-1077.199) (-1076.648) (-1079.603) [-1077.114] -- 0:02:01
373500 -- (-1088.269) [-1080.809] (-1079.191) (-1078.409) * [-1076.790] (-1076.733) (-1079.964) (-1079.722) -- 0:02:02
374000 -- (-1087.204) (-1080.917) [-1077.992] (-1076.261) * (-1082.715) [-1077.308] (-1077.828) (-1077.240) -- 0:02:02
374500 -- [-1081.520] (-1079.351) (-1079.795) (-1082.470) * (-1080.673) (-1091.103) [-1078.177] (-1079.490) -- 0:02:01
375000 -- (-1077.925) (-1077.594) [-1081.682] (-1079.551) * (-1080.178) [-1075.865] (-1080.848) (-1082.701) -- 0:02:01
Average standard deviation of split frequencies: 0.003009
375500 -- [-1077.084] (-1079.710) (-1081.731) (-1076.666) * (-1076.977) (-1078.210) [-1081.151] (-1079.992) -- 0:02:01
376000 -- [-1077.714] (-1083.109) (-1077.204) (-1079.523) * (-1080.089) (-1085.991) (-1080.151) [-1080.237] -- 0:02:01
376500 -- (-1076.663) (-1080.081) [-1082.955] (-1077.906) * [-1077.782] (-1080.892) (-1080.735) (-1085.603) -- 0:02:00
377000 -- [-1076.723] (-1083.260) (-1078.806) (-1077.193) * [-1080.249] (-1081.716) (-1082.660) (-1085.041) -- 0:02:00
377500 -- (-1082.223) [-1079.889] (-1075.795) (-1080.959) * (-1086.179) (-1085.821) [-1079.367] (-1081.437) -- 0:02:00
378000 -- (-1082.662) [-1078.228] (-1084.252) (-1080.140) * [-1081.069] (-1076.428) (-1081.133) (-1083.100) -- 0:02:00
378500 -- [-1076.288] (-1077.104) (-1085.552) (-1088.562) * [-1081.808] (-1082.515) (-1081.896) (-1085.225) -- 0:02:01
379000 -- [-1076.316] (-1079.269) (-1079.710) (-1081.273) * [-1077.318] (-1081.100) (-1076.248) (-1085.498) -- 0:02:01
379500 -- (-1077.390) (-1086.027) [-1080.322] (-1075.129) * [-1078.236] (-1082.416) (-1077.361) (-1081.958) -- 0:02:00
380000 -- (-1075.437) (-1079.015) [-1078.694] (-1074.357) * (-1090.487) (-1079.967) [-1072.922] (-1080.693) -- 0:02:00
Average standard deviation of split frequencies: 0.001486
380500 -- (-1083.892) [-1072.752] (-1081.382) (-1078.090) * (-1078.810) (-1076.014) (-1076.729) [-1078.036] -- 0:02:00
381000 -- [-1077.751] (-1085.017) (-1076.839) (-1085.600) * (-1082.763) [-1082.060] (-1085.843) (-1078.127) -- 0:02:00
381500 -- (-1082.196) (-1080.130) (-1075.049) [-1084.205] * (-1077.415) (-1076.481) [-1075.580] (-1089.335) -- 0:01:59
382000 -- (-1077.249) [-1078.471] (-1080.322) (-1084.407) * (-1083.159) (-1080.118) [-1080.274] (-1078.556) -- 0:01:59
382500 -- [-1073.872] (-1083.460) (-1076.420) (-1080.727) * (-1077.436) (-1079.593) (-1075.927) [-1076.072] -- 0:01:59
383000 -- (-1076.180) (-1079.801) [-1076.566] (-1076.442) * (-1079.046) [-1073.149] (-1080.652) (-1081.606) -- 0:01:59
383500 -- [-1076.448] (-1079.928) (-1076.475) (-1081.313) * (-1092.872) [-1085.812] (-1085.851) (-1078.455) -- 0:02:00
384000 -- [-1077.321] (-1077.663) (-1076.269) (-1078.014) * (-1080.941) (-1074.602) (-1078.278) [-1078.703] -- 0:02:00
384500 -- (-1083.085) (-1076.295) [-1078.620] (-1073.657) * (-1091.601) [-1078.803] (-1079.839) (-1076.952) -- 0:02:00
385000 -- [-1078.515] (-1076.962) (-1081.406) (-1080.032) * (-1076.512) (-1079.228) [-1079.219] (-1077.237) -- 0:01:59
Average standard deviation of split frequencies: 0.001954
385500 -- (-1079.705) (-1078.839) (-1079.014) [-1075.331] * [-1078.550] (-1075.165) (-1077.318) (-1078.435) -- 0:01:59
386000 -- (-1082.909) [-1077.181] (-1084.947) (-1081.414) * (-1084.028) (-1076.911) [-1081.270] (-1080.323) -- 0:01:59
386500 -- [-1078.247] (-1080.437) (-1083.844) (-1075.704) * (-1080.060) (-1078.156) (-1079.156) [-1080.359] -- 0:01:59
387000 -- (-1081.968) (-1080.920) [-1077.595] (-1082.476) * [-1078.847] (-1075.780) (-1078.059) (-1077.568) -- 0:01:58
387500 -- (-1077.906) (-1080.946) [-1081.667] (-1082.091) * (-1080.319) [-1075.285] (-1079.712) (-1082.356) -- 0:01:58
388000 -- (-1080.810) (-1078.410) [-1077.344] (-1081.595) * (-1082.760) (-1073.421) (-1083.341) [-1078.079] -- 0:01:58
388500 -- [-1075.460] (-1078.385) (-1086.166) (-1084.886) * (-1076.971) [-1075.938] (-1079.375) (-1080.507) -- 0:01:59
389000 -- (-1081.096) (-1077.960) [-1083.590] (-1086.640) * (-1080.756) [-1077.013] (-1073.883) (-1080.541) -- 0:01:59
389500 -- (-1078.016) [-1081.898] (-1080.835) (-1080.438) * [-1082.508] (-1079.362) (-1080.507) (-1082.116) -- 0:01:59
390000 -- [-1081.212] (-1079.608) (-1088.004) (-1080.095) * (-1077.195) (-1078.217) (-1075.877) [-1073.958] -- 0:01:58
Average standard deviation of split frequencies: 0.002896
390500 -- (-1079.040) (-1078.704) [-1078.323] (-1076.190) * (-1082.592) (-1078.458) [-1081.316] (-1079.602) -- 0:01:58
391000 -- (-1080.785) [-1076.470] (-1085.656) (-1082.096) * (-1078.562) (-1075.825) [-1077.070] (-1078.975) -- 0:01:58
391500 -- (-1078.174) [-1084.802] (-1082.940) (-1076.866) * (-1075.776) [-1077.582] (-1076.757) (-1078.298) -- 0:01:58
392000 -- (-1077.177) (-1078.003) (-1076.670) [-1077.130] * (-1084.198) (-1076.666) (-1076.473) [-1075.140] -- 0:01:57
392500 -- (-1077.147) [-1077.586] (-1073.902) (-1075.459) * (-1083.675) (-1078.032) (-1081.644) [-1077.171] -- 0:01:57
393000 -- (-1076.957) (-1078.418) [-1083.249] (-1075.728) * (-1083.004) (-1075.548) (-1080.361) [-1078.435] -- 0:01:57
393500 -- (-1081.904) (-1080.664) (-1079.259) [-1076.169] * [-1079.000] (-1080.408) (-1086.654) (-1078.894) -- 0:01:57
394000 -- (-1082.066) [-1078.946] (-1078.077) (-1093.896) * (-1083.064) (-1080.782) (-1080.196) [-1073.397] -- 0:01:58
394500 -- (-1078.788) (-1081.537) [-1077.227] (-1080.468) * (-1077.774) (-1085.575) (-1082.535) [-1075.190] -- 0:01:58
395000 -- (-1081.380) (-1076.639) (-1080.890) [-1078.352] * (-1080.140) (-1083.483) (-1080.522) [-1081.646] -- 0:01:57
Average standard deviation of split frequencies: 0.003809
395500 -- [-1073.833] (-1082.192) (-1078.249) (-1078.925) * [-1090.741] (-1083.820) (-1078.851) (-1076.774) -- 0:01:57
396000 -- (-1078.800) (-1075.777) (-1083.267) [-1078.471] * (-1080.604) [-1076.981] (-1076.365) (-1076.497) -- 0:01:57
396500 -- (-1078.532) (-1084.405) (-1081.993) [-1079.521] * [-1077.476] (-1083.392) (-1084.301) (-1077.601) -- 0:01:57
397000 -- (-1070.827) (-1075.895) [-1081.409] (-1078.624) * (-1079.458) (-1077.088) [-1076.191] (-1074.757) -- 0:01:56
397500 -- (-1078.815) (-1078.852) (-1083.049) [-1082.611] * (-1088.048) (-1081.218) [-1076.032] (-1080.479) -- 0:01:56
398000 -- (-1082.450) (-1084.767) [-1082.710] (-1079.455) * (-1083.201) (-1075.520) (-1075.891) [-1076.394] -- 0:01:56
398500 -- (-1084.961) (-1091.947) [-1075.494] (-1077.953) * (-1078.119) (-1075.062) (-1087.630) [-1082.922] -- 0:01:56
399000 -- (-1078.641) [-1090.103] (-1076.426) (-1084.446) * (-1075.044) (-1081.289) [-1080.116] (-1083.452) -- 0:01:57
399500 -- [-1082.338] (-1091.771) (-1083.024) (-1079.015) * (-1080.111) (-1082.966) (-1084.805) [-1076.550] -- 0:01:57
400000 -- [-1080.761] (-1082.145) (-1088.293) (-1080.087) * (-1079.936) (-1083.972) (-1079.407) [-1085.746] -- 0:01:57
Average standard deviation of split frequencies: 0.004236
400500 -- [-1080.842] (-1082.705) (-1078.126) (-1082.561) * [-1085.331] (-1090.316) (-1082.091) (-1075.829) -- 0:01:56
401000 -- (-1075.110) (-1082.906) (-1080.560) [-1085.740] * (-1085.449) (-1079.418) (-1085.456) [-1074.718] -- 0:01:56
401500 -- (-1076.476) (-1079.112) [-1076.766] (-1085.899) * [-1081.760] (-1080.858) (-1075.900) (-1074.976) -- 0:01:56
402000 -- [-1079.593] (-1083.693) (-1077.123) (-1085.894) * (-1086.692) (-1079.752) (-1083.600) [-1077.360] -- 0:01:56
402500 -- (-1081.061) [-1081.873] (-1084.400) (-1082.335) * [-1074.358] (-1086.997) (-1085.394) (-1076.926) -- 0:01:55
403000 -- (-1083.469) [-1083.266] (-1086.740) (-1084.482) * [-1082.069] (-1086.458) (-1080.861) (-1076.378) -- 0:01:55
403500 -- (-1078.182) [-1075.708] (-1079.529) (-1082.148) * [-1080.077] (-1081.901) (-1076.570) (-1085.221) -- 0:01:55
404000 -- (-1088.609) [-1077.818] (-1077.770) (-1083.541) * (-1082.784) (-1077.136) [-1082.875] (-1080.071) -- 0:01:56
404500 -- [-1080.550] (-1081.252) (-1081.873) (-1092.168) * [-1084.546] (-1081.028) (-1081.200) (-1077.811) -- 0:01:56
405000 -- [-1075.637] (-1084.006) (-1076.117) (-1086.968) * (-1083.935) (-1081.613) (-1090.227) [-1077.768] -- 0:01:56
Average standard deviation of split frequencies: 0.003716
405500 -- (-1075.070) (-1079.209) [-1080.343] (-1081.998) * [-1073.446] (-1089.422) (-1080.591) (-1085.067) -- 0:01:55
406000 -- (-1077.636) [-1076.254] (-1078.467) (-1077.840) * [-1077.363] (-1093.159) (-1084.547) (-1078.058) -- 0:01:55
406500 -- (-1084.188) [-1077.369] (-1076.907) (-1073.354) * (-1073.958) (-1087.354) [-1079.630] (-1082.190) -- 0:01:55
407000 -- (-1076.833) (-1080.931) [-1075.858] (-1084.604) * (-1075.501) (-1085.054) [-1078.412] (-1077.561) -- 0:01:55
407500 -- [-1077.013] (-1077.707) (-1077.241) (-1083.179) * (-1079.133) (-1090.126) (-1086.649) [-1077.978] -- 0:01:54
408000 -- [-1078.179] (-1079.939) (-1082.244) (-1082.337) * [-1077.380] (-1090.259) (-1077.368) (-1073.206) -- 0:01:54
408500 -- [-1075.372] (-1086.185) (-1081.882) (-1085.580) * (-1079.319) [-1079.053] (-1079.568) (-1078.554) -- 0:01:54
409000 -- (-1075.249) (-1086.165) (-1084.513) [-1076.348] * [-1079.412] (-1086.550) (-1075.500) (-1081.436) -- 0:01:55
409500 -- (-1081.395) [-1080.860] (-1081.839) (-1078.782) * (-1083.882) [-1079.871] (-1074.987) (-1075.605) -- 0:01:55
410000 -- [-1076.256] (-1081.106) (-1088.096) (-1082.567) * [-1077.418] (-1082.299) (-1080.435) (-1078.545) -- 0:01:55
Average standard deviation of split frequencies: 0.001837
410500 -- (-1080.716) [-1078.012] (-1090.502) (-1077.248) * (-1082.698) (-1082.179) (-1083.119) [-1078.275] -- 0:01:54
411000 -- (-1080.268) [-1076.187] (-1079.607) (-1081.564) * (-1085.217) (-1080.466) (-1075.499) [-1078.351] -- 0:01:54
411500 -- [-1075.757] (-1080.228) (-1082.334) (-1082.051) * (-1083.606) [-1076.814] (-1082.818) (-1077.217) -- 0:01:54
412000 -- (-1084.727) [-1076.149] (-1079.864) (-1078.297) * (-1078.205) [-1076.249] (-1087.341) (-1081.781) -- 0:01:54
412500 -- (-1080.124) (-1077.486) [-1079.309] (-1084.774) * (-1079.049) (-1079.284) (-1087.022) [-1079.968] -- 0:01:53
413000 -- (-1080.342) [-1083.037] (-1085.002) (-1081.885) * (-1081.537) [-1080.652] (-1087.029) (-1078.262) -- 0:01:53
413500 -- (-1076.739) (-1087.097) (-1078.028) [-1076.552] * (-1081.826) [-1079.942] (-1073.130) (-1078.749) -- 0:01:53
414000 -- (-1078.398) (-1078.378) [-1080.078] (-1084.581) * (-1079.326) (-1078.005) [-1078.929] (-1085.928) -- 0:01:53
414500 -- (-1080.302) (-1075.476) [-1077.499] (-1083.704) * (-1088.455) (-1080.663) (-1078.523) [-1082.319] -- 0:01:54
415000 -- (-1081.259) (-1079.593) [-1081.578] (-1080.041) * (-1085.664) (-1086.054) (-1083.296) [-1081.792] -- 0:01:54
Average standard deviation of split frequencies: 0.001360
415500 -- [-1076.325] (-1079.266) (-1076.453) (-1078.688) * (-1076.339) [-1081.008] (-1080.504) (-1087.484) -- 0:01:53
416000 -- (-1079.608) [-1082.756] (-1080.137) (-1082.494) * (-1077.397) (-1079.249) (-1087.236) [-1081.591] -- 0:01:53
416500 -- (-1083.337) (-1081.755) (-1082.792) [-1080.986] * (-1076.887) (-1080.597) (-1074.749) [-1078.469] -- 0:01:53
417000 -- [-1078.858] (-1075.595) (-1076.181) (-1078.441) * (-1078.057) [-1082.250] (-1079.200) (-1073.672) -- 0:01:53
417500 -- (-1079.383) [-1078.869] (-1076.288) (-1082.797) * (-1078.232) (-1084.421) [-1082.133] (-1083.519) -- 0:01:53
418000 -- (-1080.533) (-1081.281) (-1079.340) [-1075.614] * (-1075.771) (-1073.480) (-1077.148) [-1074.628] -- 0:01:52
418500 -- [-1079.706] (-1083.193) (-1084.601) (-1082.160) * (-1082.740) (-1073.746) [-1078.452] (-1081.905) -- 0:01:52
419000 -- (-1089.874) [-1079.937] (-1085.838) (-1086.576) * (-1081.956) (-1076.893) (-1081.946) [-1078.248] -- 0:01:52
419500 -- [-1080.435] (-1077.937) (-1089.930) (-1074.097) * (-1078.518) (-1081.184) [-1080.918] (-1076.750) -- 0:01:53
420000 -- (-1079.693) [-1076.357] (-1081.790) (-1080.535) * (-1083.041) [-1075.564] (-1078.743) (-1078.625) -- 0:01:53
Average standard deviation of split frequencies: 0.000896
420500 -- (-1083.523) [-1080.050] (-1086.896) (-1077.061) * (-1085.523) (-1078.690) (-1078.718) [-1081.389] -- 0:01:53
421000 -- (-1077.227) (-1085.904) (-1086.720) [-1075.868] * (-1081.465) [-1076.078] (-1083.966) (-1081.314) -- 0:01:52
421500 -- (-1085.540) (-1079.917) (-1081.150) [-1085.191] * (-1080.492) (-1076.452) [-1080.279] (-1075.055) -- 0:01:52
422000 -- (-1077.419) (-1075.078) [-1075.760] (-1080.008) * (-1077.808) (-1081.166) [-1073.506] (-1080.775) -- 0:01:52
422500 -- (-1081.250) [-1080.441] (-1082.844) (-1081.685) * (-1075.033) (-1082.264) [-1074.091] (-1081.970) -- 0:01:52
423000 -- (-1075.665) [-1083.717] (-1076.778) (-1082.831) * (-1077.271) [-1077.898] (-1078.544) (-1082.323) -- 0:01:51
423500 -- (-1081.065) [-1077.945] (-1080.789) (-1082.819) * [-1078.952] (-1081.631) (-1079.885) (-1078.663) -- 0:01:51
424000 -- (-1081.386) [-1078.726] (-1083.178) (-1086.946) * (-1080.292) [-1079.523] (-1079.611) (-1081.862) -- 0:01:51
424500 -- (-1081.731) [-1075.599] (-1095.479) (-1090.077) * (-1079.831) [-1079.751] (-1078.475) (-1081.735) -- 0:01:52
425000 -- (-1077.171) [-1076.836] (-1085.710) (-1088.718) * (-1087.866) (-1091.593) [-1081.254] (-1084.327) -- 0:01:52
Average standard deviation of split frequencies: 0.001328
425500 -- (-1083.564) (-1084.670) (-1086.985) [-1078.221] * (-1085.789) (-1080.707) (-1085.697) [-1082.620] -- 0:01:52
426000 -- (-1083.362) (-1085.614) (-1083.858) [-1081.075] * [-1082.890] (-1089.564) (-1078.495) (-1080.288) -- 0:01:51
426500 -- (-1079.783) [-1080.952] (-1074.428) (-1083.306) * [-1076.569] (-1081.601) (-1077.477) (-1077.684) -- 0:01:51
427000 -- [-1076.136] (-1087.685) (-1088.019) (-1076.908) * [-1076.012] (-1080.870) (-1075.537) (-1086.122) -- 0:01:51
427500 -- [-1076.553] (-1085.940) (-1080.605) (-1082.628) * (-1081.565) (-1079.939) (-1083.025) [-1079.463] -- 0:01:51
428000 -- (-1080.367) [-1074.995] (-1080.811) (-1082.204) * (-1082.053) (-1080.555) (-1079.369) [-1074.805] -- 0:01:50
428500 -- [-1076.718] (-1081.823) (-1076.512) (-1084.764) * (-1076.454) (-1080.450) (-1080.023) [-1079.834] -- 0:01:50
429000 -- (-1081.692) (-1076.062) (-1077.185) [-1076.893] * [-1078.504] (-1077.696) (-1085.604) (-1084.725) -- 0:01:50
429500 -- (-1084.880) [-1078.053] (-1091.899) (-1078.415) * (-1084.744) [-1077.981] (-1079.215) (-1085.968) -- 0:01:51
430000 -- (-1078.799) [-1076.245] (-1084.734) (-1081.365) * [-1081.699] (-1076.436) (-1077.259) (-1085.466) -- 0:01:51
Average standard deviation of split frequencies: 0.001314
430500 -- (-1078.125) [-1077.171] (-1079.406) (-1080.349) * (-1081.368) (-1085.452) (-1083.680) [-1083.304] -- 0:01:51
431000 -- (-1082.466) (-1081.025) (-1076.794) [-1078.644] * (-1079.913) [-1076.570] (-1079.876) (-1081.919) -- 0:01:50
431500 -- (-1078.106) (-1080.956) (-1078.428) [-1079.612] * [-1081.477] (-1079.744) (-1078.074) (-1077.940) -- 0:01:50
432000 -- (-1077.362) (-1078.122) [-1079.560] (-1079.422) * (-1079.194) (-1078.773) [-1078.044] (-1075.772) -- 0:01:50
432500 -- [-1080.508] (-1087.414) (-1081.707) (-1079.936) * (-1080.210) [-1080.048] (-1087.762) (-1090.402) -- 0:01:50
433000 -- [-1078.225] (-1082.109) (-1083.140) (-1084.003) * [-1075.681] (-1082.627) (-1076.797) (-1080.324) -- 0:01:49
433500 -- (-1076.153) (-1083.273) [-1079.130] (-1080.159) * [-1079.638] (-1080.581) (-1076.990) (-1085.829) -- 0:01:49
434000 -- (-1078.056) [-1076.085] (-1080.359) (-1085.440) * (-1081.954) [-1077.044] (-1082.792) (-1093.548) -- 0:01:49
434500 -- (-1079.684) (-1080.389) (-1083.674) [-1076.532] * (-1082.282) [-1076.802] (-1081.441) (-1083.608) -- 0:01:50
435000 -- (-1082.077) (-1082.893) [-1075.884] (-1083.009) * [-1075.629] (-1081.368) (-1080.978) (-1077.231) -- 0:01:50
Average standard deviation of split frequencies: 0.000432
435500 -- (-1075.223) (-1080.819) [-1082.953] (-1082.124) * (-1076.619) (-1082.704) (-1076.020) [-1086.550] -- 0:01:50
436000 -- (-1085.266) (-1075.882) (-1081.400) [-1080.945] * (-1080.035) (-1085.472) (-1083.409) [-1080.130] -- 0:01:49
436500 -- (-1077.838) (-1078.093) [-1074.548] (-1086.026) * (-1076.108) (-1080.284) [-1082.323] (-1077.560) -- 0:01:49
437000 -- (-1079.616) (-1080.566) [-1081.677] (-1077.161) * (-1084.413) [-1079.188] (-1085.033) (-1077.871) -- 0:01:49
437500 -- (-1081.064) [-1083.710] (-1090.806) (-1079.662) * (-1078.642) [-1077.673] (-1080.130) (-1079.388) -- 0:01:49
438000 -- (-1076.589) (-1084.445) (-1085.514) [-1076.318] * (-1081.780) (-1088.845) (-1076.099) [-1077.463] -- 0:01:49
438500 -- [-1082.712] (-1077.046) (-1084.874) (-1081.281) * [-1078.116] (-1076.378) (-1080.348) (-1087.133) -- 0:01:48
439000 -- (-1084.478) (-1074.896) [-1076.810] (-1078.699) * (-1085.802) (-1081.651) [-1084.861] (-1079.145) -- 0:01:48
439500 -- (-1083.564) [-1081.901] (-1076.824) (-1093.235) * [-1079.469] (-1075.404) (-1081.522) (-1077.520) -- 0:01:48
440000 -- (-1082.123) (-1082.248) (-1079.681) [-1084.037] * (-1081.022) (-1078.883) (-1081.568) [-1074.807] -- 0:01:49
Average standard deviation of split frequencies: 0.001284
440500 -- (-1078.926) (-1074.858) [-1073.467] (-1080.971) * (-1080.159) [-1082.619] (-1074.409) (-1083.389) -- 0:01:49
441000 -- [-1081.862] (-1085.023) (-1079.281) (-1084.660) * (-1086.259) (-1077.475) (-1079.158) [-1076.455] -- 0:01:49
441500 -- (-1082.523) [-1081.998] (-1082.431) (-1079.980) * [-1073.862] (-1084.961) (-1076.490) (-1081.683) -- 0:01:48
442000 -- (-1090.058) (-1080.409) (-1082.611) [-1078.707] * (-1084.933) [-1078.061] (-1078.836) (-1077.195) -- 0:01:48
442500 -- [-1080.607] (-1081.439) (-1087.054) (-1085.721) * (-1082.365) [-1076.806] (-1076.108) (-1079.430) -- 0:01:48
443000 -- [-1078.600] (-1080.053) (-1081.023) (-1078.417) * [-1080.610] (-1074.535) (-1082.467) (-1079.942) -- 0:01:48
443500 -- (-1085.916) (-1085.861) (-1083.177) [-1077.603] * [-1086.706] (-1076.326) (-1082.152) (-1077.767) -- 0:01:47
444000 -- (-1079.600) [-1083.728] (-1076.625) (-1082.402) * (-1084.218) (-1079.592) [-1075.853] (-1079.099) -- 0:01:47
444500 -- (-1081.161) [-1081.672] (-1083.594) (-1076.557) * (-1082.229) (-1085.374) (-1079.338) [-1076.007] -- 0:01:47
445000 -- [-1073.510] (-1077.619) (-1084.073) (-1080.886) * (-1083.101) (-1076.140) (-1082.407) [-1082.705] -- 0:01:48
Average standard deviation of split frequencies: 0.001268
445500 -- (-1074.476) (-1076.352) [-1081.542] (-1079.984) * (-1086.451) (-1072.565) [-1079.589] (-1079.446) -- 0:01:48
446000 -- (-1080.491) (-1081.069) [-1077.730] (-1082.388) * [-1081.999] (-1079.184) (-1080.691) (-1086.575) -- 0:01:48
446500 -- (-1086.320) (-1075.362) (-1081.953) [-1076.757] * (-1078.944) [-1080.058] (-1075.696) (-1084.903) -- 0:01:47
447000 -- (-1078.865) (-1081.643) [-1078.125] (-1085.279) * [-1078.414] (-1083.901) (-1075.408) (-1086.687) -- 0:01:47
447500 -- (-1075.654) [-1082.558] (-1077.110) (-1078.078) * (-1084.119) [-1080.994] (-1076.937) (-1081.890) -- 0:01:47
448000 -- [-1079.592] (-1081.150) (-1082.872) (-1077.210) * (-1077.651) [-1080.088] (-1091.345) (-1079.449) -- 0:01:47
448500 -- (-1084.079) (-1083.796) (-1079.390) [-1072.681] * (-1083.737) (-1078.558) [-1083.945] (-1078.342) -- 0:01:46
449000 -- (-1078.097) (-1078.460) (-1074.419) [-1075.600] * (-1083.785) (-1077.187) (-1085.103) [-1076.954] -- 0:01:46
449500 -- (-1081.426) (-1080.334) (-1078.114) [-1076.210] * (-1081.347) (-1085.906) [-1085.322] (-1075.277) -- 0:01:46
450000 -- [-1075.551] (-1081.071) (-1086.624) (-1084.078) * (-1086.100) [-1079.967] (-1082.115) (-1076.927) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
450500 -- (-1076.098) (-1080.136) (-1081.179) [-1079.495] * [-1079.877] (-1081.779) (-1076.018) (-1077.928) -- 0:01:47
451000 -- (-1081.317) (-1080.851) [-1077.362] (-1084.007) * (-1093.307) (-1089.804) [-1079.441] (-1079.647) -- 0:01:47
451500 -- [-1077.333] (-1076.973) (-1077.326) (-1081.506) * (-1081.428) (-1078.654) (-1081.042) [-1079.061] -- 0:01:46
452000 -- (-1079.179) (-1089.186) (-1080.607) [-1077.873] * (-1082.263) (-1085.102) [-1080.524] (-1080.831) -- 0:01:46
452500 -- (-1079.626) [-1075.043] (-1079.894) (-1076.863) * (-1082.321) (-1080.864) [-1077.027] (-1089.805) -- 0:01:46
453000 -- (-1083.013) [-1074.925] (-1079.725) (-1075.633) * (-1078.375) [-1076.122] (-1079.223) (-1090.676) -- 0:01:46
453500 -- (-1077.551) (-1081.815) (-1081.838) [-1077.918] * (-1077.232) (-1090.611) [-1075.998] (-1081.153) -- 0:01:46
454000 -- (-1077.857) [-1075.080] (-1083.511) (-1076.644) * (-1087.390) (-1078.882) [-1081.114] (-1080.184) -- 0:01:45
454500 -- [-1078.037] (-1083.041) (-1079.534) (-1080.710) * (-1080.656) [-1079.187] (-1082.811) (-1079.271) -- 0:01:45
455000 -- (-1081.700) (-1077.231) [-1074.741] (-1081.794) * (-1085.315) (-1086.813) (-1081.555) [-1079.207] -- 0:01:46
Average standard deviation of split frequencies: 0.000827
455500 -- (-1083.504) (-1086.806) [-1077.519] (-1082.791) * (-1084.902) (-1084.652) (-1076.765) [-1079.380] -- 0:01:46
456000 -- (-1082.238) [-1081.517] (-1076.134) (-1080.414) * (-1076.874) (-1076.715) (-1084.084) [-1079.654] -- 0:01:46
456500 -- (-1078.031) (-1079.777) [-1082.788] (-1082.682) * (-1085.365) (-1080.377) [-1076.295] (-1080.344) -- 0:01:45
457000 -- (-1079.164) (-1083.387) [-1077.608] (-1084.590) * [-1078.537] (-1082.627) (-1078.982) (-1079.531) -- 0:01:45
457500 -- (-1077.631) [-1083.549] (-1082.847) (-1087.433) * (-1077.610) (-1077.522) (-1077.871) [-1084.464] -- 0:01:45
458000 -- [-1078.465] (-1086.771) (-1083.219) (-1080.243) * (-1086.716) (-1078.881) (-1075.237) [-1074.610] -- 0:01:45
458500 -- (-1078.548) (-1084.911) (-1079.338) [-1077.368] * (-1075.971) [-1078.572] (-1082.473) (-1082.166) -- 0:01:45
459000 -- [-1079.681] (-1086.268) (-1084.366) (-1082.266) * (-1075.886) (-1076.934) (-1074.111) [-1075.392] -- 0:01:44
459500 -- (-1088.794) (-1088.023) [-1090.303] (-1077.671) * [-1080.907] (-1074.553) (-1082.483) (-1080.983) -- 0:01:44
460000 -- (-1082.550) (-1084.471) (-1079.352) [-1074.124] * (-1079.637) (-1075.933) [-1076.894] (-1074.281) -- 0:01:45
Average standard deviation of split frequencies: 0.001637
460500 -- [-1081.719] (-1086.044) (-1075.340) (-1079.643) * [-1077.225] (-1081.201) (-1079.142) (-1074.227) -- 0:01:45
461000 -- [-1077.170] (-1077.359) (-1081.634) (-1079.025) * (-1078.511) (-1075.257) [-1078.500] (-1078.745) -- 0:01:45
461500 -- [-1079.228] (-1078.628) (-1079.939) (-1074.625) * (-1079.146) (-1083.783) [-1084.424] (-1077.928) -- 0:01:45
462000 -- (-1081.116) (-1076.988) (-1075.205) [-1077.248] * (-1076.956) (-1084.796) [-1080.724] (-1083.520) -- 0:01:44
462500 -- [-1075.412] (-1080.993) (-1084.967) (-1075.728) * (-1080.294) [-1079.401] (-1086.620) (-1074.695) -- 0:01:44
463000 -- (-1077.174) [-1079.391] (-1082.890) (-1075.889) * (-1082.834) (-1077.554) [-1077.088] (-1077.594) -- 0:01:44
463500 -- (-1086.555) (-1085.158) (-1084.455) [-1077.541] * (-1079.198) (-1081.333) [-1077.229] (-1082.553) -- 0:01:44
464000 -- (-1089.228) (-1080.001) (-1077.018) [-1079.973] * (-1076.501) [-1086.766] (-1077.352) (-1075.109) -- 0:01:43
464500 -- (-1078.769) [-1075.173] (-1085.087) (-1074.995) * (-1080.357) (-1077.044) (-1077.921) [-1074.608] -- 0:01:43
465000 -- (-1081.083) (-1076.999) [-1084.487] (-1079.350) * (-1080.222) (-1079.617) [-1077.291] (-1085.696) -- 0:01:43
Average standard deviation of split frequencies: 0.000405
465500 -- (-1079.662) (-1082.073) (-1078.302) [-1078.720] * (-1086.084) (-1082.337) [-1074.809] (-1076.784) -- 0:01:44
466000 -- [-1078.869] (-1081.736) (-1075.717) (-1081.614) * [-1081.023] (-1080.004) (-1082.664) (-1083.427) -- 0:01:44
466500 -- (-1082.540) (-1074.671) [-1077.396] (-1079.714) * (-1087.622) (-1085.604) [-1078.406] (-1075.483) -- 0:01:44
467000 -- [-1078.554] (-1077.838) (-1084.982) (-1075.812) * (-1080.132) (-1080.882) (-1086.381) [-1078.000] -- 0:01:43
467500 -- [-1078.116] (-1080.563) (-1080.527) (-1076.233) * (-1090.119) [-1076.407] (-1082.691) (-1079.585) -- 0:01:43
468000 -- (-1080.961) (-1082.676) (-1080.135) [-1080.582] * (-1082.771) (-1080.087) (-1081.077) [-1081.359] -- 0:01:43
468500 -- (-1080.214) (-1078.466) [-1081.801] (-1077.809) * (-1080.134) (-1078.824) [-1076.047] (-1087.510) -- 0:01:43
469000 -- (-1075.073) (-1085.093) (-1081.456) [-1080.496] * (-1083.721) [-1078.957] (-1082.708) (-1087.423) -- 0:01:43
469500 -- (-1075.476) (-1092.378) (-1074.804) [-1077.599] * (-1073.988) (-1077.852) (-1081.897) [-1074.653] -- 0:01:42
470000 -- [-1079.211] (-1087.830) (-1075.993) (-1081.990) * (-1077.344) [-1079.393] (-1088.934) (-1087.694) -- 0:01:42
Average standard deviation of split frequencies: 0.001202
470500 -- (-1076.799) (-1091.440) (-1079.561) [-1079.889] * (-1089.369) [-1079.748] (-1078.830) (-1082.647) -- 0:01:43
471000 -- (-1079.042) [-1084.833] (-1087.088) (-1076.580) * [-1081.821] (-1075.173) (-1080.070) (-1087.639) -- 0:01:43
471500 -- [-1079.575] (-1082.071) (-1080.567) (-1077.580) * (-1077.286) [-1076.440] (-1090.268) (-1083.812) -- 0:01:43
472000 -- [-1074.927] (-1076.351) (-1084.604) (-1080.080) * (-1080.723) (-1076.226) (-1087.152) [-1078.115] -- 0:01:42
472500 -- (-1080.870) (-1077.355) [-1080.104] (-1076.515) * (-1073.879) (-1082.025) (-1074.610) [-1078.660] -- 0:01:42
473000 -- [-1078.634] (-1077.942) (-1082.307) (-1085.092) * (-1078.752) [-1074.940] (-1078.609) (-1080.413) -- 0:01:42
473500 -- (-1075.802) (-1088.839) [-1088.172] (-1077.793) * (-1082.313) (-1082.196) (-1078.309) [-1074.793] -- 0:01:42
474000 -- [-1075.295] (-1078.499) (-1079.440) (-1075.720) * (-1080.611) (-1076.349) (-1077.747) [-1078.726] -- 0:01:42
474500 -- (-1081.346) [-1080.768] (-1080.459) (-1078.445) * (-1080.310) (-1076.565) [-1077.633] (-1081.422) -- 0:01:41
475000 -- (-1084.234) [-1076.187] (-1085.052) (-1078.963) * (-1077.906) [-1075.527] (-1080.382) (-1081.038) -- 0:01:41
Average standard deviation of split frequencies: 0.001981
475500 -- (-1080.216) (-1077.423) (-1079.925) [-1080.337] * [-1080.106] (-1082.253) (-1080.200) (-1078.875) -- 0:01:42
476000 -- (-1077.157) (-1080.009) (-1081.308) [-1073.564] * (-1077.423) [-1074.851] (-1074.438) (-1077.368) -- 0:01:42
476500 -- (-1081.071) [-1072.723] (-1085.946) (-1077.934) * (-1081.517) (-1082.593) [-1073.867] (-1083.669) -- 0:01:42
477000 -- [-1077.261] (-1074.898) (-1078.691) (-1085.692) * [-1080.978] (-1076.117) (-1076.532) (-1081.526) -- 0:01:41
477500 -- (-1083.510) (-1083.041) [-1079.040] (-1087.764) * (-1084.819) (-1082.456) [-1075.690] (-1081.060) -- 0:01:41
478000 -- (-1079.803) (-1076.359) (-1077.789) [-1075.744] * (-1078.251) (-1080.596) [-1078.416] (-1077.774) -- 0:01:41
478500 -- (-1085.299) (-1079.096) [-1081.241] (-1081.242) * (-1081.726) (-1084.785) (-1077.065) [-1081.282] -- 0:01:41
479000 -- (-1081.252) (-1082.321) (-1084.893) [-1083.416] * (-1083.856) (-1079.671) [-1076.076] (-1081.312) -- 0:01:41
479500 -- (-1087.852) (-1077.745) (-1076.987) [-1080.246] * [-1077.308] (-1079.758) (-1078.652) (-1082.494) -- 0:01:40
480000 -- (-1080.858) (-1082.619) (-1079.321) [-1084.060] * [-1080.662] (-1087.447) (-1081.865) (-1080.678) -- 0:01:40
Average standard deviation of split frequencies: 0.002354
480500 -- (-1083.576) (-1080.146) [-1074.902] (-1084.137) * (-1077.197) [-1077.612] (-1075.540) (-1082.109) -- 0:01:41
481000 -- (-1079.452) (-1083.633) (-1080.826) [-1078.168] * (-1081.443) (-1085.235) [-1076.846] (-1079.657) -- 0:01:41
481500 -- (-1083.276) (-1079.930) (-1086.453) [-1079.201] * (-1087.877) (-1082.729) (-1081.680) [-1077.356] -- 0:01:41
482000 -- (-1082.211) [-1077.418] (-1081.777) (-1080.060) * [-1080.226] (-1077.258) (-1072.946) (-1082.086) -- 0:01:41
482500 -- [-1075.943] (-1076.247) (-1081.458) (-1080.641) * (-1075.413) [-1078.885] (-1080.288) (-1086.425) -- 0:01:40
483000 -- [-1075.675] (-1080.379) (-1082.387) (-1083.288) * (-1074.407) (-1075.598) [-1079.331] (-1080.671) -- 0:01:40
483500 -- [-1080.447] (-1078.781) (-1078.295) (-1078.549) * [-1075.978] (-1077.148) (-1081.617) (-1084.191) -- 0:01:40
484000 -- (-1077.419) (-1079.667) [-1075.365] (-1081.475) * (-1085.095) [-1075.867] (-1083.344) (-1084.369) -- 0:01:40
484500 -- (-1079.971) (-1079.849) (-1075.750) [-1077.908] * [-1079.919] (-1077.726) (-1080.433) (-1081.840) -- 0:01:40
485000 -- [-1075.129] (-1075.653) (-1075.257) (-1073.184) * (-1075.196) (-1080.096) [-1076.743] (-1082.667) -- 0:01:39
Average standard deviation of split frequencies: 0.003492
485500 -- [-1078.874] (-1082.913) (-1081.730) (-1075.008) * (-1080.617) (-1083.463) [-1077.097] (-1083.164) -- 0:01:40
486000 -- (-1079.465) [-1086.168] (-1075.012) (-1080.454) * (-1078.686) (-1075.057) [-1081.892] (-1085.545) -- 0:01:40
486500 -- (-1081.114) [-1077.231] (-1080.012) (-1080.993) * (-1079.746) (-1082.738) [-1075.690] (-1088.768) -- 0:01:40
487000 -- (-1078.048) (-1080.274) [-1078.823] (-1079.478) * (-1078.639) (-1079.592) [-1076.127] (-1080.847) -- 0:01:40
487500 -- (-1084.073) [-1077.627] (-1083.570) (-1075.609) * (-1082.003) (-1079.336) (-1078.910) [-1085.385] -- 0:01:39
488000 -- (-1074.469) (-1079.303) (-1079.992) [-1081.337] * (-1081.514) (-1084.136) (-1076.012) [-1079.349] -- 0:01:39
488500 -- (-1073.622) (-1078.491) (-1076.237) [-1079.453] * (-1076.005) (-1082.763) (-1079.741) [-1075.977] -- 0:01:39
489000 -- (-1083.486) (-1081.395) [-1078.439] (-1079.172) * [-1077.741] (-1087.461) (-1079.622) (-1074.709) -- 0:01:39
489500 -- (-1081.441) (-1082.348) [-1080.460] (-1080.945) * (-1076.181) (-1080.470) [-1081.715] (-1088.749) -- 0:01:39
490000 -- (-1078.687) (-1077.406) [-1079.222] (-1075.561) * (-1080.064) [-1081.973] (-1081.191) (-1080.853) -- 0:01:38
Average standard deviation of split frequencies: 0.003459
490500 -- (-1078.122) (-1079.534) [-1079.190] (-1078.825) * (-1082.831) [-1076.039] (-1084.155) (-1091.520) -- 0:01:38
491000 -- (-1079.603) (-1080.054) [-1075.854] (-1080.994) * (-1073.330) [-1079.279] (-1084.081) (-1079.244) -- 0:01:39
491500 -- (-1075.884) (-1076.764) (-1079.149) [-1083.647] * (-1081.890) [-1078.072] (-1089.701) (-1079.859) -- 0:01:39
492000 -- (-1082.926) [-1073.754] (-1081.724) (-1076.591) * (-1082.305) [-1076.663] (-1077.198) (-1075.769) -- 0:01:39
492500 -- (-1080.691) (-1077.625) (-1082.373) [-1078.387] * (-1083.592) (-1079.124) [-1077.908] (-1084.088) -- 0:01:38
493000 -- (-1076.397) (-1086.056) (-1078.604) [-1082.718] * (-1082.725) (-1085.891) [-1079.136] (-1081.967) -- 0:01:38
493500 -- (-1081.775) (-1092.252) (-1081.270) [-1079.125] * (-1074.798) (-1082.888) (-1081.786) [-1088.100] -- 0:01:38
494000 -- (-1084.490) (-1094.065) [-1085.265] (-1077.684) * (-1083.180) (-1082.397) [-1077.058] (-1085.351) -- 0:01:38
494500 -- [-1081.336] (-1081.933) (-1082.181) (-1084.674) * (-1074.379) (-1081.657) [-1076.883] (-1079.300) -- 0:01:38
495000 -- [-1079.922] (-1083.221) (-1079.656) (-1073.307) * (-1075.099) [-1080.806] (-1077.689) (-1081.068) -- 0:01:37
Average standard deviation of split frequencies: 0.004182
495500 -- (-1076.424) (-1084.270) [-1074.742] (-1073.320) * (-1082.808) (-1086.714) [-1081.694] (-1090.493) -- 0:01:37
496000 -- (-1077.325) (-1078.022) (-1076.696) [-1072.789] * (-1078.679) [-1077.788] (-1083.087) (-1082.184) -- 0:01:38
496500 -- (-1082.427) (-1078.622) (-1076.074) [-1083.572] * (-1079.302) (-1077.371) (-1075.600) [-1085.263] -- 0:01:38
497000 -- (-1085.713) [-1077.044] (-1083.129) (-1076.618) * (-1074.177) [-1074.445] (-1081.235) (-1089.087) -- 0:01:38
497500 -- (-1082.884) [-1075.817] (-1085.303) (-1077.567) * [-1079.580] (-1082.370) (-1083.981) (-1082.406) -- 0:01:37
498000 -- (-1081.170) (-1077.514) (-1079.820) [-1082.721] * (-1083.154) (-1088.778) [-1080.914] (-1076.755) -- 0:01:37
498500 -- (-1088.492) [-1078.694] (-1080.806) (-1079.844) * (-1078.128) (-1081.486) (-1085.810) [-1082.118] -- 0:01:37
499000 -- (-1079.885) (-1083.699) (-1077.310) [-1078.930] * (-1084.415) [-1073.870] (-1078.807) (-1087.908) -- 0:01:37
499500 -- (-1088.277) (-1088.218) (-1077.247) [-1077.617] * (-1080.987) (-1076.698) [-1077.856] (-1081.364) -- 0:01:37
500000 -- (-1081.547) (-1079.833) [-1074.682] (-1082.303) * [-1077.356] (-1077.287) (-1076.441) (-1079.478) -- 0:01:37
Average standard deviation of split frequencies: 0.003766
500500 -- (-1086.727) [-1077.800] (-1081.110) (-1077.127) * [-1082.982] (-1076.346) (-1081.763) (-1076.171) -- 0:01:36
501000 -- [-1079.326] (-1080.469) (-1079.332) (-1079.738) * (-1080.560) (-1078.828) [-1081.001] (-1078.029) -- 0:01:37
501500 -- (-1090.165) [-1083.238] (-1077.923) (-1075.326) * (-1084.267) (-1078.172) (-1073.266) [-1075.956] -- 0:01:37
502000 -- (-1082.583) (-1082.662) [-1081.009] (-1075.962) * (-1083.093) (-1078.045) [-1077.803] (-1075.717) -- 0:01:37
502500 -- (-1073.795) (-1076.853) [-1083.430] (-1084.972) * (-1079.524) (-1075.115) (-1080.818) [-1081.804] -- 0:01:37
503000 -- [-1075.844] (-1079.753) (-1084.578) (-1084.102) * (-1077.160) (-1079.086) [-1075.969] (-1079.262) -- 0:01:36
503500 -- [-1075.224] (-1090.934) (-1081.136) (-1080.592) * [-1077.831] (-1082.023) (-1080.130) (-1080.135) -- 0:01:36
504000 -- (-1077.765) (-1089.510) (-1079.987) [-1078.547] * (-1080.877) (-1077.348) (-1076.633) [-1085.325] -- 0:01:36
504500 -- [-1080.509] (-1083.161) (-1077.102) (-1081.258) * (-1088.540) (-1082.108) (-1078.273) [-1077.308] -- 0:01:36
505000 -- (-1081.062) (-1080.338) [-1076.818] (-1076.674) * (-1083.297) (-1080.149) [-1078.860] (-1086.508) -- 0:01:36
Average standard deviation of split frequencies: 0.002609
505500 -- (-1075.872) (-1085.889) (-1084.642) [-1076.604] * (-1078.324) [-1082.120] (-1075.870) (-1078.011) -- 0:01:35
506000 -- (-1076.526) (-1083.980) [-1078.845] (-1079.221) * (-1073.768) [-1088.281] (-1074.666) (-1076.019) -- 0:01:36
506500 -- (-1075.962) [-1077.444] (-1075.762) (-1086.395) * (-1080.113) (-1081.492) (-1082.210) [-1077.171] -- 0:01:36
507000 -- [-1078.157] (-1085.376) (-1090.132) (-1081.054) * (-1077.646) (-1082.215) (-1075.182) [-1078.141] -- 0:01:36
507500 -- (-1079.427) (-1085.704) (-1077.842) [-1078.587] * (-1078.122) (-1078.343) (-1075.531) [-1081.840] -- 0:01:36
508000 -- (-1081.730) [-1078.033] (-1080.093) (-1080.573) * (-1079.679) (-1091.929) [-1085.166] (-1076.640) -- 0:01:35
508500 -- (-1083.620) (-1079.605) [-1079.371] (-1081.977) * [-1077.417] (-1083.371) (-1084.814) (-1075.819) -- 0:01:35
509000 -- (-1093.475) [-1075.482] (-1081.867) (-1079.889) * [-1080.678] (-1087.643) (-1072.932) (-1078.947) -- 0:01:35
509500 -- (-1087.623) (-1082.862) [-1082.374] (-1078.795) * (-1075.947) (-1087.523) (-1077.142) [-1079.401] -- 0:01:35
510000 -- (-1079.301) (-1080.211) [-1079.983] (-1087.941) * [-1079.819] (-1082.103) (-1079.436) (-1080.939) -- 0:01:35
Average standard deviation of split frequencies: 0.003692
510500 -- (-1085.948) (-1075.654) (-1083.273) [-1079.638] * [-1074.927] (-1078.277) (-1080.138) (-1076.407) -- 0:01:34
511000 -- (-1080.728) [-1081.338] (-1082.934) (-1083.310) * (-1081.250) [-1073.103] (-1080.483) (-1077.824) -- 0:01:35
511500 -- (-1079.386) (-1081.613) [-1085.302] (-1075.195) * (-1076.964) [-1074.814] (-1078.957) (-1077.792) -- 0:01:35
512000 -- [-1079.415] (-1079.136) (-1083.285) (-1083.922) * (-1073.842) (-1080.843) [-1082.985] (-1079.325) -- 0:01:35
512500 -- (-1082.000) (-1080.100) (-1083.181) [-1079.713] * [-1077.271] (-1075.855) (-1087.812) (-1080.964) -- 0:01:35
513000 -- (-1078.151) (-1081.216) (-1087.158) [-1080.535] * (-1076.372) (-1076.467) [-1079.534] (-1084.543) -- 0:01:34
513500 -- (-1080.770) (-1079.984) (-1079.144) [-1078.933] * (-1081.455) [-1078.064] (-1080.358) (-1087.660) -- 0:01:34
514000 -- (-1078.865) (-1080.239) (-1086.228) [-1076.786] * (-1077.207) [-1080.552] (-1081.464) (-1084.092) -- 0:01:34
514500 -- (-1078.326) [-1079.368] (-1082.527) (-1083.048) * (-1076.299) (-1082.803) [-1082.067] (-1088.392) -- 0:01:34
515000 -- (-1091.134) [-1076.670] (-1078.889) (-1080.890) * [-1078.686] (-1085.125) (-1083.331) (-1084.509) -- 0:01:34
Average standard deviation of split frequencies: 0.004385
515500 -- (-1082.384) (-1079.055) [-1075.013] (-1080.715) * [-1081.350] (-1087.089) (-1085.395) (-1084.235) -- 0:01:33
516000 -- [-1077.431] (-1078.145) (-1080.500) (-1086.527) * (-1075.923) [-1080.248] (-1084.003) (-1079.069) -- 0:01:33
516500 -- (-1079.399) (-1075.169) [-1080.061] (-1076.921) * (-1080.134) (-1081.065) (-1082.768) [-1081.933] -- 0:01:34
517000 -- (-1075.190) (-1079.381) (-1076.841) [-1078.422] * (-1080.095) (-1084.790) (-1082.355) [-1083.264] -- 0:01:34
517500 -- [-1075.544] (-1078.282) (-1079.926) (-1082.012) * (-1076.945) (-1080.551) (-1083.407) [-1074.782] -- 0:01:34
518000 -- (-1080.552) (-1082.377) (-1079.582) [-1076.281] * [-1081.496] (-1082.987) (-1078.801) (-1077.335) -- 0:01:33
518500 -- (-1082.595) (-1081.241) (-1074.632) [-1076.656] * (-1079.279) (-1080.671) (-1088.340) [-1082.676] -- 0:01:33
519000 -- [-1079.500] (-1076.803) (-1076.120) (-1080.442) * (-1077.606) (-1085.327) (-1084.157) [-1077.215] -- 0:01:33
519500 -- (-1078.256) [-1078.556] (-1077.869) (-1089.352) * (-1078.403) [-1073.881] (-1076.238) (-1077.014) -- 0:01:33
520000 -- (-1084.019) (-1077.132) (-1076.905) [-1081.753] * (-1083.583) (-1080.769) (-1076.569) [-1075.393] -- 0:01:33
Average standard deviation of split frequencies: 0.005070
520500 -- [-1075.590] (-1080.082) (-1083.400) (-1085.609) * (-1083.897) (-1087.349) (-1091.492) [-1081.921] -- 0:01:33
521000 -- (-1081.518) (-1080.660) [-1081.650] (-1087.632) * (-1080.261) (-1074.029) [-1077.047] (-1078.610) -- 0:01:32
521500 -- (-1078.802) (-1081.024) (-1076.423) [-1080.922] * (-1084.740) (-1078.680) (-1078.015) [-1074.088] -- 0:01:33
522000 -- (-1078.777) [-1077.094] (-1077.956) (-1079.871) * (-1084.624) (-1080.117) [-1081.375] (-1076.570) -- 0:01:33
522500 -- (-1080.272) (-1079.010) (-1076.810) [-1085.742] * [-1078.942] (-1081.061) (-1077.463) (-1075.636) -- 0:01:33
523000 -- (-1083.923) (-1081.579) [-1072.853] (-1087.999) * (-1081.559) [-1083.683] (-1080.132) (-1078.908) -- 0:01:33
523500 -- (-1078.164) [-1083.080] (-1074.664) (-1076.591) * (-1077.967) (-1079.926) [-1082.214] (-1076.216) -- 0:01:32
524000 -- (-1080.050) (-1081.542) (-1086.361) [-1080.474] * (-1081.785) (-1076.997) (-1072.857) [-1077.843] -- 0:01:32
524500 -- (-1085.059) (-1073.625) [-1074.924] (-1077.607) * (-1075.286) (-1083.566) (-1079.744) [-1078.806] -- 0:01:32
525000 -- (-1079.843) (-1076.016) [-1075.730] (-1076.434) * (-1077.101) (-1074.575) [-1077.675] (-1078.444) -- 0:01:32
Average standard deviation of split frequencies: 0.005377
525500 -- (-1078.182) (-1077.463) [-1076.793] (-1074.339) * (-1083.081) [-1075.572] (-1077.014) (-1084.954) -- 0:01:32
526000 -- [-1081.193] (-1082.239) (-1083.629) (-1075.174) * (-1079.646) (-1079.975) [-1077.599] (-1086.995) -- 0:01:31
526500 -- (-1079.329) (-1079.916) (-1074.598) [-1081.314] * (-1084.571) [-1076.699] (-1084.348) (-1084.163) -- 0:01:32
527000 -- (-1077.796) [-1078.251] (-1079.296) (-1081.345) * (-1075.386) [-1081.975] (-1081.354) (-1085.376) -- 0:01:32
527500 -- (-1081.711) [-1080.456] (-1080.784) (-1085.293) * [-1073.380] (-1083.535) (-1080.016) (-1079.827) -- 0:01:32
528000 -- (-1082.748) (-1083.680) [-1083.465] (-1075.572) * [-1074.319] (-1077.033) (-1080.701) (-1089.966) -- 0:01:32
528500 -- (-1084.934) [-1077.532] (-1075.511) (-1075.673) * (-1078.192) (-1082.619) (-1081.006) [-1076.547] -- 0:01:31
529000 -- (-1082.238) (-1076.564) (-1080.730) [-1080.904] * [-1078.981] (-1079.642) (-1082.431) (-1078.171) -- 0:01:31
529500 -- (-1080.283) [-1081.783] (-1078.292) (-1080.800) * [-1075.873] (-1081.767) (-1078.291) (-1081.324) -- 0:01:31
530000 -- (-1079.749) (-1078.421) [-1076.748] (-1086.159) * (-1079.070) [-1081.323] (-1075.431) (-1090.179) -- 0:01:31
Average standard deviation of split frequencies: 0.006041
530500 -- (-1086.457) [-1081.817] (-1076.578) (-1080.345) * (-1075.317) (-1078.719) (-1080.769) [-1079.449] -- 0:01:31
531000 -- (-1078.199) (-1075.047) (-1080.246) [-1077.211] * (-1078.662) [-1080.211] (-1086.594) (-1081.989) -- 0:01:30
531500 -- (-1086.801) [-1083.327] (-1075.428) (-1078.114) * (-1078.471) (-1078.441) [-1080.597] (-1085.315) -- 0:01:31
532000 -- [-1081.381] (-1077.089) (-1084.450) (-1075.319) * [-1077.883] (-1077.418) (-1084.641) (-1082.306) -- 0:01:31
532500 -- [-1079.114] (-1087.399) (-1078.784) (-1077.516) * [-1077.637] (-1079.711) (-1089.381) (-1079.698) -- 0:01:31
533000 -- (-1081.910) (-1076.840) (-1079.310) [-1085.166] * [-1079.163] (-1082.780) (-1081.459) (-1082.400) -- 0:01:31
533500 -- [-1080.435] (-1084.131) (-1077.071) (-1081.996) * (-1078.868) (-1089.137) [-1081.027] (-1084.175) -- 0:01:30
534000 -- (-1082.150) [-1075.583] (-1079.929) (-1079.905) * (-1082.387) (-1079.624) [-1078.195] (-1078.082) -- 0:01:30
534500 -- (-1082.831) [-1083.105] (-1078.632) (-1082.251) * (-1078.553) (-1082.659) [-1082.037] (-1081.904) -- 0:01:30
535000 -- [-1082.579] (-1080.981) (-1088.219) (-1078.531) * (-1079.941) [-1088.479] (-1079.777) (-1079.888) -- 0:01:30
Average standard deviation of split frequencies: 0.005629
535500 -- (-1072.277) (-1079.406) [-1079.884] (-1081.311) * (-1079.600) (-1089.662) (-1078.013) [-1074.201] -- 0:01:30
536000 -- (-1076.670) (-1080.863) [-1080.372] (-1076.039) * [-1082.447] (-1084.077) (-1074.360) (-1077.074) -- 0:01:30
536500 -- (-1076.744) (-1078.104) [-1078.991] (-1080.179) * (-1079.535) [-1079.517] (-1080.608) (-1086.463) -- 0:01:30
537000 -- (-1080.532) (-1075.198) [-1076.660] (-1083.407) * (-1081.746) (-1079.022) (-1075.891) [-1080.828] -- 0:01:30
537500 -- (-1078.154) (-1078.960) (-1079.372) [-1085.452] * [-1084.658] (-1085.621) (-1077.414) (-1078.667) -- 0:01:30
538000 -- (-1088.684) (-1078.340) [-1077.436] (-1078.793) * (-1079.511) [-1079.430] (-1077.316) (-1079.635) -- 0:01:30
538500 -- (-1086.178) (-1079.309) (-1086.605) [-1074.046] * (-1080.370) [-1078.206] (-1081.444) (-1075.439) -- 0:01:29
539000 -- (-1081.458) [-1080.542] (-1077.946) (-1079.806) * (-1086.600) (-1075.887) (-1077.439) [-1077.709] -- 0:01:29
539500 -- (-1084.595) (-1076.794) [-1078.454] (-1078.285) * (-1076.168) [-1077.360] (-1082.255) (-1085.344) -- 0:01:29
540000 -- [-1085.968] (-1083.429) (-1084.952) (-1083.988) * [-1075.877] (-1077.502) (-1084.392) (-1093.888) -- 0:01:29
Average standard deviation of split frequencies: 0.005929
540500 -- (-1074.369) [-1072.749] (-1081.411) (-1072.800) * (-1074.381) (-1078.443) (-1086.051) [-1080.596] -- 0:01:29
541000 -- [-1081.983] (-1078.360) (-1084.789) (-1081.156) * [-1082.088] (-1075.520) (-1079.724) (-1078.266) -- 0:01:29
541500 -- (-1082.468) (-1076.670) (-1082.880) [-1078.515] * (-1081.544) (-1073.566) (-1087.777) [-1087.936] -- 0:01:28
542000 -- (-1079.727) (-1079.072) (-1076.852) [-1079.576] * (-1077.331) [-1077.052] (-1083.083) (-1079.320) -- 0:01:29
542500 -- (-1081.174) [-1077.578] (-1075.116) (-1078.809) * (-1075.491) (-1076.826) (-1081.789) [-1086.483] -- 0:01:29
543000 -- (-1076.319) [-1081.399] (-1082.683) (-1078.544) * (-1079.186) [-1078.438] (-1079.033) (-1079.383) -- 0:01:29
543500 -- [-1081.506] (-1081.258) (-1079.716) (-1087.705) * (-1092.315) (-1087.790) [-1081.747] (-1081.655) -- 0:01:29
544000 -- (-1077.198) [-1079.899] (-1080.343) (-1079.315) * (-1080.221) (-1082.021) [-1081.831] (-1083.652) -- 0:01:28
544500 -- [-1077.976] (-1080.510) (-1078.007) (-1077.945) * (-1082.958) (-1081.878) (-1081.755) [-1082.196] -- 0:01:28
545000 -- [-1079.413] (-1079.502) (-1077.164) (-1076.196) * (-1085.190) (-1076.376) (-1081.719) [-1078.207] -- 0:01:28
Average standard deviation of split frequencies: 0.006907
545500 -- [-1077.691] (-1084.090) (-1079.600) (-1080.522) * (-1085.778) (-1077.212) [-1075.914] (-1079.005) -- 0:01:28
546000 -- (-1074.153) (-1086.781) [-1076.497] (-1081.125) * (-1082.029) [-1076.819] (-1084.319) (-1082.585) -- 0:01:28
546500 -- (-1084.537) (-1077.500) [-1074.254] (-1077.960) * (-1074.942) (-1076.620) [-1077.500] (-1082.008) -- 0:01:27
547000 -- [-1081.069] (-1078.627) (-1075.253) (-1076.251) * (-1083.122) (-1077.712) [-1075.528] (-1076.068) -- 0:01:28
547500 -- (-1078.917) (-1080.018) (-1078.502) [-1074.560] * (-1078.641) (-1080.976) (-1079.470) [-1078.391] -- 0:01:28
548000 -- (-1080.647) (-1080.850) (-1076.745) [-1078.533] * (-1083.410) (-1090.444) [-1077.781] (-1083.992) -- 0:01:28
548500 -- [-1078.803] (-1076.221) (-1076.718) (-1077.119) * (-1082.071) [-1077.217] (-1079.890) (-1087.858) -- 0:01:28
549000 -- (-1081.291) (-1078.363) [-1081.322] (-1079.600) * (-1088.191) (-1076.803) [-1081.282] (-1080.026) -- 0:01:27
549500 -- [-1078.301] (-1082.437) (-1078.652) (-1079.125) * (-1076.444) [-1075.324] (-1074.491) (-1078.013) -- 0:01:27
550000 -- (-1078.651) (-1072.685) (-1077.294) [-1080.277] * (-1077.146) (-1079.715) (-1082.806) [-1079.322] -- 0:01:27
Average standard deviation of split frequencies: 0.006164
550500 -- (-1080.340) (-1082.204) [-1077.055] (-1078.962) * (-1082.051) (-1087.495) [-1077.322] (-1080.531) -- 0:01:27
551000 -- (-1073.766) (-1077.303) [-1083.053] (-1084.038) * (-1076.187) (-1082.027) [-1079.459] (-1084.672) -- 0:01:27
551500 -- (-1074.921) (-1088.556) [-1075.603] (-1071.959) * (-1081.630) (-1084.362) (-1078.103) [-1082.342] -- 0:01:27
552000 -- (-1080.895) (-1081.203) [-1086.185] (-1075.687) * (-1079.153) (-1080.658) [-1077.383] (-1082.984) -- 0:01:27
552500 -- (-1081.151) [-1078.550] (-1086.596) (-1076.236) * (-1076.079) [-1076.162] (-1075.892) (-1078.761) -- 0:01:27
553000 -- (-1076.458) [-1077.774] (-1084.049) (-1080.559) * [-1079.495] (-1083.309) (-1087.710) (-1074.791) -- 0:01:27
553500 -- (-1075.845) (-1081.337) (-1083.089) [-1078.554] * [-1076.601] (-1079.174) (-1079.211) (-1078.098) -- 0:01:27
554000 -- (-1089.456) (-1079.142) [-1082.002] (-1078.037) * (-1079.735) (-1085.924) [-1076.534] (-1078.345) -- 0:01:26
554500 -- (-1085.091) [-1086.952] (-1080.035) (-1076.708) * (-1081.381) (-1081.486) (-1082.322) [-1075.237] -- 0:01:26
555000 -- (-1083.394) [-1080.279] (-1077.722) (-1085.371) * (-1087.706) (-1081.965) [-1079.361] (-1076.111) -- 0:01:26
Average standard deviation of split frequencies: 0.006444
555500 -- [-1078.882] (-1081.234) (-1077.215) (-1084.433) * (-1086.990) (-1083.926) (-1080.618) [-1078.465] -- 0:01:26
556000 -- (-1072.904) (-1082.672) [-1077.996] (-1092.119) * (-1080.763) (-1076.722) (-1077.297) [-1078.292] -- 0:01:26
556500 -- (-1074.394) [-1077.405] (-1083.176) (-1080.487) * (-1081.031) [-1077.571] (-1077.819) (-1082.968) -- 0:01:26
557000 -- [-1077.215] (-1073.767) (-1078.381) (-1081.854) * [-1085.289] (-1086.416) (-1076.779) (-1087.215) -- 0:01:26
557500 -- (-1082.753) (-1075.279) [-1083.957] (-1082.536) * (-1080.592) (-1079.486) (-1076.405) [-1080.015] -- 0:01:26
558000 -- (-1085.364) (-1084.757) (-1084.237) [-1080.423] * (-1084.071) [-1077.009] (-1082.305) (-1081.123) -- 0:01:26
558500 -- (-1078.283) (-1079.294) (-1079.998) [-1079.257] * (-1084.350) [-1075.755] (-1072.860) (-1084.175) -- 0:01:26
559000 -- (-1081.716) [-1084.049] (-1085.366) (-1079.693) * [-1083.434] (-1075.209) (-1073.961) (-1083.570) -- 0:01:25
559500 -- [-1081.986] (-1079.636) (-1075.139) (-1085.942) * (-1084.449) (-1077.643) (-1077.870) [-1079.747] -- 0:01:25
560000 -- (-1082.458) (-1077.512) (-1076.838) [-1081.679] * [-1083.314] (-1079.439) (-1078.634) (-1076.979) -- 0:01:25
Average standard deviation of split frequencies: 0.006054
560500 -- (-1083.542) [-1077.732] (-1078.564) (-1089.175) * (-1081.285) [-1079.141] (-1084.677) (-1078.405) -- 0:01:25
561000 -- [-1077.829] (-1084.394) (-1075.624) (-1091.706) * (-1078.615) [-1076.487] (-1089.144) (-1079.082) -- 0:01:25
561500 -- (-1089.906) (-1084.173) (-1080.850) [-1081.540] * (-1080.621) (-1081.037) [-1080.802] (-1079.056) -- 0:01:25
562000 -- [-1077.713] (-1082.215) (-1079.814) (-1077.756) * [-1078.783] (-1085.539) (-1080.711) (-1084.552) -- 0:01:25
562500 -- [-1079.842] (-1087.108) (-1082.547) (-1086.479) * (-1079.728) (-1082.102) (-1080.109) [-1078.708] -- 0:01:25
563000 -- [-1083.188] (-1078.082) (-1084.022) (-1081.815) * (-1082.485) (-1087.760) (-1078.082) [-1078.241] -- 0:01:25
563500 -- (-1087.455) (-1072.620) (-1078.606) [-1077.851] * [-1076.162] (-1077.496) (-1082.334) (-1090.351) -- 0:01:25
564000 -- [-1078.512] (-1079.237) (-1087.705) (-1076.325) * (-1074.573) (-1082.207) (-1082.002) [-1074.663] -- 0:01:25
564500 -- [-1080.053] (-1085.118) (-1090.055) (-1081.727) * [-1077.061] (-1081.155) (-1079.936) (-1082.742) -- 0:01:24
565000 -- [-1077.145] (-1078.861) (-1086.333) (-1088.944) * (-1079.023) [-1075.242] (-1084.595) (-1075.783) -- 0:01:24
Average standard deviation of split frequencies: 0.006663
565500 -- (-1080.702) (-1080.759) [-1081.438] (-1085.623) * (-1075.464) [-1079.649] (-1078.851) (-1078.719) -- 0:01:24
566000 -- (-1083.439) (-1084.919) [-1074.396] (-1078.768) * (-1077.815) [-1086.827] (-1082.375) (-1078.873) -- 0:01:24
566500 -- (-1079.116) [-1083.387] (-1074.175) (-1082.105) * (-1074.656) (-1079.211) [-1077.054] (-1078.863) -- 0:01:24
567000 -- (-1081.018) (-1084.877) (-1082.189) [-1083.498] * (-1080.962) (-1086.583) [-1074.785] (-1087.760) -- 0:01:24
567500 -- [-1076.063] (-1087.413) (-1076.525) (-1079.770) * (-1078.747) (-1081.355) [-1078.637] (-1082.963) -- 0:01:24
568000 -- (-1081.781) (-1078.206) [-1079.231] (-1076.038) * (-1078.183) (-1079.576) (-1077.300) [-1078.960] -- 0:01:24
568500 -- (-1075.865) (-1081.307) [-1077.308] (-1078.122) * (-1079.011) (-1088.192) [-1079.611] (-1081.646) -- 0:01:24
569000 -- (-1078.533) (-1079.791) (-1076.339) [-1076.822] * [-1074.916] (-1085.618) (-1084.354) (-1077.388) -- 0:01:24
569500 -- (-1075.073) [-1076.473] (-1075.351) (-1078.018) * [-1074.911] (-1082.271) (-1078.235) (-1077.378) -- 0:01:23
570000 -- (-1079.705) (-1082.343) [-1082.434] (-1080.010) * [-1083.806] (-1090.746) (-1079.690) (-1083.323) -- 0:01:23
Average standard deviation of split frequencies: 0.005948
570500 -- [-1073.890] (-1084.750) (-1086.656) (-1079.129) * [-1077.694] (-1076.785) (-1091.733) (-1080.669) -- 0:01:23
571000 -- (-1084.402) (-1080.632) (-1086.028) [-1080.434] * [-1082.715] (-1083.395) (-1080.137) (-1080.652) -- 0:01:23
571500 -- [-1079.721] (-1085.442) (-1077.944) (-1073.861) * (-1086.261) (-1082.685) [-1081.594] (-1082.343) -- 0:01:23
572000 -- (-1083.481) (-1081.899) [-1078.761] (-1078.250) * [-1083.534] (-1077.335) (-1085.592) (-1077.418) -- 0:01:23
572500 -- (-1082.615) [-1079.699] (-1080.013) (-1079.888) * [-1082.431] (-1079.754) (-1077.659) (-1082.047) -- 0:01:23
573000 -- [-1077.355] (-1079.135) (-1077.707) (-1077.857) * (-1081.316) (-1088.027) (-1081.906) [-1082.730] -- 0:01:23
573500 -- (-1083.700) (-1079.147) [-1079.045] (-1079.892) * [-1079.180] (-1081.767) (-1078.308) (-1072.418) -- 0:01:23
574000 -- (-1084.414) [-1079.338] (-1075.459) (-1083.272) * (-1076.260) (-1073.501) (-1080.857) [-1075.527] -- 0:01:23
574500 -- [-1077.583] (-1086.601) (-1074.703) (-1080.973) * (-1078.400) [-1076.707] (-1085.835) (-1077.341) -- 0:01:22
575000 -- (-1077.994) (-1085.326) (-1079.562) [-1081.157] * (-1080.987) (-1078.247) (-1077.693) [-1086.160] -- 0:01:22
Average standard deviation of split frequencies: 0.005565
575500 -- [-1074.552] (-1079.639) (-1082.911) (-1083.813) * (-1079.161) (-1081.169) [-1078.965] (-1081.144) -- 0:01:22
576000 -- (-1075.223) (-1077.479) (-1079.080) [-1079.216] * [-1082.500] (-1083.553) (-1078.731) (-1081.016) -- 0:01:22
576500 -- (-1079.268) (-1080.575) [-1078.039] (-1075.512) * (-1076.155) [-1081.806] (-1083.357) (-1081.749) -- 0:01:22
577000 -- (-1080.792) (-1080.962) [-1075.217] (-1086.834) * (-1075.009) [-1078.108] (-1075.016) (-1081.130) -- 0:01:22
577500 -- [-1079.859] (-1084.375) (-1083.993) (-1082.910) * (-1079.943) [-1077.853] (-1076.924) (-1079.949) -- 0:01:22
578000 -- (-1083.003) (-1076.427) (-1077.996) [-1083.234] * (-1080.451) (-1078.048) (-1082.508) [-1076.779] -- 0:01:22
578500 -- (-1081.684) (-1081.645) [-1077.955] (-1084.454) * (-1083.071) [-1080.435] (-1077.766) (-1083.233) -- 0:01:22
579000 -- (-1076.921) (-1077.434) [-1078.892] (-1085.926) * [-1077.804] (-1073.075) (-1079.668) (-1084.573) -- 0:01:22
579500 -- [-1078.904] (-1076.473) (-1081.393) (-1085.443) * (-1088.331) [-1079.833] (-1077.978) (-1080.842) -- 0:01:21
580000 -- [-1078.680] (-1082.948) (-1082.426) (-1085.909) * [-1076.485] (-1080.769) (-1082.746) (-1076.873) -- 0:01:21
Average standard deviation of split frequencies: 0.004222
580500 -- (-1083.951) [-1076.973] (-1080.205) (-1085.626) * (-1078.441) [-1083.550] (-1084.637) (-1077.963) -- 0:01:21
581000 -- (-1078.073) (-1079.061) [-1086.608] (-1077.031) * (-1086.222) (-1083.995) [-1075.993] (-1078.275) -- 0:01:21
581500 -- (-1083.415) (-1080.293) (-1076.739) [-1079.683] * (-1079.283) (-1086.640) (-1079.299) [-1072.875] -- 0:01:21
582000 -- (-1083.893) (-1083.370) [-1076.088] (-1079.699) * (-1083.664) (-1077.789) (-1078.291) [-1083.379] -- 0:01:21
582500 -- [-1081.837] (-1082.988) (-1075.325) (-1080.670) * (-1078.653) [-1084.131] (-1080.076) (-1078.436) -- 0:01:21
583000 -- (-1075.510) [-1082.110] (-1085.956) (-1080.017) * (-1081.560) (-1085.810) [-1079.972] (-1081.021) -- 0:01:21
583500 -- (-1078.548) [-1075.381] (-1086.986) (-1079.790) * (-1082.471) (-1080.269) [-1074.387] (-1083.991) -- 0:01:21
584000 -- [-1075.424] (-1077.304) (-1088.418) (-1080.916) * [-1074.552] (-1078.247) (-1078.755) (-1083.467) -- 0:01:21
584500 -- (-1077.068) [-1080.360] (-1075.939) (-1090.833) * (-1077.688) [-1080.517] (-1079.211) (-1077.721) -- 0:01:21
585000 -- (-1079.630) [-1078.004] (-1080.879) (-1080.511) * [-1077.940] (-1077.525) (-1081.133) (-1085.793) -- 0:01:20
Average standard deviation of split frequencies: 0.004505
585500 -- (-1086.558) [-1077.793] (-1085.002) (-1082.795) * [-1073.159] (-1074.436) (-1090.649) (-1082.582) -- 0:01:20
586000 -- (-1093.589) (-1079.466) (-1082.513) [-1072.298] * (-1073.225) [-1077.430] (-1077.461) (-1087.690) -- 0:01:20
586500 -- [-1080.168] (-1078.659) (-1084.195) (-1075.817) * (-1080.699) (-1076.922) (-1084.641) [-1078.780] -- 0:01:20
587000 -- (-1074.446) (-1079.375) (-1085.255) [-1082.532] * (-1074.980) [-1081.019] (-1077.130) (-1083.706) -- 0:01:20
587500 -- (-1076.496) (-1082.300) (-1079.688) [-1075.756] * [-1077.407] (-1077.436) (-1084.572) (-1084.372) -- 0:01:20
588000 -- (-1079.602) (-1083.401) [-1074.280] (-1077.277) * [-1079.701] (-1084.124) (-1075.751) (-1082.807) -- 0:01:20
588500 -- (-1077.308) (-1077.532) (-1088.974) [-1075.722] * [-1075.893] (-1084.692) (-1075.899) (-1079.251) -- 0:01:20
589000 -- [-1085.067] (-1080.732) (-1083.422) (-1082.776) * (-1077.491) (-1084.142) (-1086.790) [-1078.041] -- 0:01:20
589500 -- (-1084.486) (-1084.257) [-1076.977] (-1079.443) * (-1078.512) (-1077.608) [-1082.246] (-1078.305) -- 0:01:20
590000 -- (-1085.950) (-1081.283) (-1083.812) [-1083.501] * [-1079.643] (-1085.499) (-1076.916) (-1078.524) -- 0:01:19
Average standard deviation of split frequencies: 0.005108
590500 -- (-1083.962) (-1081.356) (-1089.577) [-1082.146] * [-1076.272] (-1080.185) (-1078.773) (-1079.096) -- 0:01:19
591000 -- (-1088.717) (-1078.993) [-1083.581] (-1089.253) * (-1085.578) (-1078.602) (-1077.416) [-1075.695] -- 0:01:19
591500 -- (-1079.806) [-1076.919] (-1087.855) (-1084.624) * (-1077.502) (-1084.311) (-1078.522) [-1074.050] -- 0:01:19
592000 -- (-1078.405) (-1075.287) [-1079.155] (-1091.069) * (-1080.420) [-1075.414] (-1076.321) (-1075.842) -- 0:01:19
592500 -- (-1078.506) [-1076.623] (-1077.194) (-1086.743) * (-1087.861) [-1079.038] (-1081.141) (-1084.059) -- 0:01:19
593000 -- (-1079.810) [-1079.394] (-1077.946) (-1083.113) * (-1081.570) [-1074.606] (-1083.836) (-1078.520) -- 0:01:19
593500 -- [-1077.810] (-1083.883) (-1084.099) (-1079.179) * [-1078.037] (-1078.182) (-1082.745) (-1074.695) -- 0:01:19
594000 -- (-1075.985) (-1082.833) (-1077.354) [-1076.595] * (-1083.400) [-1081.848] (-1079.721) (-1079.839) -- 0:01:19
594500 -- (-1085.209) (-1078.665) (-1077.912) [-1080.256] * [-1075.239] (-1081.566) (-1082.055) (-1088.539) -- 0:01:19
595000 -- (-1078.999) (-1081.863) (-1081.210) [-1077.339] * [-1075.775] (-1080.201) (-1079.066) (-1085.791) -- 0:01:18
Average standard deviation of split frequencies: 0.004429
595500 -- (-1080.737) (-1077.525) [-1080.306] (-1081.441) * (-1078.072) (-1078.720) [-1087.118] (-1077.489) -- 0:01:18
596000 -- [-1075.588] (-1078.329) (-1080.227) (-1078.292) * (-1082.802) (-1091.418) (-1081.852) [-1083.157] -- 0:01:18
596500 -- [-1077.601] (-1083.092) (-1072.743) (-1081.349) * (-1075.643) [-1074.072] (-1082.597) (-1074.596) -- 0:01:18
597000 -- (-1082.893) (-1086.463) (-1074.615) [-1075.341] * (-1084.490) (-1084.330) (-1075.637) [-1076.684] -- 0:01:18
597500 -- (-1077.773) (-1084.306) [-1077.212] (-1077.377) * [-1078.391] (-1086.545) (-1076.875) (-1077.127) -- 0:01:18
598000 -- (-1079.393) [-1079.083] (-1080.219) (-1078.732) * (-1077.481) (-1077.533) (-1076.771) [-1074.065] -- 0:01:18
598500 -- (-1078.186) (-1087.163) (-1072.066) [-1075.837] * (-1078.466) (-1079.712) (-1088.328) [-1077.212] -- 0:01:18
599000 -- [-1075.071] (-1089.695) (-1078.161) (-1075.958) * (-1073.413) [-1085.118] (-1083.528) (-1076.181) -- 0:01:18
599500 -- (-1076.342) [-1084.157] (-1081.778) (-1083.018) * [-1074.396] (-1085.604) (-1080.224) (-1083.394) -- 0:01:18
600000 -- (-1086.065) (-1082.431) (-1079.912) [-1075.507] * (-1089.570) (-1082.332) [-1076.639] (-1083.357) -- 0:01:18
Average standard deviation of split frequencies: 0.004709
600500 -- (-1079.723) [-1083.726] (-1078.696) (-1078.834) * (-1081.419) (-1084.266) [-1080.834] (-1076.795) -- 0:01:17
601000 -- (-1079.593) [-1077.019] (-1076.874) (-1075.822) * (-1085.508) [-1077.305] (-1083.053) (-1078.603) -- 0:01:17
601500 -- (-1080.564) (-1077.081) [-1081.059] (-1077.881) * (-1081.292) [-1079.439] (-1080.195) (-1075.865) -- 0:01:17
602000 -- (-1079.507) [-1076.210] (-1079.449) (-1078.071) * (-1077.076) [-1084.136] (-1078.022) (-1079.075) -- 0:01:17
602500 -- [-1077.758] (-1078.758) (-1078.178) (-1083.709) * (-1073.603) (-1077.774) [-1075.987] (-1078.502) -- 0:01:17
603000 -- (-1079.391) (-1078.773) (-1082.859) [-1077.491] * (-1077.198) (-1080.861) (-1078.477) [-1078.670] -- 0:01:17
603500 -- (-1081.177) (-1076.540) [-1079.631] (-1081.670) * (-1076.422) (-1081.596) (-1078.943) [-1077.555] -- 0:01:17
604000 -- (-1078.612) (-1085.468) (-1082.646) [-1080.610] * (-1076.510) (-1083.199) [-1076.148] (-1081.612) -- 0:01:17
604500 -- (-1080.010) (-1081.871) (-1086.350) [-1084.677] * [-1078.506] (-1076.486) (-1076.468) (-1080.215) -- 0:01:17
605000 -- (-1074.798) (-1082.069) [-1080.704] (-1080.422) * (-1080.957) [-1076.793] (-1087.462) (-1078.531) -- 0:01:17
Average standard deviation of split frequencies: 0.004979
605500 -- (-1084.670) (-1091.593) (-1084.471) [-1081.120] * [-1075.688] (-1078.986) (-1081.921) (-1077.121) -- 0:01:16
606000 -- [-1076.227] (-1090.939) (-1083.011) (-1080.448) * (-1080.077) (-1086.576) (-1090.197) [-1076.476] -- 0:01:16
606500 -- (-1079.774) (-1085.376) (-1080.215) [-1082.969] * (-1075.998) (-1084.112) [-1077.524] (-1075.269) -- 0:01:16
607000 -- (-1085.547) (-1084.459) (-1077.720) [-1080.068] * (-1082.329) [-1080.496] (-1080.237) (-1074.326) -- 0:01:16
607500 -- (-1080.982) (-1077.112) (-1082.561) [-1078.978] * (-1079.388) (-1085.050) (-1073.971) [-1076.564] -- 0:01:16
608000 -- (-1077.573) (-1089.387) (-1080.603) [-1073.677] * (-1072.972) (-1081.869) (-1087.291) [-1081.523] -- 0:01:16
608500 -- (-1087.673) (-1080.318) [-1075.791] (-1077.412) * (-1077.862) (-1076.424) [-1074.576] (-1087.793) -- 0:01:16
609000 -- (-1074.153) (-1083.544) [-1079.484] (-1081.122) * (-1077.315) (-1076.027) [-1075.315] (-1091.047) -- 0:01:16
609500 -- (-1079.376) (-1080.796) (-1081.677) [-1077.338] * [-1081.480] (-1073.985) (-1080.868) (-1088.803) -- 0:01:16
610000 -- (-1081.748) (-1078.355) (-1083.840) [-1078.292] * [-1073.989] (-1077.633) (-1090.560) (-1078.411) -- 0:01:16
Average standard deviation of split frequencies: 0.004940
610500 -- (-1080.670) (-1082.214) (-1083.357) [-1075.169] * (-1087.359) [-1079.749] (-1092.996) (-1081.544) -- 0:01:15
611000 -- (-1083.459) (-1077.548) [-1077.443] (-1077.765) * (-1084.282) (-1075.259) [-1080.104] (-1082.719) -- 0:01:15
611500 -- [-1080.269] (-1077.958) (-1077.494) (-1076.722) * (-1080.419) [-1084.679] (-1073.664) (-1083.532) -- 0:01:15
612000 -- (-1080.455) (-1079.449) (-1090.533) [-1078.888] * (-1079.356) (-1086.918) [-1078.318] (-1072.817) -- 0:01:15
612500 -- (-1079.239) (-1076.445) (-1085.906) [-1082.268] * [-1077.254] (-1078.329) (-1078.119) (-1080.148) -- 0:01:15
613000 -- (-1085.887) (-1090.137) (-1078.869) [-1074.025] * [-1076.830] (-1076.375) (-1081.762) (-1085.849) -- 0:01:15
613500 -- (-1079.887) (-1080.995) (-1086.019) [-1076.469] * (-1082.641) (-1077.532) [-1085.739] (-1085.099) -- 0:01:15
614000 -- (-1082.458) (-1081.089) [-1076.953] (-1078.920) * [-1076.646] (-1075.009) (-1083.139) (-1074.677) -- 0:01:15
614500 -- (-1086.089) (-1079.750) (-1077.381) [-1077.560] * [-1075.737] (-1091.429) (-1081.667) (-1083.180) -- 0:01:15
615000 -- [-1083.326] (-1079.316) (-1073.999) (-1083.032) * (-1075.625) (-1081.191) [-1081.106] (-1089.240) -- 0:01:15
Average standard deviation of split frequencies: 0.005204
615500 -- (-1077.699) (-1076.862) (-1072.551) [-1083.461] * [-1079.597] (-1080.053) (-1084.377) (-1082.240) -- 0:01:14
616000 -- [-1075.404] (-1073.375) (-1075.538) (-1080.253) * (-1081.745) [-1075.115] (-1080.865) (-1078.955) -- 0:01:14
616500 -- (-1083.991) (-1079.392) [-1079.715] (-1073.187) * (-1083.806) [-1074.670] (-1083.635) (-1079.363) -- 0:01:14
617000 -- (-1080.359) (-1081.642) (-1088.204) [-1079.130] * [-1074.505] (-1079.507) (-1078.403) (-1089.067) -- 0:01:14
617500 -- [-1080.673] (-1079.771) (-1078.170) (-1079.333) * (-1076.877) [-1082.937] (-1086.282) (-1082.224) -- 0:01:14
618000 -- [-1077.182] (-1078.606) (-1079.144) (-1073.957) * (-1080.534) (-1078.553) (-1084.541) [-1078.148] -- 0:01:14
618500 -- [-1076.600] (-1080.633) (-1090.560) (-1076.729) * [-1074.626] (-1088.835) (-1083.141) (-1081.766) -- 0:01:14
619000 -- [-1080.647] (-1082.940) (-1079.285) (-1075.498) * (-1082.230) (-1087.308) [-1079.377] (-1077.072) -- 0:01:14
619500 -- (-1078.419) (-1086.230) (-1084.055) [-1076.624] * [-1075.359] (-1082.431) (-1077.029) (-1076.978) -- 0:01:14
620000 -- (-1085.361) [-1084.282] (-1084.166) (-1083.575) * (-1074.774) (-1075.640) [-1074.996] (-1075.556) -- 0:01:14
Average standard deviation of split frequencies: 0.004557
620500 -- (-1083.412) [-1079.322] (-1083.241) (-1083.129) * (-1087.655) (-1081.885) [-1082.431] (-1080.353) -- 0:01:14
621000 -- [-1078.051] (-1085.180) (-1081.685) (-1080.495) * (-1092.437) (-1079.590) (-1076.976) [-1078.250] -- 0:01:13
621500 -- [-1082.476] (-1083.283) (-1079.626) (-1077.732) * (-1076.404) (-1082.030) (-1076.286) [-1076.939] -- 0:01:13
622000 -- (-1075.930) [-1078.859] (-1085.772) (-1079.462) * (-1086.129) (-1078.494) [-1077.819] (-1080.003) -- 0:01:13
622500 -- (-1075.198) (-1077.258) [-1082.102] (-1076.676) * [-1075.828] (-1079.362) (-1081.052) (-1085.279) -- 0:01:13
623000 -- (-1083.203) (-1079.381) [-1078.993] (-1075.565) * (-1078.811) (-1072.797) [-1083.096] (-1085.721) -- 0:01:13
623500 -- (-1080.557) (-1076.481) [-1075.361] (-1074.178) * (-1084.567) (-1079.626) (-1078.361) [-1078.453] -- 0:01:13
624000 -- (-1081.310) (-1086.772) (-1081.300) [-1079.878] * [-1074.209] (-1081.822) (-1081.563) (-1075.285) -- 0:01:13
624500 -- (-1081.820) [-1076.790] (-1089.175) (-1076.605) * [-1083.737] (-1079.746) (-1080.678) (-1084.618) -- 0:01:13
625000 -- (-1076.367) [-1082.617] (-1077.833) (-1080.790) * [-1085.397] (-1077.727) (-1078.290) (-1086.354) -- 0:01:13
Average standard deviation of split frequencies: 0.004819
625500 -- [-1079.205] (-1086.449) (-1076.538) (-1075.569) * (-1083.742) (-1076.837) (-1085.188) [-1086.118] -- 0:01:13
626000 -- (-1081.642) (-1079.374) [-1081.779] (-1078.897) * [-1080.757] (-1083.819) (-1082.015) (-1085.557) -- 0:01:12
626500 -- (-1084.979) (-1087.885) [-1077.965] (-1077.719) * (-1088.252) (-1091.838) [-1080.539] (-1081.946) -- 0:01:12
627000 -- (-1083.524) (-1083.519) (-1086.314) [-1087.327] * (-1079.996) (-1082.547) [-1076.336] (-1084.489) -- 0:01:12
627500 -- (-1085.466) (-1085.159) (-1082.817) [-1082.725] * (-1078.964) (-1093.982) (-1081.131) [-1081.061] -- 0:01:12
628000 -- (-1082.601) [-1080.603] (-1079.673) (-1080.622) * [-1077.897] (-1086.414) (-1081.406) (-1076.925) -- 0:01:12
628500 -- (-1086.254) (-1080.149) (-1076.992) [-1077.025] * (-1078.259) [-1079.850] (-1083.051) (-1082.541) -- 0:01:12
629000 -- (-1077.051) [-1076.727] (-1078.899) (-1080.759) * [-1076.854] (-1083.492) (-1079.386) (-1078.482) -- 0:01:12
629500 -- (-1074.508) [-1075.693] (-1083.491) (-1080.635) * [-1075.613] (-1080.564) (-1077.971) (-1078.825) -- 0:01:12
630000 -- [-1079.609] (-1078.475) (-1085.772) (-1077.604) * (-1076.402) (-1076.595) [-1078.075] (-1078.413) -- 0:01:12
Average standard deviation of split frequencies: 0.005980
630500 -- [-1077.227] (-1089.705) (-1077.540) (-1085.280) * (-1075.642) [-1082.781] (-1082.696) (-1072.574) -- 0:01:12
631000 -- (-1081.240) (-1081.746) [-1076.424] (-1082.893) * (-1078.093) (-1080.523) (-1083.075) [-1078.426] -- 0:01:11
631500 -- (-1080.980) [-1079.545] (-1076.930) (-1084.470) * (-1079.434) [-1078.325] (-1087.351) (-1076.447) -- 0:01:11
632000 -- [-1078.037] (-1073.672) (-1079.180) (-1084.226) * [-1082.042] (-1078.768) (-1086.411) (-1075.327) -- 0:01:11
632500 -- (-1081.692) [-1076.703] (-1075.111) (-1080.652) * [-1084.051] (-1082.544) (-1085.754) (-1078.337) -- 0:01:11
633000 -- (-1081.419) (-1079.480) [-1073.078] (-1080.462) * (-1075.406) (-1081.878) (-1077.990) [-1078.760] -- 0:01:11
633500 -- (-1079.016) (-1084.205) (-1074.866) [-1078.735] * (-1077.865) (-1077.556) [-1085.060] (-1077.031) -- 0:01:11
634000 -- [-1080.504] (-1082.066) (-1078.201) (-1079.750) * (-1079.033) (-1083.361) [-1079.944] (-1078.102) -- 0:01:11
634500 -- (-1084.142) (-1076.694) [-1076.189] (-1080.142) * [-1079.854] (-1078.632) (-1087.246) (-1084.605) -- 0:01:11
635000 -- (-1082.929) (-1077.143) [-1079.922] (-1082.261) * (-1082.323) (-1076.161) [-1076.965] (-1080.385) -- 0:01:11
Average standard deviation of split frequencies: 0.004744
635500 -- [-1080.927] (-1075.607) (-1076.744) (-1085.692) * (-1084.434) [-1078.033] (-1082.774) (-1074.997) -- 0:01:11
636000 -- (-1085.595) [-1075.425] (-1075.997) (-1083.210) * [-1077.076] (-1077.434) (-1078.419) (-1076.175) -- 0:01:10
636500 -- [-1075.770] (-1076.794) (-1084.514) (-1080.562) * (-1082.929) [-1076.951] (-1077.678) (-1079.154) -- 0:01:10
637000 -- (-1085.485) (-1078.836) [-1080.712] (-1074.490) * (-1076.856) [-1077.706] (-1085.690) (-1077.095) -- 0:01:10
637500 -- [-1079.364] (-1084.275) (-1076.356) (-1076.198) * [-1078.660] (-1076.921) (-1084.895) (-1079.439) -- 0:01:10
638000 -- (-1076.259) (-1077.923) (-1084.137) [-1083.075] * [-1077.120] (-1078.800) (-1076.599) (-1078.483) -- 0:01:10
638500 -- [-1083.699] (-1080.170) (-1081.868) (-1076.830) * (-1076.892) (-1080.053) (-1076.656) [-1078.076] -- 0:01:10
639000 -- (-1078.351) (-1081.080) (-1080.860) [-1079.818] * (-1078.587) [-1074.179] (-1076.327) (-1080.394) -- 0:01:10
639500 -- (-1077.939) [-1075.425] (-1079.535) (-1083.330) * (-1078.616) [-1087.231] (-1077.265) (-1086.776) -- 0:01:10
640000 -- (-1076.902) (-1076.637) [-1081.635] (-1078.711) * (-1073.709) [-1082.534] (-1077.574) (-1086.155) -- 0:01:10
Average standard deviation of split frequencies: 0.005298
640500 -- (-1075.430) (-1078.440) [-1078.329] (-1079.090) * (-1075.855) [-1075.854] (-1077.417) (-1080.105) -- 0:01:10
641000 -- (-1076.371) (-1086.097) [-1081.519] (-1074.785) * (-1083.128) [-1077.482] (-1079.715) (-1078.088) -- 0:01:10
641500 -- (-1082.451) (-1083.332) (-1084.580) [-1081.516] * (-1086.325) (-1079.382) [-1080.377] (-1076.533) -- 0:01:09
642000 -- (-1078.125) (-1080.638) [-1078.959] (-1083.907) * (-1088.971) (-1076.548) [-1073.956] (-1079.333) -- 0:01:09
642500 -- [-1080.751] (-1076.533) (-1076.860) (-1082.410) * (-1079.028) [-1075.738] (-1081.470) (-1084.357) -- 0:01:09
643000 -- [-1075.472] (-1076.284) (-1077.614) (-1075.474) * (-1079.680) [-1078.739] (-1078.287) (-1081.165) -- 0:01:09
643500 -- (-1081.247) (-1079.085) (-1078.552) [-1077.843] * (-1079.541) [-1083.272] (-1078.797) (-1080.339) -- 0:01:09
644000 -- (-1084.202) [-1076.243] (-1082.838) (-1080.821) * (-1080.264) (-1083.285) (-1078.433) [-1075.478] -- 0:01:09
644500 -- (-1079.182) (-1076.862) (-1086.689) [-1081.916] * (-1078.119) (-1081.976) (-1080.402) [-1073.124] -- 0:01:09
645000 -- (-1078.474) (-1080.617) [-1080.032] (-1076.217) * (-1088.343) (-1080.372) (-1086.391) [-1081.105] -- 0:01:09
Average standard deviation of split frequencies: 0.004670
645500 -- (-1081.766) (-1085.683) [-1077.031] (-1083.954) * (-1080.296) (-1079.774) (-1084.448) [-1074.869] -- 0:01:09
646000 -- [-1079.390] (-1077.923) (-1084.031) (-1072.534) * (-1088.174) [-1078.137] (-1078.143) (-1082.334) -- 0:01:09
646500 -- [-1079.746] (-1079.819) (-1079.678) (-1076.950) * (-1083.566) [-1079.541] (-1080.335) (-1081.692) -- 0:01:08
647000 -- (-1085.894) (-1080.924) [-1074.132] (-1076.913) * [-1076.066] (-1078.626) (-1079.094) (-1083.709) -- 0:01:08
647500 -- (-1078.951) [-1076.679] (-1085.790) (-1078.163) * (-1080.437) (-1083.068) [-1073.015] (-1079.756) -- 0:01:08
648000 -- [-1078.968] (-1081.333) (-1083.546) (-1080.931) * (-1078.484) (-1083.059) (-1078.053) [-1079.397] -- 0:01:08
648500 -- (-1078.845) (-1085.449) (-1083.790) [-1078.302] * [-1076.228] (-1082.374) (-1082.685) (-1076.482) -- 0:01:08
649000 -- (-1078.132) (-1084.297) [-1079.878] (-1084.615) * [-1077.108] (-1077.327) (-1082.913) (-1079.030) -- 0:01:08
649500 -- (-1085.736) (-1078.201) [-1079.214] (-1078.002) * (-1078.652) [-1078.167] (-1079.965) (-1077.671) -- 0:01:08
650000 -- (-1082.543) (-1077.378) [-1078.509] (-1083.428) * (-1082.059) (-1075.797) (-1082.451) [-1076.844] -- 0:01:08
Average standard deviation of split frequencies: 0.003767
650500 -- (-1083.358) (-1079.358) [-1082.263] (-1079.191) * [-1076.201] (-1080.964) (-1086.252) (-1084.047) -- 0:01:08
651000 -- (-1075.995) [-1090.388] (-1084.519) (-1084.818) * (-1075.630) [-1078.300] (-1077.323) (-1079.142) -- 0:01:08
651500 -- (-1079.699) (-1079.185) [-1089.408] (-1073.986) * [-1078.960] (-1081.631) (-1085.181) (-1075.833) -- 0:01:07
652000 -- (-1081.239) [-1080.241] (-1086.408) (-1074.256) * (-1078.175) (-1081.951) [-1084.143] (-1074.465) -- 0:01:07
652500 -- [-1081.135] (-1084.576) (-1086.788) (-1077.649) * (-1076.666) (-1077.120) [-1081.170] (-1081.163) -- 0:01:07
653000 -- [-1085.771] (-1080.759) (-1087.427) (-1081.325) * (-1084.335) (-1082.520) [-1079.959] (-1080.162) -- 0:01:07
653500 -- (-1085.175) [-1079.005] (-1077.916) (-1081.204) * [-1084.261] (-1084.245) (-1084.365) (-1076.592) -- 0:01:07
654000 -- (-1077.617) (-1079.575) (-1076.732) [-1079.339] * (-1084.780) (-1077.951) [-1078.138] (-1078.757) -- 0:01:07
654500 -- (-1078.978) (-1077.418) [-1083.361] (-1093.950) * (-1079.038) (-1082.848) [-1073.659] (-1076.232) -- 0:01:07
655000 -- [-1080.525] (-1073.401) (-1078.042) (-1094.159) * [-1079.740] (-1080.180) (-1078.549) (-1086.423) -- 0:01:07
Average standard deviation of split frequencies: 0.003162
655500 -- [-1075.606] (-1076.249) (-1074.526) (-1081.185) * (-1078.380) (-1074.214) [-1079.447] (-1083.735) -- 0:01:07
656000 -- [-1073.547] (-1079.723) (-1084.375) (-1075.590) * (-1074.941) [-1076.552] (-1078.514) (-1076.446) -- 0:01:07
656500 -- [-1075.287] (-1079.607) (-1079.801) (-1083.062) * [-1078.372] (-1082.407) (-1084.073) (-1076.440) -- 0:01:06
657000 -- [-1077.922] (-1080.108) (-1075.954) (-1084.197) * (-1079.366) (-1078.732) [-1080.072] (-1084.464) -- 0:01:06
657500 -- (-1081.771) (-1077.466) (-1079.649) [-1079.343] * [-1081.378] (-1076.889) (-1077.362) (-1081.032) -- 0:01:06
658000 -- [-1079.946] (-1078.807) (-1075.121) (-1083.437) * (-1081.000) (-1082.036) [-1076.219] (-1080.782) -- 0:01:06
658500 -- (-1078.017) (-1078.262) [-1079.127] (-1088.958) * (-1084.283) (-1074.548) [-1080.702] (-1073.648) -- 0:01:06
659000 -- (-1079.863) (-1081.156) (-1084.785) [-1074.580] * (-1082.757) (-1074.229) [-1079.569] (-1084.884) -- 0:01:06
659500 -- [-1078.638] (-1077.172) (-1076.128) (-1081.686) * (-1080.687) (-1077.966) [-1080.514] (-1076.030) -- 0:01:06
660000 -- [-1075.091] (-1087.907) (-1084.445) (-1079.265) * (-1080.458) (-1080.767) (-1084.847) [-1075.363] -- 0:01:06
Average standard deviation of split frequencies: 0.004281
660500 -- (-1083.426) (-1084.649) (-1078.160) [-1077.777] * (-1076.494) (-1078.730) (-1084.953) [-1076.237] -- 0:01:06
661000 -- (-1083.401) (-1077.208) (-1073.856) [-1081.828] * (-1084.714) (-1079.767) (-1077.387) [-1076.317] -- 0:01:06
661500 -- (-1087.926) (-1083.536) [-1076.593] (-1080.542) * (-1077.102) (-1086.890) [-1074.772] (-1087.150) -- 0:01:06
662000 -- (-1075.235) [-1080.808] (-1078.901) (-1083.591) * (-1074.979) (-1074.229) (-1076.721) [-1073.759] -- 0:01:05
662500 -- (-1085.058) (-1079.337) [-1077.172] (-1075.834) * [-1078.701] (-1077.442) (-1083.434) (-1078.698) -- 0:01:05
663000 -- (-1077.758) (-1082.045) (-1079.467) [-1079.826] * (-1087.254) (-1083.193) (-1082.102) [-1076.310] -- 0:01:05
663500 -- (-1081.678) [-1072.954] (-1082.483) (-1082.267) * (-1080.617) (-1076.201) [-1081.189] (-1079.816) -- 0:01:05
664000 -- (-1076.113) [-1078.938] (-1082.817) (-1076.305) * (-1077.779) (-1079.075) (-1077.296) [-1075.845] -- 0:01:05
664500 -- (-1085.103) (-1079.309) (-1083.513) [-1077.141] * [-1075.685] (-1085.325) (-1083.020) (-1076.294) -- 0:01:05
665000 -- (-1077.145) (-1075.599) [-1074.953] (-1082.626) * (-1077.740) (-1081.615) (-1077.629) [-1080.198] -- 0:01:05
Average standard deviation of split frequencies: 0.003398
665500 -- (-1077.893) (-1076.628) (-1077.226) [-1087.886] * (-1080.377) [-1080.949] (-1079.034) (-1081.600) -- 0:01:05
666000 -- (-1081.888) [-1078.817] (-1078.137) (-1086.085) * (-1077.753) (-1080.563) (-1080.537) [-1078.525] -- 0:01:05
666500 -- (-1079.554) (-1089.280) (-1075.900) [-1077.771] * (-1075.743) (-1081.041) [-1075.728] (-1085.322) -- 0:01:05
667000 -- [-1084.428] (-1085.402) (-1077.264) (-1090.519) * (-1073.409) (-1078.556) [-1083.359] (-1079.297) -- 0:01:04
667500 -- [-1077.630] (-1076.361) (-1080.621) (-1083.339) * (-1076.057) [-1076.063] (-1077.994) (-1074.349) -- 0:01:04
668000 -- (-1080.863) (-1076.416) [-1081.992] (-1081.991) * [-1078.463] (-1079.899) (-1088.429) (-1079.809) -- 0:01:04
668500 -- [-1083.236] (-1076.895) (-1083.293) (-1078.899) * (-1080.865) (-1080.965) [-1084.572] (-1086.506) -- 0:01:04
669000 -- (-1082.506) [-1077.344] (-1073.997) (-1084.557) * (-1087.448) [-1081.480] (-1080.993) (-1084.155) -- 0:01:04
669500 -- (-1082.429) [-1076.955] (-1079.023) (-1083.040) * (-1077.121) (-1079.718) [-1079.369] (-1082.887) -- 0:01:04
670000 -- [-1077.577] (-1076.892) (-1083.703) (-1084.657) * (-1076.817) [-1078.556] (-1080.189) (-1081.361) -- 0:01:04
Average standard deviation of split frequencies: 0.004217
670500 -- (-1078.973) [-1076.720] (-1078.376) (-1081.073) * [-1078.379] (-1078.782) (-1079.106) (-1081.929) -- 0:01:04
671000 -- (-1084.005) (-1079.680) (-1079.591) [-1080.411] * [-1080.063] (-1081.593) (-1083.127) (-1073.899) -- 0:01:04
671500 -- (-1082.549) (-1082.657) (-1078.673) [-1078.118] * (-1083.379) (-1079.040) [-1079.444] (-1080.895) -- 0:01:04
672000 -- (-1081.787) [-1080.786] (-1085.822) (-1080.482) * [-1079.271] (-1078.722) (-1079.866) (-1075.296) -- 0:01:03
672500 -- (-1079.913) [-1084.450] (-1077.192) (-1083.001) * (-1082.414) [-1075.073] (-1078.462) (-1073.642) -- 0:01:03
673000 -- (-1073.699) [-1080.532] (-1084.752) (-1076.723) * (-1080.109) (-1079.439) (-1079.027) [-1076.366] -- 0:01:03
673500 -- (-1080.104) (-1080.802) (-1097.175) [-1076.401] * (-1076.339) (-1078.442) (-1077.359) [-1078.928] -- 0:01:03
674000 -- (-1077.938) (-1080.936) (-1084.669) [-1084.289] * [-1082.861] (-1082.619) (-1075.541) (-1078.090) -- 0:01:03
674500 -- (-1081.185) (-1088.051) [-1077.956] (-1078.041) * (-1087.207) [-1077.176] (-1077.024) (-1083.109) -- 0:01:03
675000 -- (-1076.372) (-1085.173) (-1083.071) [-1075.882] * (-1082.390) (-1082.533) [-1075.469] (-1081.041) -- 0:01:03
Average standard deviation of split frequencies: 0.004742
675500 -- (-1087.282) [-1078.045] (-1087.247) (-1074.579) * (-1078.202) (-1076.226) [-1078.982] (-1078.280) -- 0:01:03
676000 -- (-1089.513) (-1079.920) [-1074.166] (-1075.222) * (-1078.424) (-1090.111) [-1078.284] (-1088.058) -- 0:01:03
676500 -- (-1081.613) [-1077.357] (-1079.216) (-1084.027) * (-1078.807) [-1078.680] (-1082.122) (-1081.325) -- 0:01:03
677000 -- (-1091.221) (-1084.838) [-1081.886] (-1082.118) * (-1085.324) (-1079.779) (-1082.886) [-1087.013] -- 0:01:02
677500 -- [-1076.764] (-1079.187) (-1081.425) (-1076.722) * [-1083.896] (-1082.029) (-1088.584) (-1077.635) -- 0:01:02
678000 -- (-1082.287) (-1076.771) (-1080.954) [-1080.222] * (-1077.557) (-1078.637) (-1077.053) [-1074.441] -- 0:01:02
678500 -- (-1078.559) (-1076.809) (-1079.661) [-1078.016] * [-1080.982] (-1084.215) (-1078.736) (-1078.742) -- 0:01:02
679000 -- (-1080.077) (-1075.766) (-1083.240) [-1073.975] * (-1086.108) [-1081.453] (-1079.826) (-1076.483) -- 0:01:02
679500 -- (-1087.395) (-1079.808) (-1081.895) [-1079.562] * (-1078.241) (-1079.356) [-1085.359] (-1077.879) -- 0:01:02
680000 -- (-1075.236) (-1086.304) [-1078.336] (-1080.334) * (-1080.418) [-1079.517] (-1086.214) (-1079.104) -- 0:01:02
Average standard deviation of split frequencies: 0.004986
680500 -- (-1078.028) (-1084.441) (-1076.646) [-1076.124] * (-1080.118) [-1080.006] (-1093.062) (-1079.068) -- 0:01:02
681000 -- (-1078.514) (-1077.683) [-1084.605] (-1090.688) * (-1079.070) (-1077.025) [-1082.007] (-1085.547) -- 0:01:02
681500 -- (-1084.012) [-1075.345] (-1084.269) (-1079.519) * (-1075.748) (-1076.354) (-1081.550) [-1085.999] -- 0:01:02
682000 -- (-1083.717) (-1085.929) (-1077.448) [-1074.296] * (-1080.599) (-1086.747) (-1080.129) [-1079.743] -- 0:01:02
682500 -- (-1075.252) (-1090.494) [-1077.627] (-1078.584) * (-1076.138) (-1083.768) [-1081.444] (-1078.539) -- 0:01:01
683000 -- [-1079.584] (-1081.018) (-1077.501) (-1077.341) * (-1085.506) [-1077.402] (-1081.552) (-1078.190) -- 0:01:01
683500 -- (-1075.519) [-1076.327] (-1082.372) (-1078.788) * (-1076.424) (-1078.247) (-1078.231) [-1080.229] -- 0:01:01
684000 -- (-1083.665) (-1083.505) [-1076.754] (-1078.788) * (-1080.206) [-1077.801] (-1075.583) (-1075.860) -- 0:01:01
684500 -- (-1083.522) (-1077.252) (-1084.542) [-1080.374] * (-1081.405) (-1079.041) (-1082.448) [-1082.010] -- 0:01:01
685000 -- (-1078.138) [-1075.452] (-1083.879) (-1083.976) * (-1080.780) (-1077.932) [-1075.454] (-1077.897) -- 0:01:01
Average standard deviation of split frequencies: 0.004948
685500 -- (-1085.756) [-1078.544] (-1082.158) (-1083.626) * (-1077.258) (-1086.788) (-1076.165) [-1078.828] -- 0:01:01
686000 -- (-1089.145) [-1083.427] (-1075.107) (-1084.756) * (-1087.480) (-1080.722) [-1075.804] (-1087.751) -- 0:01:01
686500 -- [-1077.789] (-1090.168) (-1083.659) (-1092.213) * (-1081.501) (-1084.906) [-1075.857] (-1079.881) -- 0:01:01
687000 -- (-1075.800) (-1077.936) [-1078.623] (-1086.334) * (-1079.746) (-1079.080) [-1081.135] (-1084.592) -- 0:01:01
687500 -- (-1080.100) (-1075.250) (-1078.544) [-1077.692] * (-1080.650) [-1082.895] (-1077.929) (-1079.612) -- 0:01:00
688000 -- (-1080.927) [-1078.869] (-1078.154) (-1086.395) * [-1075.355] (-1082.477) (-1081.009) (-1081.747) -- 0:01:00
688500 -- (-1080.713) (-1078.398) (-1078.476) [-1084.056] * (-1081.952) [-1078.605] (-1080.522) (-1077.067) -- 0:01:00
689000 -- [-1075.118] (-1080.014) (-1083.695) (-1091.993) * (-1077.434) (-1077.221) (-1084.731) [-1075.467] -- 0:01:00
689500 -- [-1076.266] (-1083.798) (-1075.598) (-1082.347) * [-1083.212] (-1084.703) (-1080.016) (-1077.685) -- 0:01:00
690000 -- (-1079.623) (-1083.486) (-1079.304) [-1077.712] * (-1084.357) (-1075.615) [-1085.452] (-1083.578) -- 0:01:00
Average standard deviation of split frequencies: 0.003822
690500 -- (-1080.805) [-1077.114] (-1081.669) (-1077.568) * [-1078.112] (-1078.014) (-1082.531) (-1081.279) -- 0:01:00
691000 -- (-1078.227) (-1087.471) (-1083.407) [-1076.160] * (-1084.906) (-1081.453) (-1077.408) [-1086.465] -- 0:01:00
691500 -- (-1082.684) (-1080.583) (-1080.952) [-1080.835] * (-1079.693) (-1083.311) [-1076.497] (-1089.234) -- 0:01:00
692000 -- (-1082.782) (-1081.108) [-1085.232] (-1085.366) * (-1073.458) [-1076.718] (-1083.476) (-1083.401) -- 0:01:00
692500 -- [-1077.631] (-1081.934) (-1081.399) (-1078.754) * [-1080.209] (-1078.088) (-1087.328) (-1081.174) -- 0:00:59
693000 -- [-1079.808] (-1083.249) (-1079.058) (-1087.940) * [-1076.923] (-1080.021) (-1078.363) (-1080.023) -- 0:00:59
693500 -- (-1076.464) (-1080.442) (-1079.678) [-1075.695] * (-1075.541) (-1079.253) [-1073.234] (-1079.778) -- 0:00:59
694000 -- (-1080.584) (-1082.784) (-1082.163) [-1075.717] * (-1077.430) [-1074.787] (-1073.952) (-1082.617) -- 0:00:59
694500 -- (-1085.415) (-1085.211) [-1076.322] (-1077.579) * [-1077.545] (-1079.586) (-1082.670) (-1073.282) -- 0:00:59
695000 -- (-1082.121) (-1077.176) [-1075.284] (-1081.546) * (-1077.273) (-1075.586) [-1075.668] (-1083.903) -- 0:00:59
Average standard deviation of split frequencies: 0.003793
695500 -- (-1077.513) (-1081.630) (-1079.007) [-1077.164] * (-1075.547) (-1077.018) (-1082.464) [-1081.592] -- 0:00:59
696000 -- [-1075.864] (-1084.637) (-1084.097) (-1086.244) * (-1077.895) (-1085.287) (-1079.285) [-1080.000] -- 0:00:59
696500 -- [-1077.707] (-1087.453) (-1076.096) (-1084.884) * (-1081.762) [-1082.052] (-1088.479) (-1079.628) -- 0:00:59
697000 -- [-1074.293] (-1085.257) (-1080.280) (-1075.578) * (-1077.739) (-1087.704) (-1081.670) [-1079.465] -- 0:00:59
697500 -- [-1080.272] (-1085.548) (-1081.586) (-1076.515) * (-1077.417) (-1087.174) [-1079.607] (-1081.172) -- 0:00:58
698000 -- (-1083.991) [-1083.490] (-1081.193) (-1078.170) * (-1080.983) (-1081.591) [-1078.517] (-1081.674) -- 0:00:58
698500 -- [-1081.894] (-1082.678) (-1079.762) (-1079.741) * (-1085.333) (-1073.732) [-1081.482] (-1077.427) -- 0:00:58
699000 -- (-1080.001) [-1081.422] (-1088.971) (-1081.674) * [-1076.911] (-1078.954) (-1079.987) (-1078.193) -- 0:00:58
699500 -- (-1075.890) [-1082.891] (-1087.326) (-1077.996) * (-1081.844) [-1075.800] (-1075.924) (-1077.321) -- 0:00:58
700000 -- (-1078.518) (-1073.376) (-1081.490) [-1072.876] * (-1077.732) (-1081.573) (-1083.639) [-1084.755] -- 0:00:58
Average standard deviation of split frequencies: 0.004575
700500 -- (-1077.914) [-1074.889] (-1080.544) (-1078.596) * (-1085.312) [-1080.389] (-1084.836) (-1083.660) -- 0:00:58
701000 -- (-1075.418) (-1082.959) (-1080.069) [-1076.741] * [-1081.026] (-1078.772) (-1079.011) (-1082.364) -- 0:00:58
701500 -- [-1078.112] (-1079.397) (-1075.765) (-1078.105) * (-1079.855) (-1076.226) (-1074.325) [-1077.340] -- 0:00:58
702000 -- [-1078.348] (-1078.938) (-1075.591) (-1081.407) * (-1080.171) [-1078.678] (-1077.579) (-1074.653) -- 0:00:58
702500 -- (-1080.108) (-1082.878) (-1078.066) [-1078.781] * (-1083.269) (-1081.083) (-1077.137) [-1075.993] -- 0:00:58
703000 -- [-1077.237] (-1086.170) (-1080.933) (-1083.079) * (-1081.870) (-1078.537) [-1076.674] (-1091.415) -- 0:00:57
703500 -- [-1076.369] (-1085.973) (-1077.356) (-1080.600) * (-1082.388) (-1079.344) [-1079.966] (-1091.568) -- 0:00:57
704000 -- (-1077.802) (-1078.771) [-1077.442] (-1082.134) * (-1075.988) [-1077.165] (-1079.883) (-1076.266) -- 0:00:57
704500 -- [-1075.443] (-1086.891) (-1078.609) (-1081.460) * (-1079.476) (-1079.134) [-1072.247] (-1081.946) -- 0:00:57
705000 -- (-1079.259) [-1080.383] (-1079.145) (-1078.397) * (-1076.617) [-1076.384] (-1078.602) (-1083.414) -- 0:00:57
Average standard deviation of split frequencies: 0.004540
705500 -- (-1084.483) (-1077.703) [-1076.910] (-1081.219) * (-1079.655) (-1080.693) [-1074.650] (-1082.478) -- 0:00:57
706000 -- (-1079.558) [-1076.908] (-1079.002) (-1078.939) * (-1081.992) (-1089.179) (-1086.936) [-1079.812] -- 0:00:57
706500 -- (-1077.243) [-1077.917] (-1079.917) (-1076.331) * (-1079.418) (-1082.582) (-1078.003) [-1077.258] -- 0:00:57
707000 -- (-1077.979) (-1082.006) [-1084.637] (-1080.623) * (-1085.912) (-1078.576) [-1080.493] (-1079.392) -- 0:00:57
707500 -- (-1081.207) (-1082.636) (-1089.616) [-1078.318] * (-1086.900) (-1079.212) (-1080.113) [-1078.275] -- 0:00:57
708000 -- (-1078.420) (-1085.917) (-1078.601) [-1078.057] * (-1078.551) (-1081.224) [-1079.630] (-1085.495) -- 0:00:56
708500 -- (-1075.470) [-1076.200] (-1078.163) (-1086.522) * (-1080.202) (-1087.570) (-1077.830) [-1080.189] -- 0:00:56
709000 -- (-1078.756) [-1077.755] (-1081.965) (-1082.208) * (-1078.112) (-1079.498) (-1082.650) [-1075.941] -- 0:00:56
709500 -- [-1081.649] (-1078.931) (-1079.015) (-1087.087) * (-1087.757) (-1082.077) (-1081.814) [-1074.239] -- 0:00:56
710000 -- (-1077.575) [-1084.715] (-1085.951) (-1082.679) * (-1076.813) [-1078.265] (-1078.239) (-1075.930) -- 0:00:56
Average standard deviation of split frequencies: 0.005307
710500 -- (-1083.693) (-1081.194) [-1081.352] (-1077.843) * (-1078.369) (-1076.852) [-1083.156] (-1077.232) -- 0:00:56
711000 -- [-1074.179] (-1080.167) (-1086.004) (-1085.005) * (-1080.885) [-1071.903] (-1078.247) (-1079.826) -- 0:00:56
711500 -- (-1079.653) (-1085.005) [-1083.588] (-1078.134) * (-1078.614) [-1076.892] (-1076.736) (-1076.654) -- 0:00:56
712000 -- (-1077.354) (-1079.354) (-1081.212) [-1083.039] * (-1079.583) [-1075.858] (-1074.858) (-1077.281) -- 0:00:56
712500 -- [-1076.146] (-1077.182) (-1079.932) (-1079.107) * (-1075.251) (-1087.819) [-1074.498] (-1086.786) -- 0:00:56
713000 -- (-1076.964) (-1079.590) (-1078.919) [-1086.647] * [-1078.026] (-1083.707) (-1075.985) (-1082.539) -- 0:00:55
713500 -- (-1078.962) (-1084.868) [-1076.370] (-1077.363) * [-1079.835] (-1080.099) (-1078.239) (-1080.407) -- 0:00:55
714000 -- (-1075.930) [-1080.264] (-1079.023) (-1076.884) * [-1077.661] (-1085.941) (-1073.814) (-1081.283) -- 0:00:55
714500 -- (-1079.036) (-1082.493) (-1077.846) [-1073.642] * (-1083.484) (-1080.827) (-1078.116) [-1080.176] -- 0:00:55
715000 -- (-1078.573) (-1081.937) [-1079.814] (-1077.450) * (-1078.679) (-1078.187) (-1077.821) [-1075.640] -- 0:00:55
Average standard deviation of split frequencies: 0.006057
715500 -- (-1074.774) (-1077.314) [-1079.776] (-1084.871) * (-1077.001) [-1077.415] (-1079.330) (-1081.781) -- 0:00:55
716000 -- (-1079.005) (-1080.227) [-1080.216] (-1082.659) * (-1083.154) (-1079.069) (-1077.444) [-1079.385] -- 0:00:55
716500 -- [-1072.705] (-1075.127) (-1077.215) (-1082.038) * (-1081.672) (-1080.947) [-1075.408] (-1076.107) -- 0:00:55
717000 -- (-1078.496) (-1081.860) [-1078.546] (-1078.662) * (-1081.638) (-1081.082) (-1085.452) [-1078.037] -- 0:00:55
717500 -- (-1072.783) [-1081.346] (-1077.802) (-1080.977) * (-1080.304) (-1081.185) [-1079.936] (-1084.123) -- 0:00:55
718000 -- (-1079.147) (-1075.329) [-1080.716] (-1080.444) * (-1083.707) [-1084.393] (-1080.817) (-1079.190) -- 0:00:54
718500 -- (-1079.985) [-1081.814] (-1083.338) (-1083.001) * [-1078.195] (-1084.377) (-1073.798) (-1076.986) -- 0:00:54
719000 -- (-1077.951) (-1079.874) (-1079.570) [-1074.164] * (-1079.092) [-1077.393] (-1083.574) (-1080.063) -- 0:00:54
719500 -- (-1081.375) [-1075.280] (-1075.688) (-1078.562) * (-1077.466) (-1082.351) (-1077.245) [-1082.369] -- 0:00:54
720000 -- [-1078.777] (-1080.094) (-1080.560) (-1081.777) * (-1085.989) [-1077.658] (-1080.748) (-1086.903) -- 0:00:54
Average standard deviation of split frequencies: 0.006280
720500 -- [-1077.437] (-1082.023) (-1078.564) (-1083.291) * (-1076.388) [-1076.085] (-1079.108) (-1084.178) -- 0:00:54
721000 -- [-1076.330] (-1080.302) (-1075.536) (-1083.147) * (-1080.005) (-1077.200) (-1081.101) [-1083.117] -- 0:00:54
721500 -- (-1080.512) (-1084.280) [-1075.780] (-1079.666) * (-1083.815) [-1073.631] (-1080.487) (-1077.524) -- 0:00:54
722000 -- [-1077.667] (-1081.018) (-1076.921) (-1086.141) * (-1078.982) (-1082.726) (-1084.240) [-1079.597] -- 0:00:54
722500 -- [-1075.302] (-1087.931) (-1078.939) (-1080.102) * (-1085.054) (-1092.110) (-1080.680) [-1075.640] -- 0:00:54
723000 -- (-1079.637) (-1091.274) [-1082.850] (-1089.356) * [-1074.650] (-1080.547) (-1090.161) (-1072.433) -- 0:00:54
723500 -- (-1082.402) [-1075.334] (-1083.346) (-1085.463) * (-1089.990) (-1076.470) (-1085.729) [-1082.696] -- 0:00:53
724000 -- (-1080.593) [-1073.346] (-1080.744) (-1078.550) * [-1081.497] (-1076.918) (-1088.888) (-1083.998) -- 0:00:53
724500 -- [-1080.333] (-1076.664) (-1078.746) (-1077.960) * (-1074.063) [-1073.024] (-1082.206) (-1080.676) -- 0:00:53
725000 -- (-1081.807) (-1079.023) (-1075.261) [-1079.929] * (-1086.069) (-1074.276) (-1082.727) [-1079.786] -- 0:00:53
Average standard deviation of split frequencies: 0.005974
725500 -- (-1081.633) (-1085.813) [-1082.063] (-1077.364) * (-1078.748) (-1083.053) [-1085.533] (-1081.660) -- 0:00:53
726000 -- (-1079.513) (-1076.460) (-1073.886) [-1078.438] * [-1079.018] (-1083.567) (-1077.531) (-1082.207) -- 0:00:53
726500 -- (-1073.960) (-1078.233) [-1075.356] (-1080.555) * (-1081.507) [-1076.424] (-1078.307) (-1078.298) -- 0:00:53
727000 -- [-1075.127] (-1087.665) (-1076.964) (-1079.332) * (-1084.851) (-1083.339) [-1074.310] (-1079.142) -- 0:00:53
727500 -- [-1079.629] (-1082.875) (-1081.064) (-1078.992) * (-1079.377) (-1081.515) (-1076.059) [-1076.390] -- 0:00:53
728000 -- (-1080.897) (-1080.040) [-1083.706] (-1080.123) * [-1081.333] (-1082.290) (-1080.457) (-1080.609) -- 0:00:53
728500 -- [-1080.081] (-1081.833) (-1084.513) (-1089.439) * (-1084.287) [-1080.257] (-1082.719) (-1078.449) -- 0:00:52
729000 -- [-1076.272] (-1085.487) (-1079.274) (-1081.582) * [-1079.094] (-1076.355) (-1082.723) (-1084.189) -- 0:00:52
729500 -- (-1079.374) (-1079.450) [-1079.750] (-1073.302) * [-1079.912] (-1080.407) (-1080.196) (-1083.013) -- 0:00:52
730000 -- [-1081.694] (-1083.898) (-1081.495) (-1078.977) * (-1078.771) (-1079.601) [-1080.457] (-1080.074) -- 0:00:52
Average standard deviation of split frequencies: 0.006452
730500 -- [-1079.108] (-1080.637) (-1080.076) (-1090.410) * (-1084.086) (-1077.137) (-1079.758) [-1082.604] -- 0:00:52
731000 -- (-1083.684) [-1083.971] (-1078.228) (-1087.090) * [-1075.198] (-1092.524) (-1081.317) (-1087.708) -- 0:00:52
731500 -- [-1081.223] (-1078.179) (-1079.878) (-1083.628) * [-1075.459] (-1077.903) (-1083.661) (-1080.545) -- 0:00:52
732000 -- (-1081.308) [-1080.978] (-1082.911) (-1076.975) * [-1078.536] (-1078.483) (-1081.299) (-1079.468) -- 0:00:52
732500 -- [-1090.727] (-1081.105) (-1083.895) (-1080.062) * (-1079.681) [-1080.112] (-1075.619) (-1077.349) -- 0:00:52
733000 -- (-1080.227) [-1080.838] (-1080.614) (-1080.798) * (-1084.221) (-1075.263) (-1081.396) [-1075.319] -- 0:00:52
733500 -- (-1082.741) (-1078.500) [-1082.582] (-1085.763) * [-1081.948] (-1079.216) (-1080.568) (-1084.522) -- 0:00:51
734000 -- (-1076.338) (-1078.300) [-1075.904] (-1089.607) * (-1085.522) (-1080.111) [-1076.747] (-1084.171) -- 0:00:51
734500 -- (-1078.176) (-1073.351) [-1073.843] (-1084.448) * (-1076.676) (-1074.504) (-1086.430) [-1075.492] -- 0:00:51
735000 -- [-1078.486] (-1073.573) (-1079.586) (-1081.267) * (-1080.701) (-1078.400) [-1079.179] (-1082.793) -- 0:00:51
Average standard deviation of split frequencies: 0.006405
735500 -- (-1088.465) (-1081.111) (-1075.743) [-1077.586] * [-1077.768] (-1082.179) (-1081.907) (-1084.355) -- 0:00:51
736000 -- (-1080.326) [-1079.020] (-1082.087) (-1079.404) * (-1079.517) (-1078.270) (-1091.144) [-1074.486] -- 0:00:51
736500 -- (-1075.258) (-1079.588) (-1081.488) [-1077.117] * (-1078.613) [-1081.430] (-1078.957) (-1076.898) -- 0:00:51
737000 -- (-1080.374) (-1076.444) [-1076.941] (-1083.669) * (-1078.520) (-1081.224) [-1075.098] (-1078.940) -- 0:00:51
737500 -- (-1080.466) (-1083.791) [-1078.904] (-1080.063) * [-1076.614] (-1082.221) (-1076.579) (-1081.068) -- 0:00:51
738000 -- (-1084.782) [-1085.629] (-1079.616) (-1079.069) * (-1081.495) (-1076.413) [-1078.755] (-1079.393) -- 0:00:51
738500 -- (-1085.024) (-1081.157) [-1078.434] (-1079.793) * (-1078.620) (-1076.575) (-1080.751) [-1077.309] -- 0:00:50
739000 -- (-1088.948) [-1075.581] (-1079.624) (-1073.803) * (-1078.052) (-1080.561) (-1080.804) [-1077.549] -- 0:00:50
739500 -- (-1089.260) (-1081.272) (-1078.046) [-1084.183] * (-1080.559) [-1079.085] (-1079.930) (-1085.341) -- 0:00:50
740000 -- (-1077.784) (-1082.289) [-1081.788] (-1081.564) * (-1082.197) (-1077.778) [-1076.556] (-1086.171) -- 0:00:50
Average standard deviation of split frequencies: 0.006365
740500 -- (-1079.015) [-1085.328] (-1078.777) (-1086.787) * (-1081.246) (-1077.769) [-1076.737] (-1082.676) -- 0:00:50
741000 -- (-1085.058) (-1083.694) [-1074.357] (-1074.743) * (-1082.872) (-1084.502) [-1083.170] (-1085.951) -- 0:00:50
741500 -- [-1075.491] (-1080.036) (-1080.190) (-1080.436) * (-1079.030) [-1083.216] (-1075.782) (-1092.929) -- 0:00:50
742000 -- [-1077.231] (-1081.452) (-1079.132) (-1084.613) * (-1078.163) (-1083.300) [-1075.624] (-1082.789) -- 0:00:50
742500 -- [-1075.926] (-1078.538) (-1075.315) (-1081.287) * (-1076.910) [-1074.250] (-1073.886) (-1090.662) -- 0:00:50
743000 -- (-1085.763) [-1077.983] (-1081.121) (-1083.963) * [-1080.739] (-1080.675) (-1081.231) (-1084.940) -- 0:00:50
743500 -- [-1082.836] (-1079.672) (-1077.950) (-1087.983) * [-1074.434] (-1078.796) (-1081.802) (-1087.050) -- 0:00:50
744000 -- [-1082.928] (-1080.859) (-1079.112) (-1085.889) * (-1082.474) (-1078.382) [-1078.078] (-1079.080) -- 0:00:49
744500 -- (-1079.059) (-1078.929) [-1083.192] (-1093.136) * (-1079.733) [-1077.671] (-1075.474) (-1080.758) -- 0:00:49
745000 -- (-1085.893) [-1076.976] (-1083.496) (-1078.132) * (-1082.196) (-1081.681) (-1079.219) [-1077.418] -- 0:00:49
Average standard deviation of split frequencies: 0.006319
745500 -- (-1083.552) (-1075.595) (-1083.530) [-1082.341] * (-1081.590) [-1078.501] (-1081.881) (-1087.480) -- 0:00:49
746000 -- [-1077.117] (-1076.563) (-1076.117) (-1086.593) * (-1079.312) [-1084.258] (-1078.442) (-1086.274) -- 0:00:49
746500 -- [-1077.705] (-1077.088) (-1080.090) (-1085.148) * (-1076.309) (-1078.228) (-1078.005) [-1080.032] -- 0:00:49
747000 -- (-1082.601) [-1078.824] (-1072.697) (-1089.158) * (-1076.528) [-1080.447] (-1077.973) (-1081.236) -- 0:00:49
747500 -- (-1072.987) (-1080.523) [-1079.892] (-1082.398) * (-1081.032) (-1085.103) [-1078.539] (-1077.850) -- 0:00:49
748000 -- (-1081.579) (-1078.763) (-1080.326) [-1080.151] * [-1080.029] (-1084.220) (-1076.957) (-1086.211) -- 0:00:49
748500 -- [-1082.376] (-1079.829) (-1080.378) (-1077.353) * (-1084.427) [-1078.814] (-1075.625) (-1081.183) -- 0:00:49
749000 -- (-1078.625) (-1081.797) (-1083.258) [-1083.899] * (-1081.906) (-1084.677) (-1083.941) [-1081.162] -- 0:00:48
749500 -- [-1081.126] (-1090.887) (-1086.856) (-1083.696) * (-1083.713) (-1083.593) (-1083.389) [-1075.798] -- 0:00:48
750000 -- (-1077.455) (-1081.685) [-1084.979] (-1093.927) * [-1077.974] (-1080.616) (-1076.247) (-1079.917) -- 0:00:48
Average standard deviation of split frequencies: 0.006531
750500 -- (-1076.314) [-1082.974] (-1080.144) (-1084.844) * (-1078.437) [-1081.336] (-1076.418) (-1079.887) -- 0:00:48
751000 -- (-1074.850) (-1081.115) (-1076.695) [-1077.543] * (-1078.228) [-1078.178] (-1077.538) (-1082.164) -- 0:00:48
751500 -- (-1083.735) [-1083.628] (-1084.643) (-1081.745) * [-1083.096] (-1073.670) (-1079.089) (-1077.342) -- 0:00:48
752000 -- (-1076.440) (-1082.288) [-1078.199] (-1078.646) * (-1085.586) (-1080.337) (-1084.905) [-1076.879] -- 0:00:48
752500 -- [-1075.925] (-1085.475) (-1080.697) (-1082.251) * (-1084.416) [-1079.470] (-1079.428) (-1084.368) -- 0:00:48
753000 -- (-1076.318) (-1076.394) [-1081.789] (-1083.492) * [-1079.958] (-1080.746) (-1079.573) (-1083.200) -- 0:00:48
753500 -- (-1081.754) [-1072.086] (-1075.447) (-1084.671) * (-1087.946) (-1077.694) (-1076.295) [-1078.193] -- 0:00:48
754000 -- (-1083.500) [-1075.152] (-1080.425) (-1089.922) * (-1090.352) [-1079.939] (-1078.698) (-1079.526) -- 0:00:47
754500 -- (-1085.504) (-1079.521) (-1082.195) [-1077.317] * (-1088.118) (-1083.195) [-1072.864] (-1083.714) -- 0:00:47
755000 -- [-1077.832] (-1076.650) (-1081.801) (-1079.156) * (-1079.348) (-1080.706) [-1081.136] (-1082.986) -- 0:00:47
Average standard deviation of split frequencies: 0.006485
755500 -- (-1077.307) [-1078.494] (-1076.629) (-1079.690) * (-1079.157) [-1081.435] (-1082.623) (-1078.660) -- 0:00:47
756000 -- (-1077.314) (-1081.369) [-1077.114] (-1077.156) * [-1077.744] (-1085.969) (-1076.573) (-1079.637) -- 0:00:47
756500 -- (-1079.623) [-1074.004] (-1080.072) (-1080.929) * [-1078.080] (-1096.327) (-1083.154) (-1081.446) -- 0:00:47
757000 -- [-1080.661] (-1089.592) (-1080.747) (-1081.742) * (-1077.746) [-1078.075] (-1086.935) (-1083.583) -- 0:00:47
757500 -- (-1083.862) [-1079.294] (-1079.112) (-1091.206) * (-1078.058) [-1079.726] (-1090.483) (-1078.902) -- 0:00:47
758000 -- (-1079.077) [-1079.509] (-1075.755) (-1086.995) * [-1080.431] (-1080.632) (-1079.428) (-1085.097) -- 0:00:47
758500 -- [-1074.636] (-1081.811) (-1079.682) (-1075.673) * (-1076.680) (-1086.991) [-1078.693] (-1079.906) -- 0:00:47
759000 -- (-1085.339) (-1082.801) (-1075.743) [-1077.026] * (-1080.535) (-1084.605) (-1080.253) [-1076.146] -- 0:00:46
759500 -- [-1080.300] (-1083.534) (-1076.631) (-1077.527) * (-1072.332) (-1077.194) (-1080.422) [-1076.500] -- 0:00:46
760000 -- (-1080.202) (-1076.114) (-1079.689) [-1075.229] * (-1089.536) (-1080.394) [-1081.285] (-1086.473) -- 0:00:46
Average standard deviation of split frequencies: 0.005701
760500 -- (-1082.203) (-1085.871) [-1084.133] (-1086.137) * [-1077.905] (-1074.455) (-1082.648) (-1078.734) -- 0:00:46
761000 -- (-1083.650) (-1076.037) [-1078.804] (-1085.315) * (-1078.669) (-1076.669) [-1076.876] (-1078.042) -- 0:00:46
761500 -- [-1079.331] (-1080.693) (-1081.328) (-1082.407) * (-1080.123) [-1078.905] (-1081.574) (-1091.880) -- 0:00:46
762000 -- (-1079.208) [-1077.345] (-1085.170) (-1085.203) * (-1074.990) (-1078.992) (-1078.203) [-1075.361] -- 0:00:46
762500 -- (-1079.988) (-1074.347) [-1078.680] (-1082.928) * (-1075.032) (-1088.377) [-1077.280] (-1078.149) -- 0:00:46
763000 -- (-1079.333) [-1074.727] (-1078.548) (-1080.278) * (-1080.932) (-1076.646) (-1086.558) [-1075.896] -- 0:00:46
763500 -- (-1079.139) (-1083.322) [-1074.843] (-1081.936) * (-1078.390) [-1080.197] (-1075.254) (-1075.673) -- 0:00:46
764000 -- (-1080.586) [-1074.582] (-1082.016) (-1080.654) * (-1078.666) (-1079.967) (-1077.949) [-1077.608] -- 0:00:46
764500 -- (-1079.038) (-1078.260) [-1075.349] (-1077.524) * (-1076.784) (-1073.866) (-1085.669) [-1076.487] -- 0:00:45
765000 -- (-1081.175) [-1079.789] (-1076.193) (-1080.884) * (-1080.399) [-1077.409] (-1081.751) (-1089.207) -- 0:00:45
Average standard deviation of split frequencies: 0.006400
765500 -- (-1079.206) [-1078.495] (-1077.506) (-1081.623) * [-1080.458] (-1078.729) (-1076.682) (-1083.313) -- 0:00:45
766000 -- (-1082.301) (-1077.623) (-1080.749) [-1077.294] * (-1089.135) (-1075.869) (-1077.285) [-1078.362] -- 0:00:45
766500 -- (-1081.151) [-1081.136] (-1078.763) (-1078.940) * (-1080.161) (-1078.368) [-1080.340] (-1076.268) -- 0:00:45
767000 -- (-1081.618) (-1077.796) [-1078.296] (-1082.298) * (-1079.370) (-1080.331) (-1080.829) [-1080.584] -- 0:00:45
767500 -- (-1079.206) (-1081.838) (-1074.857) [-1075.091] * (-1077.745) (-1079.011) (-1080.056) [-1076.665] -- 0:00:45
768000 -- [-1080.346] (-1087.545) (-1076.084) (-1075.387) * (-1075.540) [-1076.693] (-1079.319) (-1075.092) -- 0:00:45
768500 -- (-1081.850) [-1076.532] (-1076.081) (-1076.941) * [-1079.257] (-1077.372) (-1081.315) (-1080.455) -- 0:00:45
769000 -- [-1078.368] (-1076.829) (-1079.590) (-1088.305) * (-1081.681) (-1072.538) [-1078.097] (-1077.253) -- 0:00:45
769500 -- (-1091.158) [-1082.672] (-1075.350) (-1083.983) * [-1078.232] (-1078.879) (-1080.004) (-1079.673) -- 0:00:44
770000 -- [-1076.366] (-1078.888) (-1082.328) (-1081.154) * (-1081.326) [-1077.053] (-1080.473) (-1085.690) -- 0:00:44
Average standard deviation of split frequencies: 0.006362
770500 -- (-1080.857) [-1079.599] (-1078.622) (-1078.810) * [-1081.833] (-1077.459) (-1089.248) (-1077.528) -- 0:00:44
771000 -- (-1081.374) (-1085.000) (-1075.502) [-1080.701] * (-1087.326) (-1079.379) (-1077.746) [-1083.790] -- 0:00:44
771500 -- (-1084.399) (-1082.539) (-1075.402) [-1079.897] * (-1084.776) [-1080.629] (-1078.573) (-1078.718) -- 0:00:44
772000 -- (-1078.631) [-1082.156] (-1078.345) (-1078.262) * [-1079.507] (-1075.639) (-1080.875) (-1078.199) -- 0:00:44
772500 -- (-1077.085) [-1084.058] (-1081.834) (-1075.762) * (-1072.704) [-1074.833] (-1081.700) (-1080.053) -- 0:00:44
773000 -- (-1080.234) (-1083.805) [-1080.893] (-1083.548) * (-1080.729) (-1083.080) [-1078.325] (-1082.080) -- 0:00:44
773500 -- (-1080.472) (-1082.992) (-1082.373) [-1079.954] * [-1077.718] (-1076.300) (-1079.382) (-1079.149) -- 0:00:44
774000 -- (-1077.556) (-1082.283) (-1075.218) [-1079.878] * [-1081.620] (-1073.222) (-1077.878) (-1083.283) -- 0:00:44
774500 -- (-1078.526) (-1081.921) (-1082.394) [-1073.753] * (-1082.933) [-1076.076] (-1079.416) (-1075.571) -- 0:00:43
775000 -- (-1078.389) [-1076.376] (-1083.582) (-1085.865) * (-1077.640) (-1080.838) (-1080.367) [-1072.851] -- 0:00:43
Average standard deviation of split frequencies: 0.005346
775500 -- [-1076.963] (-1078.726) (-1080.899) (-1081.291) * (-1081.090) [-1087.619] (-1089.514) (-1076.977) -- 0:00:43
776000 -- (-1078.665) (-1075.307) (-1083.067) [-1076.822] * [-1080.234] (-1073.477) (-1087.946) (-1085.033) -- 0:00:43
776500 -- [-1079.828] (-1080.723) (-1075.092) (-1078.997) * (-1079.393) (-1079.269) [-1084.449] (-1076.623) -- 0:00:43
777000 -- (-1084.594) (-1076.835) [-1075.909] (-1077.369) * (-1076.021) [-1075.814] (-1080.654) (-1074.753) -- 0:00:43
777500 -- [-1077.380] (-1084.735) (-1077.549) (-1078.613) * [-1077.682] (-1083.659) (-1081.328) (-1083.184) -- 0:00:43
778000 -- [-1084.383] (-1079.112) (-1077.021) (-1085.601) * (-1081.669) (-1077.463) [-1077.767] (-1080.278) -- 0:00:43
778500 -- (-1077.480) (-1080.788) [-1076.306] (-1081.172) * (-1076.852) [-1080.207] (-1078.384) (-1076.766) -- 0:00:43
779000 -- (-1080.136) (-1076.363) (-1087.441) [-1077.366] * (-1078.723) [-1073.894] (-1075.171) (-1085.567) -- 0:00:43
779500 -- [-1090.286] (-1087.064) (-1083.513) (-1086.781) * [-1085.546] (-1078.115) (-1079.145) (-1093.849) -- 0:00:42
780000 -- (-1087.524) (-1076.899) [-1084.029] (-1076.731) * (-1087.672) (-1073.577) [-1074.718] (-1087.178) -- 0:00:42
Average standard deviation of split frequencies: 0.006038
780500 -- (-1079.333) (-1079.610) [-1077.603] (-1079.141) * (-1078.874) [-1078.691] (-1079.732) (-1080.339) -- 0:00:42
781000 -- (-1079.270) [-1079.743] (-1080.889) (-1082.334) * [-1075.017] (-1079.419) (-1085.715) (-1076.170) -- 0:00:42
781500 -- (-1084.241) [-1078.747] (-1078.352) (-1079.597) * (-1076.096) [-1073.278] (-1084.089) (-1083.443) -- 0:00:42
782000 -- (-1082.876) (-1078.459) [-1075.606] (-1081.141) * (-1080.567) [-1078.834] (-1079.597) (-1077.140) -- 0:00:42
782500 -- (-1081.664) (-1077.796) (-1075.133) [-1077.555] * (-1078.976) (-1077.586) (-1082.710) [-1074.886] -- 0:00:42
783000 -- [-1076.777] (-1081.542) (-1090.473) (-1077.103) * [-1077.761] (-1079.012) (-1077.482) (-1078.983) -- 0:00:42
783500 -- (-1080.890) (-1078.459) [-1077.785] (-1083.098) * (-1081.947) [-1079.722] (-1080.832) (-1074.928) -- 0:00:42
784000 -- [-1080.132] (-1076.806) (-1084.588) (-1080.841) * (-1077.062) [-1077.735] (-1081.695) (-1077.396) -- 0:00:42
784500 -- (-1082.666) (-1076.502) [-1077.948] (-1073.078) * [-1077.869] (-1079.615) (-1078.965) (-1074.821) -- 0:00:42
785000 -- [-1080.558] (-1077.661) (-1082.124) (-1084.145) * (-1078.220) (-1076.981) (-1081.402) [-1078.179] -- 0:00:41
Average standard deviation of split frequencies: 0.005998
785500 -- (-1081.492) (-1077.440) [-1078.637] (-1081.329) * [-1079.624] (-1076.751) (-1077.569) (-1073.564) -- 0:00:41
786000 -- [-1078.475] (-1076.328) (-1083.319) (-1086.985) * (-1075.591) [-1085.580] (-1079.985) (-1076.661) -- 0:00:41
786500 -- (-1078.679) [-1079.834] (-1084.588) (-1076.046) * (-1082.411) [-1080.756] (-1075.362) (-1080.038) -- 0:00:41
787000 -- (-1079.796) [-1077.678] (-1074.542) (-1079.546) * [-1078.023] (-1077.254) (-1076.713) (-1074.095) -- 0:00:41
787500 -- (-1084.006) [-1078.585] (-1080.265) (-1077.848) * (-1078.613) (-1076.452) (-1086.041) [-1079.582] -- 0:00:41
788000 -- [-1081.320] (-1076.132) (-1077.432) (-1083.562) * (-1076.223) [-1076.529] (-1078.536) (-1091.122) -- 0:00:41
788500 -- (-1087.318) (-1082.666) [-1079.466] (-1081.412) * (-1078.526) [-1078.841] (-1079.875) (-1077.319) -- 0:00:41
789000 -- (-1081.421) (-1076.502) (-1079.292) [-1075.283] * (-1080.721) (-1082.621) (-1080.340) [-1078.020] -- 0:00:41
789500 -- [-1078.189] (-1086.239) (-1078.919) (-1081.469) * (-1083.087) [-1078.597] (-1081.882) (-1076.303) -- 0:00:41
790000 -- [-1081.478] (-1083.777) (-1076.848) (-1089.524) * (-1084.817) (-1073.011) [-1086.232] (-1080.164) -- 0:00:40
Average standard deviation of split frequencies: 0.005724
790500 -- (-1080.050) (-1088.857) [-1076.318] (-1081.664) * [-1080.239] (-1079.784) (-1091.974) (-1079.799) -- 0:00:40
791000 -- [-1079.816] (-1077.054) (-1080.087) (-1080.805) * (-1078.541) (-1082.808) (-1084.804) [-1077.430] -- 0:00:40
791500 -- (-1076.949) [-1084.699] (-1078.992) (-1084.252) * (-1082.525) (-1081.723) (-1077.870) [-1074.909] -- 0:00:40
792000 -- (-1081.873) (-1080.757) (-1077.811) [-1074.627] * (-1076.526) (-1080.740) [-1077.437] (-1075.921) -- 0:00:40
792500 -- (-1082.710) (-1083.732) (-1075.597) [-1081.899] * [-1077.544] (-1079.858) (-1080.828) (-1076.483) -- 0:00:40
793000 -- [-1084.204] (-1079.906) (-1087.902) (-1078.809) * [-1082.425] (-1083.941) (-1079.008) (-1075.642) -- 0:00:40
793500 -- (-1081.125) [-1081.581] (-1077.066) (-1087.335) * (-1079.473) (-1087.479) [-1079.623] (-1083.097) -- 0:00:40
794000 -- (-1074.081) (-1084.717) (-1075.896) [-1075.442] * (-1082.635) (-1081.686) [-1081.430] (-1076.075) -- 0:00:40
794500 -- (-1078.714) (-1083.326) [-1076.349] (-1085.562) * (-1081.264) [-1080.971] (-1078.172) (-1081.562) -- 0:00:40
795000 -- [-1079.485] (-1081.319) (-1079.764) (-1077.720) * [-1082.034] (-1081.400) (-1083.621) (-1084.243) -- 0:00:39
Average standard deviation of split frequencies: 0.005685
795500 -- (-1078.907) (-1082.942) (-1083.811) [-1079.800] * (-1079.672) (-1078.022) (-1084.678) [-1086.228] -- 0:00:39
796000 -- [-1077.802] (-1095.693) (-1078.286) (-1078.687) * (-1077.682) (-1080.326) [-1082.323] (-1080.890) -- 0:00:39
796500 -- [-1077.161] (-1091.964) (-1084.658) (-1074.067) * (-1079.925) [-1082.020] (-1078.023) (-1080.737) -- 0:00:39
797000 -- [-1075.893] (-1085.965) (-1079.333) (-1077.567) * (-1081.023) (-1080.852) [-1076.619] (-1078.741) -- 0:00:39
797500 -- (-1074.762) (-1089.766) (-1082.025) [-1076.001] * (-1088.657) (-1082.914) [-1080.695] (-1081.007) -- 0:00:39
798000 -- [-1080.230] (-1091.548) (-1077.245) (-1081.565) * [-1079.389] (-1076.626) (-1079.138) (-1081.727) -- 0:00:39
798500 -- [-1081.104] (-1085.285) (-1082.719) (-1079.542) * (-1082.066) [-1079.528] (-1075.105) (-1077.431) -- 0:00:39
799000 -- [-1080.765] (-1085.085) (-1085.819) (-1075.404) * [-1075.496] (-1079.604) (-1083.542) (-1074.877) -- 0:00:39
799500 -- (-1084.493) (-1078.044) (-1084.040) [-1076.781] * (-1074.432) (-1077.252) [-1076.429] (-1077.786) -- 0:00:39
800000 -- (-1076.291) [-1078.978] (-1080.350) (-1078.098) * (-1074.633) (-1080.888) [-1081.021] (-1083.768) -- 0:00:39
Average standard deviation of split frequencies: 0.005417
800500 -- (-1082.855) [-1077.299] (-1076.446) (-1084.202) * (-1086.483) [-1081.087] (-1078.951) (-1084.500) -- 0:00:38
801000 -- [-1075.091] (-1074.404) (-1081.954) (-1076.550) * [-1079.155] (-1080.212) (-1076.748) (-1084.936) -- 0:00:38
801500 -- (-1081.776) [-1075.509] (-1077.651) (-1082.561) * (-1081.670) [-1080.877] (-1080.844) (-1079.964) -- 0:00:38
802000 -- (-1081.891) (-1076.644) [-1081.982] (-1078.181) * (-1085.680) (-1077.805) [-1075.607] (-1080.847) -- 0:00:38
802500 -- (-1073.372) [-1077.385] (-1078.113) (-1084.953) * (-1082.773) (-1074.694) (-1079.739) [-1080.474] -- 0:00:38
803000 -- [-1077.127] (-1079.058) (-1077.430) (-1081.423) * (-1079.142) [-1082.848] (-1079.581) (-1091.522) -- 0:00:38
803500 -- (-1078.460) [-1076.016] (-1084.578) (-1079.044) * (-1076.400) (-1082.033) [-1080.171] (-1084.359) -- 0:00:38
804000 -- (-1080.110) (-1078.300) [-1080.660] (-1078.955) * (-1083.105) (-1077.754) (-1078.251) [-1083.689] -- 0:00:38
804500 -- (-1078.157) (-1082.414) [-1078.849] (-1079.736) * (-1080.524) (-1081.000) [-1083.029] (-1082.813) -- 0:00:38
805000 -- [-1075.505] (-1077.087) (-1078.545) (-1085.211) * (-1081.371) [-1082.832] (-1077.141) (-1082.001) -- 0:00:38
Average standard deviation of split frequencies: 0.004211
805500 -- [-1078.019] (-1077.255) (-1078.275) (-1076.597) * (-1079.865) (-1082.381) [-1074.940] (-1083.690) -- 0:00:37
806000 -- (-1075.981) (-1074.797) [-1080.680] (-1082.566) * (-1074.945) [-1084.718] (-1077.394) (-1079.520) -- 0:00:37
806500 -- [-1079.350] (-1090.189) (-1082.413) (-1079.380) * [-1079.927] (-1077.226) (-1077.688) (-1085.844) -- 0:00:37
807000 -- (-1075.336) (-1080.522) [-1078.005] (-1077.288) * (-1087.024) [-1079.911] (-1082.075) (-1080.172) -- 0:00:37
807500 -- (-1078.272) (-1083.969) (-1080.638) [-1075.138] * (-1086.035) (-1074.527) [-1076.026] (-1082.466) -- 0:00:37
808000 -- [-1077.954] (-1086.472) (-1078.568) (-1076.435) * (-1082.373) (-1079.625) [-1072.609] (-1078.590) -- 0:00:37
808500 -- (-1083.300) (-1100.169) [-1075.770] (-1080.940) * [-1079.502] (-1077.279) (-1077.517) (-1077.825) -- 0:00:37
809000 -- [-1076.812] (-1075.362) (-1078.844) (-1077.853) * (-1081.354) (-1076.007) (-1079.877) [-1079.566] -- 0:00:37
809500 -- (-1084.443) (-1077.774) (-1079.469) [-1078.972] * (-1075.622) (-1077.509) [-1074.286] (-1086.632) -- 0:00:37
810000 -- (-1089.962) [-1078.199] (-1079.449) (-1081.655) * (-1082.619) [-1078.058] (-1079.396) (-1083.004) -- 0:00:37
Average standard deviation of split frequencies: 0.004885
810500 -- (-1081.654) (-1080.139) [-1073.668] (-1083.033) * [-1077.454] (-1073.981) (-1083.231) (-1078.386) -- 0:00:36
811000 -- (-1080.066) (-1079.877) [-1075.812] (-1090.361) * (-1083.496) (-1085.856) (-1080.175) [-1078.717] -- 0:00:36
811500 -- (-1076.141) (-1075.772) [-1079.098] (-1083.523) * (-1083.885) (-1079.399) (-1085.667) [-1082.899] -- 0:00:36
812000 -- (-1079.530) (-1078.208) (-1081.161) [-1079.375] * (-1084.343) (-1078.619) [-1080.986] (-1076.607) -- 0:00:36
812500 -- (-1078.519) (-1086.075) [-1084.304] (-1081.079) * [-1075.098] (-1077.109) (-1083.040) (-1081.037) -- 0:00:36
813000 -- [-1078.237] (-1075.785) (-1079.435) (-1082.979) * (-1087.274) [-1078.549] (-1077.056) (-1080.787) -- 0:00:36
813500 -- (-1075.402) [-1073.542] (-1076.867) (-1078.538) * (-1080.290) (-1079.073) [-1082.741] (-1078.058) -- 0:00:36
814000 -- (-1078.789) (-1082.211) [-1080.390] (-1076.849) * (-1077.363) (-1077.466) (-1081.923) [-1074.038] -- 0:00:36
814500 -- (-1080.316) (-1085.432) [-1078.157] (-1086.413) * (-1078.331) [-1084.738] (-1079.887) (-1080.034) -- 0:00:36
815000 -- (-1077.575) [-1078.535] (-1081.969) (-1075.272) * (-1073.544) [-1082.497] (-1077.200) (-1087.340) -- 0:00:36
Average standard deviation of split frequencies: 0.006008
815500 -- (-1077.271) [-1078.116] (-1079.834) (-1082.487) * (-1081.623) (-1076.198) [-1074.805] (-1086.507) -- 0:00:35
816000 -- (-1088.021) (-1078.193) [-1078.490] (-1076.225) * (-1076.712) [-1083.280] (-1080.207) (-1083.438) -- 0:00:35
816500 -- (-1082.672) (-1077.323) (-1079.636) [-1074.936] * [-1074.421] (-1075.935) (-1075.070) (-1083.400) -- 0:00:35
817000 -- (-1086.320) [-1078.051] (-1082.197) (-1081.633) * (-1083.609) [-1076.619] (-1079.321) (-1078.351) -- 0:00:35
817500 -- (-1088.247) (-1080.886) (-1079.788) [-1076.361] * (-1083.325) (-1077.462) (-1082.321) [-1079.091] -- 0:00:35
818000 -- (-1082.517) [-1082.294] (-1075.544) (-1075.997) * (-1086.042) (-1080.774) [-1078.249] (-1075.255) -- 0:00:35
818500 -- [-1080.681] (-1082.195) (-1080.720) (-1081.076) * (-1080.368) (-1089.919) (-1079.550) [-1078.058] -- 0:00:35
819000 -- [-1079.483] (-1088.278) (-1079.489) (-1087.443) * [-1079.869] (-1079.437) (-1077.744) (-1076.033) -- 0:00:35
819500 -- (-1092.527) (-1081.201) (-1074.609) [-1085.167] * (-1075.198) [-1074.728] (-1077.854) (-1085.586) -- 0:00:35
820000 -- (-1083.760) (-1091.090) [-1081.081] (-1080.219) * (-1075.108) [-1076.259] (-1080.250) (-1083.204) -- 0:00:35
Average standard deviation of split frequencies: 0.005285
820500 -- (-1077.647) (-1085.557) (-1085.818) [-1082.838] * [-1083.068] (-1079.503) (-1077.800) (-1084.429) -- 0:00:35
821000 -- (-1080.098) (-1086.985) [-1077.331] (-1079.483) * [-1077.202] (-1076.091) (-1081.534) (-1076.171) -- 0:00:34
821500 -- (-1073.516) (-1084.015) (-1080.846) [-1077.547] * (-1075.105) [-1076.006] (-1080.479) (-1081.253) -- 0:00:34
822000 -- (-1081.353) (-1073.866) (-1080.822) [-1072.668] * (-1087.921) (-1082.347) [-1074.252] (-1082.084) -- 0:00:34
822500 -- (-1082.085) (-1081.536) (-1079.007) [-1074.898] * (-1077.076) (-1082.413) [-1074.005] (-1081.578) -- 0:00:34
823000 -- (-1077.818) (-1083.007) (-1074.776) [-1075.580] * (-1082.664) [-1077.265] (-1074.137) (-1079.155) -- 0:00:34
823500 -- (-1079.081) [-1079.753] (-1078.790) (-1078.320) * (-1077.067) [-1078.228] (-1078.417) (-1075.879) -- 0:00:34
824000 -- (-1083.607) [-1080.353] (-1079.861) (-1078.841) * (-1084.495) [-1076.342] (-1091.064) (-1087.754) -- 0:00:34
824500 -- (-1080.035) (-1075.649) (-1079.824) [-1077.165] * (-1078.561) (-1079.304) [-1082.019] (-1092.709) -- 0:00:34
825000 -- (-1080.044) (-1080.304) [-1081.576] (-1073.547) * [-1083.441] (-1082.769) (-1079.875) (-1090.561) -- 0:00:34
Average standard deviation of split frequencies: 0.006620
825500 -- (-1078.986) [-1076.333] (-1079.413) (-1087.831) * (-1074.049) [-1077.555] (-1080.320) (-1080.886) -- 0:00:34
826000 -- (-1080.749) (-1079.801) (-1089.428) [-1082.491] * [-1080.827] (-1077.603) (-1079.193) (-1078.975) -- 0:00:33
826500 -- (-1083.499) (-1081.034) [-1086.150] (-1086.222) * (-1078.774) (-1079.631) (-1074.537) [-1078.938] -- 0:00:33
827000 -- (-1075.739) (-1081.973) [-1081.682] (-1077.197) * (-1076.149) [-1079.720] (-1075.631) (-1079.957) -- 0:00:33
827500 -- (-1077.133) [-1087.116] (-1085.737) (-1071.772) * [-1076.371] (-1081.227) (-1078.872) (-1082.630) -- 0:00:33
828000 -- (-1081.549) (-1089.122) [-1081.318] (-1079.231) * [-1081.269] (-1077.854) (-1081.677) (-1076.720) -- 0:00:33
828500 -- (-1084.793) (-1077.478) [-1076.282] (-1085.706) * [-1084.754] (-1078.334) (-1078.139) (-1078.439) -- 0:00:33
829000 -- (-1075.755) (-1081.413) (-1079.941) [-1079.464] * (-1086.463) (-1074.131) (-1082.459) [-1080.016] -- 0:00:33
829500 -- (-1081.108) (-1078.038) (-1078.582) [-1075.067] * [-1083.355] (-1081.648) (-1079.285) (-1076.915) -- 0:00:33
830000 -- (-1077.481) [-1074.525] (-1082.685) (-1077.723) * [-1080.626] (-1089.243) (-1083.368) (-1078.565) -- 0:00:33
Average standard deviation of split frequencies: 0.006810
830500 -- (-1081.496) (-1085.244) [-1082.747] (-1080.382) * (-1083.868) (-1079.347) (-1082.559) [-1075.466] -- 0:00:33
831000 -- (-1084.086) (-1085.208) [-1082.597] (-1089.231) * (-1079.846) [-1084.714] (-1082.764) (-1075.530) -- 0:00:32
831500 -- (-1080.033) (-1089.979) [-1076.158] (-1081.330) * (-1076.179) (-1080.731) (-1075.412) [-1080.669] -- 0:00:32
832000 -- (-1078.310) [-1082.109] (-1084.199) (-1082.643) * (-1077.479) [-1079.682] (-1087.783) (-1081.673) -- 0:00:32
832500 -- (-1083.169) [-1075.418] (-1082.078) (-1080.962) * (-1084.622) (-1077.838) (-1080.253) [-1082.590] -- 0:00:32
833000 -- (-1080.687) [-1077.177] (-1075.163) (-1080.581) * (-1084.747) (-1077.436) (-1078.401) [-1073.669] -- 0:00:32
833500 -- (-1091.000) [-1082.371] (-1081.139) (-1083.560) * [-1080.102] (-1076.654) (-1080.769) (-1078.122) -- 0:00:32
834000 -- (-1085.664) (-1083.922) [-1086.746] (-1077.616) * (-1077.990) (-1080.350) [-1077.595] (-1085.421) -- 0:00:32
834500 -- (-1081.654) (-1077.042) [-1078.257] (-1085.466) * (-1080.147) [-1076.448] (-1076.791) (-1080.491) -- 0:00:32
835000 -- (-1084.248) (-1082.925) [-1078.641] (-1081.759) * [-1076.373] (-1077.559) (-1080.861) (-1075.343) -- 0:00:32
Average standard deviation of split frequencies: 0.005639
835500 -- (-1075.989) (-1085.910) [-1078.949] (-1082.349) * (-1081.626) (-1082.091) [-1084.969] (-1084.607) -- 0:00:32
836000 -- (-1076.861) (-1076.921) [-1078.742] (-1081.002) * (-1075.194) (-1076.842) (-1082.317) [-1078.679] -- 0:00:31
836500 -- (-1077.280) (-1076.095) [-1077.530] (-1075.067) * (-1077.654) [-1075.981] (-1078.590) (-1084.909) -- 0:00:31
837000 -- (-1081.366) (-1081.922) [-1077.776] (-1079.601) * (-1087.414) (-1079.772) [-1075.595] (-1076.922) -- 0:00:31
837500 -- (-1079.839) (-1081.056) [-1081.708] (-1075.700) * (-1075.327) (-1082.303) (-1077.396) [-1078.924] -- 0:00:31
838000 -- (-1076.021) (-1080.978) (-1075.784) [-1078.359] * (-1082.482) (-1083.272) (-1078.984) [-1082.020] -- 0:00:31
838500 -- (-1076.267) (-1081.178) [-1079.802] (-1078.446) * [-1077.438] (-1080.394) (-1079.005) (-1082.185) -- 0:00:31
839000 -- (-1074.716) (-1080.375) (-1079.248) [-1085.944] * [-1079.323] (-1079.818) (-1077.093) (-1079.937) -- 0:00:31
839500 -- (-1078.888) (-1079.773) [-1081.206] (-1079.896) * (-1081.378) (-1080.124) [-1080.468] (-1082.742) -- 0:00:31
840000 -- (-1087.098) [-1077.984] (-1083.854) (-1081.332) * (-1080.618) (-1080.876) (-1079.423) [-1084.787] -- 0:00:31
Average standard deviation of split frequencies: 0.005383
840500 -- (-1085.213) (-1077.129) [-1081.493] (-1075.890) * [-1081.266] (-1082.166) (-1072.695) (-1083.729) -- 0:00:31
841000 -- [-1082.326] (-1079.559) (-1080.655) (-1077.348) * (-1083.282) (-1080.226) (-1077.153) [-1076.405] -- 0:00:31
841500 -- (-1079.937) [-1079.547] (-1076.553) (-1077.928) * (-1080.366) [-1079.305] (-1079.919) (-1078.008) -- 0:00:30
842000 -- (-1082.587) [-1082.984] (-1077.388) (-1081.875) * (-1085.202) (-1078.108) (-1091.107) [-1079.467] -- 0:00:30
842500 -- (-1087.281) (-1079.226) [-1081.033] (-1072.659) * (-1074.735) [-1077.991] (-1081.119) (-1081.068) -- 0:00:30
843000 -- (-1080.312) (-1083.597) (-1083.024) [-1074.557] * (-1075.844) (-1076.837) [-1081.731] (-1082.669) -- 0:00:30
843500 -- (-1082.936) (-1077.251) [-1080.167] (-1077.718) * (-1078.668) (-1079.569) (-1079.306) [-1080.259] -- 0:00:30
844000 -- (-1082.851) (-1084.532) [-1073.002] (-1075.754) * [-1073.066] (-1079.010) (-1085.125) (-1082.247) -- 0:00:30
844500 -- (-1082.059) (-1079.395) (-1078.627) [-1072.387] * (-1075.603) (-1078.754) [-1077.332] (-1083.539) -- 0:00:30
845000 -- [-1074.516] (-1074.411) (-1082.774) (-1076.870) * (-1079.777) (-1082.750) [-1079.968] (-1085.780) -- 0:00:30
Average standard deviation of split frequencies: 0.005349
845500 -- (-1079.294) (-1080.871) (-1081.508) [-1070.489] * (-1085.525) (-1079.283) [-1075.481] (-1080.610) -- 0:00:30
846000 -- (-1075.396) (-1086.263) (-1080.425) [-1077.480] * (-1082.380) (-1077.371) (-1084.252) [-1077.303] -- 0:00:30
846500 -- (-1080.224) (-1083.762) (-1085.702) [-1078.753] * (-1075.360) (-1077.432) [-1082.366] (-1084.032) -- 0:00:29
847000 -- [-1083.878] (-1081.459) (-1083.090) (-1080.620) * (-1077.628) [-1079.775] (-1075.502) (-1088.445) -- 0:00:29
847500 -- [-1084.850] (-1084.062) (-1075.561) (-1075.292) * (-1082.100) [-1077.354] (-1079.225) (-1083.077) -- 0:00:29
848000 -- [-1079.038] (-1087.868) (-1079.695) (-1081.601) * (-1078.130) (-1076.445) (-1076.021) [-1095.380] -- 0:00:29
848500 -- (-1082.285) (-1083.304) (-1076.092) [-1078.108] * [-1075.510] (-1075.208) (-1079.676) (-1096.508) -- 0:00:29
849000 -- (-1089.955) (-1082.385) (-1084.271) [-1076.723] * (-1081.114) (-1083.145) [-1076.849] (-1077.634) -- 0:00:29
849500 -- (-1079.569) (-1088.671) (-1078.787) [-1082.548] * (-1077.143) (-1082.158) [-1080.596] (-1080.347) -- 0:00:29
850000 -- (-1079.791) (-1077.125) [-1080.017] (-1081.307) * (-1081.171) (-1080.894) (-1078.339) [-1080.564] -- 0:00:29
Average standard deviation of split frequencies: 0.005320
850500 -- (-1078.631) [-1078.112] (-1085.838) (-1079.948) * (-1085.495) [-1084.200] (-1078.033) (-1082.799) -- 0:00:29
851000 -- (-1093.493) (-1078.615) [-1084.551] (-1076.136) * (-1077.950) (-1081.571) [-1079.073] (-1075.791) -- 0:00:29
851500 -- (-1080.784) (-1085.552) [-1078.918] (-1076.377) * (-1081.569) (-1079.473) (-1079.617) [-1077.286] -- 0:00:28
852000 -- [-1084.502] (-1082.910) (-1090.044) (-1078.416) * [-1073.903] (-1083.239) (-1081.876) (-1079.010) -- 0:00:28
852500 -- [-1081.021] (-1075.734) (-1084.933) (-1077.995) * [-1082.172] (-1080.315) (-1084.293) (-1077.324) -- 0:00:28
853000 -- (-1091.706) (-1079.211) [-1076.995] (-1076.411) * (-1083.208) (-1083.698) [-1078.002] (-1082.454) -- 0:00:28
853500 -- [-1079.000] (-1079.730) (-1078.636) (-1077.528) * [-1077.625] (-1083.185) (-1088.968) (-1078.608) -- 0:00:28
854000 -- (-1075.847) (-1079.882) [-1075.223] (-1084.534) * (-1078.757) (-1081.686) [-1083.168] (-1080.503) -- 0:00:28
854500 -- (-1076.508) [-1079.173] (-1078.967) (-1081.608) * (-1077.927) (-1078.410) [-1075.665] (-1081.275) -- 0:00:28
855000 -- (-1080.340) [-1083.643] (-1078.920) (-1078.442) * (-1077.082) (-1082.306) [-1076.807] (-1088.565) -- 0:00:28
Average standard deviation of split frequencies: 0.005287
855500 -- (-1076.530) [-1073.041] (-1082.967) (-1082.983) * (-1077.463) [-1076.950] (-1086.821) (-1083.549) -- 0:00:28
856000 -- (-1080.200) [-1074.490] (-1081.459) (-1089.772) * (-1077.347) [-1078.507] (-1074.365) (-1089.786) -- 0:00:28
856500 -- (-1078.159) [-1075.915] (-1078.663) (-1085.427) * [-1078.056] (-1080.579) (-1079.189) (-1084.126) -- 0:00:27
857000 -- [-1077.241] (-1074.706) (-1083.112) (-1083.953) * (-1086.001) [-1078.221] (-1075.554) (-1090.092) -- 0:00:27
857500 -- (-1077.305) [-1081.281] (-1086.787) (-1080.848) * [-1083.927] (-1076.146) (-1084.515) (-1085.310) -- 0:00:27
858000 -- (-1077.859) [-1083.953] (-1082.921) (-1077.919) * (-1085.640) [-1082.535] (-1088.177) (-1084.858) -- 0:00:27
858500 -- (-1088.468) [-1077.268] (-1077.036) (-1088.581) * (-1079.759) [-1079.753] (-1086.552) (-1080.474) -- 0:00:27
859000 -- [-1085.751] (-1081.869) (-1081.018) (-1075.375) * (-1081.162) [-1075.982] (-1090.552) (-1078.894) -- 0:00:27
859500 -- (-1075.964) [-1076.359] (-1080.215) (-1075.810) * (-1076.965) (-1086.479) [-1077.501] (-1079.571) -- 0:00:27
860000 -- (-1076.995) [-1080.545] (-1082.065) (-1080.206) * (-1078.717) [-1081.790] (-1081.265) (-1075.114) -- 0:00:27
Average standard deviation of split frequencies: 0.005696
860500 -- [-1084.598] (-1081.075) (-1082.892) (-1082.221) * (-1080.604) (-1078.221) (-1086.384) [-1082.754] -- 0:00:27
861000 -- (-1088.598) (-1085.006) (-1083.922) [-1075.373] * (-1081.524) (-1080.680) (-1077.537) [-1079.058] -- 0:00:27
861500 -- (-1078.546) (-1075.567) (-1079.200) [-1078.939] * [-1075.696] (-1081.134) (-1081.208) (-1084.957) -- 0:00:27
862000 -- [-1081.961] (-1084.324) (-1079.564) (-1081.615) * [-1076.738] (-1080.229) (-1077.365) (-1079.346) -- 0:00:26
862500 -- (-1079.664) (-1084.322) [-1080.696] (-1089.482) * (-1082.341) (-1084.081) [-1075.766] (-1082.562) -- 0:00:26
863000 -- (-1074.856) [-1079.554] (-1076.546) (-1088.305) * (-1097.113) [-1079.247] (-1084.049) (-1085.070) -- 0:00:26
863500 -- [-1076.417] (-1082.476) (-1080.783) (-1078.520) * (-1083.412) (-1077.865) [-1084.851] (-1075.064) -- 0:00:26
864000 -- (-1079.766) [-1079.560] (-1089.602) (-1083.652) * (-1078.349) (-1087.444) [-1079.197] (-1078.303) -- 0:00:26
864500 -- (-1082.464) [-1078.671] (-1076.363) (-1080.959) * (-1083.041) (-1083.165) (-1075.727) [-1080.474] -- 0:00:26
865000 -- [-1078.861] (-1084.521) (-1078.952) (-1078.454) * [-1077.564] (-1075.744) (-1074.822) (-1078.468) -- 0:00:26
Average standard deviation of split frequencies: 0.005226
865500 -- (-1078.219) [-1075.646] (-1088.796) (-1081.660) * (-1079.594) (-1074.355) [-1078.823] (-1074.590) -- 0:00:26
866000 -- (-1083.934) (-1075.133) [-1075.675] (-1078.583) * (-1080.698) (-1077.647) (-1078.558) [-1080.580] -- 0:00:26
866500 -- (-1080.481) (-1093.693) [-1078.331] (-1083.750) * [-1080.713] (-1079.453) (-1082.549) (-1077.504) -- 0:00:26
867000 -- (-1085.928) (-1076.235) [-1083.138] (-1088.630) * (-1086.647) (-1074.885) [-1076.470] (-1083.208) -- 0:00:25
867500 -- (-1084.104) (-1082.126) [-1078.908] (-1086.617) * (-1087.695) [-1075.730] (-1082.123) (-1081.206) -- 0:00:25
868000 -- (-1085.757) (-1075.731) [-1083.352] (-1085.684) * [-1077.740] (-1076.616) (-1083.777) (-1081.018) -- 0:00:25
868500 -- [-1081.019] (-1080.395) (-1079.640) (-1082.321) * [-1079.815] (-1081.601) (-1080.780) (-1075.007) -- 0:00:25
869000 -- (-1078.333) [-1082.777] (-1079.043) (-1085.371) * (-1086.454) [-1080.840] (-1081.011) (-1084.437) -- 0:00:25
869500 -- (-1093.339) [-1072.996] (-1074.454) (-1082.079) * (-1082.098) (-1081.208) (-1081.243) [-1078.573] -- 0:00:25
870000 -- (-1080.601) [-1073.337] (-1075.903) (-1083.103) * (-1086.565) (-1081.703) [-1080.288] (-1076.283) -- 0:00:25
Average standard deviation of split frequencies: 0.005631
870500 -- (-1081.261) [-1075.774] (-1076.747) (-1083.419) * (-1078.604) (-1080.621) [-1079.221] (-1080.320) -- 0:00:25
871000 -- (-1081.979) [-1082.299] (-1075.257) (-1080.259) * (-1080.025) [-1074.969] (-1081.671) (-1085.502) -- 0:00:25
871500 -- (-1082.546) [-1078.774] (-1084.096) (-1081.895) * (-1089.018) (-1074.300) [-1077.807] (-1079.608) -- 0:00:25
872000 -- (-1079.298) (-1081.947) (-1077.211) [-1080.884] * (-1091.859) (-1080.272) [-1076.803] (-1082.132) -- 0:00:24
872500 -- [-1075.236] (-1082.142) (-1082.951) (-1074.637) * [-1081.630] (-1084.895) (-1082.447) (-1075.771) -- 0:00:24
873000 -- [-1075.762] (-1072.926) (-1077.484) (-1075.623) * (-1077.474) [-1079.118] (-1077.891) (-1081.419) -- 0:00:24
873500 -- (-1078.629) [-1078.962] (-1082.135) (-1079.159) * [-1080.317] (-1075.071) (-1076.329) (-1083.103) -- 0:00:24
874000 -- (-1078.424) (-1075.662) (-1090.499) [-1077.158] * [-1075.436] (-1082.304) (-1083.633) (-1079.803) -- 0:00:24
874500 -- [-1074.437] (-1079.571) (-1075.094) (-1083.577) * (-1074.175) (-1073.712) (-1080.210) [-1078.787] -- 0:00:24
875000 -- [-1076.979] (-1083.759) (-1080.292) (-1090.870) * (-1075.532) (-1076.429) (-1084.396) [-1073.433] -- 0:00:24
Average standard deviation of split frequencies: 0.004951
875500 -- [-1079.783] (-1077.424) (-1086.352) (-1081.472) * (-1081.841) [-1074.494] (-1088.272) (-1077.931) -- 0:00:24
876000 -- (-1079.935) (-1080.477) (-1077.489) [-1075.524] * [-1078.483] (-1080.496) (-1083.873) (-1081.381) -- 0:00:24
876500 -- [-1084.819] (-1082.130) (-1083.380) (-1076.220) * [-1077.549] (-1076.618) (-1075.126) (-1080.552) -- 0:00:24
877000 -- (-1076.008) (-1078.234) (-1082.653) [-1076.990] * (-1075.259) [-1077.264] (-1085.225) (-1077.560) -- 0:00:23
877500 -- (-1089.740) (-1075.988) (-1078.375) [-1081.094] * (-1077.003) [-1077.532] (-1086.186) (-1076.545) -- 0:00:23
878000 -- (-1081.800) (-1077.331) (-1078.539) [-1080.505] * (-1081.295) [-1075.010] (-1081.295) (-1083.051) -- 0:00:23
878500 -- (-1085.000) [-1080.555] (-1078.385) (-1080.501) * (-1075.295) (-1083.901) [-1080.377] (-1084.314) -- 0:00:23
879000 -- (-1083.102) [-1079.639] (-1086.155) (-1082.387) * (-1079.132) (-1083.679) (-1083.685) [-1080.229] -- 0:00:23
879500 -- (-1083.185) (-1078.951) [-1083.741] (-1087.281) * (-1077.365) [-1078.941] (-1084.401) (-1080.724) -- 0:00:23
880000 -- [-1077.815] (-1086.216) (-1081.059) (-1083.485) * (-1075.693) [-1079.056] (-1081.496) (-1078.688) -- 0:00:23
Average standard deviation of split frequencies: 0.005353
880500 -- (-1082.727) [-1075.354] (-1083.724) (-1074.148) * (-1077.416) (-1077.706) (-1080.901) [-1079.584] -- 0:00:23
881000 -- (-1089.017) [-1078.324] (-1079.830) (-1080.878) * (-1082.176) [-1078.285] (-1078.177) (-1084.739) -- 0:00:23
881500 -- (-1084.224) (-1082.269) [-1081.562] (-1080.254) * (-1081.371) [-1077.277] (-1083.738) (-1082.836) -- 0:00:23
882000 -- (-1083.951) [-1073.492] (-1083.493) (-1081.213) * (-1085.495) [-1076.322] (-1077.509) (-1078.279) -- 0:00:23
882500 -- (-1079.184) (-1080.160) (-1082.057) [-1078.375] * (-1080.769) [-1078.703] (-1078.567) (-1077.219) -- 0:00:22
883000 -- (-1084.132) (-1081.001) (-1084.729) [-1073.462] * (-1077.818) [-1076.865] (-1078.797) (-1075.476) -- 0:00:22
883500 -- (-1083.396) (-1074.100) (-1078.942) [-1075.462] * (-1076.387) (-1075.999) [-1078.593] (-1079.447) -- 0:00:22
884000 -- [-1079.321] (-1083.913) (-1084.073) (-1079.359) * (-1085.878) [-1077.896] (-1086.221) (-1076.590) -- 0:00:22
884500 -- (-1079.024) (-1082.093) (-1083.396) [-1081.567] * [-1076.985] (-1077.991) (-1076.174) (-1079.567) -- 0:00:22
885000 -- (-1079.760) [-1077.805] (-1079.385) (-1074.068) * [-1085.180] (-1080.726) (-1079.700) (-1085.629) -- 0:00:22
Average standard deviation of split frequencies: 0.005533
885500 -- (-1081.285) (-1081.987) [-1073.382] (-1077.100) * [-1084.721] (-1076.323) (-1075.874) (-1077.328) -- 0:00:22
886000 -- (-1085.043) (-1080.050) [-1077.752] (-1082.539) * (-1081.133) (-1080.779) [-1082.689] (-1076.876) -- 0:00:22
886500 -- (-1080.515) (-1074.449) (-1083.958) [-1081.663] * (-1087.785) (-1078.716) [-1074.244] (-1078.477) -- 0:00:22
887000 -- [-1082.009] (-1077.402) (-1080.560) (-1084.367) * (-1079.510) [-1074.137] (-1082.569) (-1087.203) -- 0:00:22
887500 -- (-1090.004) (-1077.644) [-1077.255] (-1083.146) * [-1080.421] (-1075.719) (-1078.859) (-1075.263) -- 0:00:21
888000 -- (-1080.620) (-1077.800) (-1080.512) [-1086.086] * (-1080.686) [-1078.769] (-1077.258) (-1081.050) -- 0:00:21
888500 -- [-1074.537] (-1086.465) (-1083.261) (-1090.957) * (-1077.636) (-1088.144) [-1078.694] (-1078.653) -- 0:00:21
889000 -- [-1080.791] (-1082.993) (-1085.036) (-1078.654) * (-1078.954) (-1084.977) (-1081.909) [-1081.969] -- 0:00:21
889500 -- [-1073.717] (-1080.212) (-1091.428) (-1082.280) * (-1087.482) (-1088.758) (-1081.275) [-1076.067] -- 0:00:21
890000 -- (-1082.838) (-1082.198) (-1089.873) [-1076.130] * [-1079.880] (-1084.344) (-1083.685) (-1081.529) -- 0:00:21
Average standard deviation of split frequencies: 0.005928
890500 -- (-1077.052) [-1084.458] (-1079.605) (-1079.388) * (-1081.581) (-1094.276) [-1077.117] (-1082.457) -- 0:00:21
891000 -- (-1078.220) (-1072.739) (-1079.173) [-1078.190] * (-1083.108) [-1077.636] (-1080.031) (-1082.180) -- 0:00:21
891500 -- (-1075.713) [-1077.296] (-1080.885) (-1079.833) * (-1075.635) (-1079.055) [-1074.192] (-1079.012) -- 0:00:21
892000 -- (-1079.634) (-1086.093) [-1078.637] (-1079.064) * (-1080.469) (-1080.867) [-1077.715] (-1075.964) -- 0:00:21
892500 -- (-1082.005) (-1087.809) [-1080.625] (-1079.185) * [-1076.775] (-1076.663) (-1078.793) (-1084.880) -- 0:00:20
893000 -- (-1075.804) (-1087.625) [-1078.871] (-1081.266) * (-1082.691) [-1077.226] (-1077.800) (-1077.822) -- 0:00:20
893500 -- [-1080.074] (-1084.821) (-1078.870) (-1073.958) * (-1081.042) [-1077.293] (-1078.678) (-1081.451) -- 0:00:20
894000 -- (-1080.765) [-1076.229] (-1082.457) (-1081.268) * (-1084.278) (-1076.984) [-1080.616] (-1078.381) -- 0:00:20
894500 -- [-1076.655] (-1075.923) (-1080.794) (-1075.472) * (-1081.065) [-1081.225] (-1081.298) (-1081.306) -- 0:00:20
895000 -- (-1074.958) [-1081.226] (-1085.925) (-1074.193) * (-1085.939) [-1078.713] (-1088.513) (-1073.341) -- 0:00:20
Average standard deviation of split frequencies: 0.006313
895500 -- (-1081.343) (-1079.006) (-1076.789) [-1081.173] * (-1079.725) (-1078.128) (-1086.720) [-1078.728] -- 0:00:20
896000 -- (-1080.389) (-1083.977) [-1081.637] (-1079.555) * (-1088.096) [-1073.101] (-1083.656) (-1080.098) -- 0:00:20
896500 -- (-1082.154) (-1082.749) (-1079.387) [-1080.993] * (-1076.768) (-1084.893) (-1081.600) [-1083.059] -- 0:00:20
897000 -- (-1074.734) (-1077.114) (-1080.468) [-1078.199] * [-1076.227] (-1086.485) (-1080.809) (-1080.626) -- 0:00:20
897500 -- (-1076.909) [-1075.563] (-1087.099) (-1079.798) * (-1078.010) (-1084.273) (-1077.075) [-1077.998] -- 0:00:19
898000 -- (-1086.081) (-1088.041) [-1083.845] (-1085.644) * (-1086.960) (-1078.462) (-1079.762) [-1083.467] -- 0:00:19
898500 -- [-1075.142] (-1076.651) (-1078.735) (-1080.198) * (-1080.157) [-1077.433] (-1085.980) (-1079.903) -- 0:00:19
899000 -- [-1079.045] (-1078.050) (-1077.801) (-1082.066) * (-1081.248) [-1080.372] (-1092.705) (-1077.312) -- 0:00:19
899500 -- [-1079.496] (-1079.479) (-1083.571) (-1076.558) * [-1076.372] (-1083.305) (-1081.476) (-1080.626) -- 0:00:19
900000 -- (-1073.924) [-1077.203] (-1082.949) (-1082.340) * [-1074.367] (-1078.759) (-1084.461) (-1083.152) -- 0:00:19
Average standard deviation of split frequencies: 0.006490
900500 -- (-1079.472) [-1077.913] (-1088.382) (-1076.633) * (-1072.635) [-1078.428] (-1090.963) (-1087.540) -- 0:00:19
901000 -- (-1077.470) [-1076.897] (-1077.232) (-1083.101) * [-1081.023] (-1081.591) (-1084.565) (-1083.245) -- 0:00:19
901500 -- (-1077.188) (-1076.876) (-1083.345) [-1081.009] * (-1076.502) (-1084.549) [-1082.079] (-1080.070) -- 0:00:19
902000 -- (-1079.556) (-1081.140) [-1074.868] (-1076.978) * (-1073.824) [-1078.019] (-1079.721) (-1082.723) -- 0:00:19
902500 -- [-1083.498] (-1079.589) (-1076.493) (-1078.378) * (-1077.041) (-1079.100) (-1083.036) [-1080.660] -- 0:00:19
903000 -- (-1080.705) (-1085.858) (-1086.874) [-1083.667] * (-1080.408) (-1082.462) [-1086.859] (-1079.037) -- 0:00:18
903500 -- [-1076.183] (-1076.641) (-1084.385) (-1087.385) * (-1077.689) (-1080.113) [-1080.503] (-1078.697) -- 0:00:18
904000 -- (-1077.091) (-1076.713) (-1079.822) [-1081.927] * [-1080.790] (-1078.467) (-1084.845) (-1079.068) -- 0:00:18
904500 -- (-1077.239) [-1073.264] (-1078.863) (-1084.089) * (-1081.955) [-1074.456] (-1084.761) (-1086.801) -- 0:00:18
905000 -- (-1087.015) (-1084.946) (-1080.513) [-1079.356] * (-1082.703) [-1084.468] (-1079.515) (-1086.408) -- 0:00:18
Average standard deviation of split frequencies: 0.006452
905500 -- (-1078.180) (-1082.741) [-1074.966] (-1082.993) * (-1086.175) (-1075.661) [-1076.442] (-1085.615) -- 0:00:18
906000 -- [-1078.735] (-1082.229) (-1078.145) (-1079.810) * [-1083.998] (-1076.983) (-1085.209) (-1077.282) -- 0:00:18
906500 -- [-1079.201] (-1078.357) (-1080.129) (-1081.675) * [-1083.044] (-1085.723) (-1076.693) (-1080.803) -- 0:00:18
907000 -- [-1079.228] (-1076.646) (-1077.708) (-1076.588) * (-1080.341) (-1075.190) [-1076.450] (-1081.408) -- 0:00:18
907500 -- (-1080.009) (-1076.851) (-1086.991) [-1074.716] * (-1079.618) (-1075.270) (-1077.792) [-1083.615] -- 0:00:18
908000 -- [-1078.135] (-1074.824) (-1085.117) (-1082.274) * [-1084.788] (-1077.205) (-1076.573) (-1085.155) -- 0:00:17
908500 -- (-1081.810) (-1080.340) [-1082.574] (-1083.459) * (-1075.121) (-1081.090) (-1077.583) [-1076.362] -- 0:00:17
909000 -- (-1077.892) (-1079.907) (-1083.227) [-1076.100] * [-1075.264] (-1080.476) (-1076.570) (-1076.482) -- 0:00:17
909500 -- [-1078.537] (-1074.189) (-1085.732) (-1078.578) * (-1075.698) [-1074.761] (-1078.889) (-1083.591) -- 0:00:17
910000 -- [-1077.231] (-1077.649) (-1081.592) (-1078.289) * (-1081.418) (-1076.339) [-1079.180] (-1075.485) -- 0:00:17
Average standard deviation of split frequencies: 0.006626
910500 -- (-1074.705) (-1080.542) [-1076.511] (-1077.334) * (-1076.817) [-1074.924] (-1081.547) (-1079.942) -- 0:00:17
911000 -- [-1078.624] (-1080.886) (-1080.419) (-1079.197) * (-1086.086) [-1076.931] (-1075.594) (-1078.990) -- 0:00:17
911500 -- (-1085.270) (-1077.378) [-1081.132] (-1076.618) * (-1075.799) (-1077.477) (-1084.976) [-1079.597] -- 0:00:17
912000 -- [-1075.401] (-1074.731) (-1079.821) (-1087.539) * [-1077.961] (-1075.939) (-1083.929) (-1080.767) -- 0:00:17
912500 -- (-1074.373) [-1077.087] (-1082.147) (-1074.470) * (-1077.662) (-1077.787) (-1087.706) [-1079.084] -- 0:00:17
913000 -- (-1083.475) (-1078.713) (-1073.946) [-1075.845] * (-1074.773) [-1084.135] (-1079.090) (-1086.558) -- 0:00:16
913500 -- [-1075.414] (-1075.890) (-1075.800) (-1078.899) * (-1082.488) [-1075.671] (-1076.082) (-1082.258) -- 0:00:16
914000 -- [-1074.839] (-1080.234) (-1082.993) (-1071.642) * [-1076.914] (-1073.048) (-1080.014) (-1082.542) -- 0:00:16
914500 -- (-1079.611) (-1087.621) [-1080.089] (-1075.291) * [-1083.764] (-1079.415) (-1077.540) (-1076.413) -- 0:00:16
915000 -- [-1084.946] (-1080.124) (-1084.722) (-1079.650) * (-1081.269) (-1077.863) (-1080.364) [-1072.734] -- 0:00:16
Average standard deviation of split frequencies: 0.005970
915500 -- (-1079.311) (-1081.443) (-1079.353) [-1077.738] * (-1081.049) [-1075.254] (-1076.162) (-1078.666) -- 0:00:16
916000 -- [-1081.192] (-1084.491) (-1079.731) (-1083.016) * (-1085.646) (-1074.781) (-1081.594) [-1077.814] -- 0:00:16
916500 -- [-1076.088] (-1088.226) (-1088.859) (-1077.533) * (-1081.660) (-1098.993) (-1083.693) [-1077.815] -- 0:00:16
917000 -- [-1083.721] (-1081.038) (-1075.562) (-1078.234) * (-1085.820) (-1077.709) [-1074.189] (-1085.786) -- 0:00:16
917500 -- (-1077.471) (-1078.956) [-1079.623] (-1081.276) * [-1080.300] (-1079.508) (-1078.540) (-1080.736) -- 0:00:16
918000 -- (-1078.247) (-1079.739) [-1075.379] (-1080.669) * [-1074.421] (-1074.986) (-1078.527) (-1078.300) -- 0:00:15
918500 -- (-1080.987) [-1078.444] (-1084.228) (-1082.015) * (-1080.045) [-1075.976] (-1081.023) (-1078.226) -- 0:00:15
919000 -- (-1082.133) (-1079.338) (-1086.314) [-1081.418] * (-1077.726) (-1076.336) [-1082.866] (-1083.939) -- 0:00:15
919500 -- [-1078.735] (-1077.648) (-1088.004) (-1075.494) * (-1085.486) [-1078.827] (-1084.685) (-1084.142) -- 0:00:15
920000 -- (-1075.608) (-1089.827) [-1079.961] (-1074.993) * (-1083.214) [-1084.059] (-1077.333) (-1084.981) -- 0:00:15
Average standard deviation of split frequencies: 0.006349
920500 -- (-1083.786) (-1079.893) (-1085.459) [-1074.933] * [-1084.487] (-1078.137) (-1077.841) (-1084.146) -- 0:00:15
921000 -- (-1080.449) (-1077.901) [-1075.191] (-1077.057) * [-1076.128] (-1078.548) (-1073.594) (-1082.509) -- 0:00:15
921500 -- [-1074.429] (-1080.732) (-1076.705) (-1079.424) * (-1090.098) (-1079.255) (-1078.257) [-1074.925] -- 0:00:15
922000 -- [-1078.362] (-1080.645) (-1080.679) (-1081.155) * (-1076.730) (-1081.643) (-1078.970) [-1081.046] -- 0:00:15
922500 -- [-1076.312] (-1090.572) (-1072.809) (-1080.483) * [-1080.705] (-1079.944) (-1079.462) (-1078.878) -- 0:00:15
923000 -- (-1084.793) (-1079.278) [-1077.847] (-1075.161) * (-1077.818) (-1082.938) (-1081.048) [-1086.516] -- 0:00:15
923500 -- (-1080.669) (-1078.415) [-1076.515] (-1080.006) * (-1086.419) (-1083.982) [-1080.853] (-1077.054) -- 0:00:14
924000 -- (-1090.168) (-1081.265) (-1074.835) [-1074.952] * (-1079.170) (-1079.388) (-1079.715) [-1075.543] -- 0:00:14
924500 -- (-1080.036) (-1082.780) (-1078.233) [-1076.087] * (-1074.171) (-1077.177) [-1079.548] (-1078.813) -- 0:00:14
925000 -- (-1085.504) (-1077.658) [-1076.552] (-1081.037) * (-1081.396) (-1076.685) (-1084.895) [-1082.092] -- 0:00:14
Average standard deviation of split frequencies: 0.005702
925500 -- [-1080.182] (-1078.577) (-1083.526) (-1080.361) * [-1079.536] (-1083.254) (-1076.796) (-1081.139) -- 0:00:14
926000 -- [-1079.889] (-1080.022) (-1078.944) (-1079.425) * (-1082.194) (-1077.878) [-1077.953] (-1078.130) -- 0:00:14
926500 -- (-1077.180) [-1078.220] (-1081.293) (-1086.890) * (-1080.864) (-1081.511) (-1078.761) [-1077.768] -- 0:00:14
927000 -- (-1077.484) [-1084.143] (-1087.606) (-1087.612) * (-1077.455) (-1085.802) [-1083.751] (-1082.499) -- 0:00:14
927500 -- [-1075.450] (-1083.205) (-1079.865) (-1079.909) * (-1079.528) (-1086.720) (-1079.801) [-1082.472] -- 0:00:14
928000 -- (-1076.327) (-1081.822) (-1082.037) [-1078.043] * (-1080.545) (-1081.887) [-1077.572] (-1078.334) -- 0:00:14
928500 -- (-1078.609) [-1084.260] (-1083.315) (-1080.168) * (-1078.800) [-1074.800] (-1072.478) (-1079.096) -- 0:00:13
929000 -- (-1075.541) (-1072.951) [-1076.751] (-1076.735) * [-1078.573] (-1076.655) (-1074.436) (-1079.010) -- 0:00:13
929500 -- [-1077.974] (-1076.698) (-1081.223) (-1079.589) * [-1076.415] (-1081.803) (-1078.416) (-1078.819) -- 0:00:13
930000 -- (-1083.886) (-1079.582) [-1076.504] (-1079.620) * (-1085.374) (-1079.002) (-1082.098) [-1080.382] -- 0:00:13
Average standard deviation of split frequencies: 0.005673
930500 -- (-1080.144) (-1080.167) (-1081.585) [-1079.029] * (-1079.199) (-1077.427) (-1088.847) [-1074.599] -- 0:00:13
931000 -- (-1080.509) (-1076.900) [-1083.066] (-1077.529) * [-1078.234] (-1078.771) (-1079.524) (-1075.684) -- 0:00:13
931500 -- (-1079.615) (-1074.300) [-1084.262] (-1090.713) * (-1077.945) [-1078.507] (-1081.244) (-1079.089) -- 0:00:13
932000 -- (-1078.884) [-1077.327] (-1084.035) (-1082.940) * (-1077.694) [-1079.511] (-1083.887) (-1083.117) -- 0:00:13
932500 -- (-1078.429) [-1078.859] (-1076.460) (-1079.293) * [-1079.139] (-1079.124) (-1082.051) (-1075.858) -- 0:00:13
933000 -- (-1078.870) (-1082.701) (-1078.779) [-1081.420] * (-1080.203) [-1082.721] (-1073.097) (-1077.751) -- 0:00:13
933500 -- (-1078.887) (-1084.645) [-1075.066] (-1080.687) * (-1080.470) (-1085.616) [-1075.124] (-1081.519) -- 0:00:12
934000 -- (-1079.973) (-1081.066) (-1078.313) [-1081.921] * (-1077.851) (-1078.198) [-1075.331] (-1083.566) -- 0:00:12
934500 -- [-1080.209] (-1077.548) (-1080.984) (-1076.931) * (-1076.446) (-1082.906) [-1078.410] (-1080.609) -- 0:00:12
935000 -- [-1084.980] (-1081.393) (-1078.779) (-1077.270) * (-1076.257) [-1081.116] (-1081.103) (-1080.780) -- 0:00:12
Average standard deviation of split frequencies: 0.005238
935500 -- [-1079.704] (-1078.880) (-1077.022) (-1086.234) * (-1081.534) [-1077.650] (-1078.650) (-1077.634) -- 0:00:12
936000 -- (-1081.469) (-1084.122) (-1078.278) [-1076.351] * (-1083.507) (-1077.130) (-1081.111) [-1076.859] -- 0:00:12
936500 -- (-1088.679) (-1083.700) (-1078.962) [-1079.283] * (-1085.569) (-1082.722) (-1082.289) [-1076.088] -- 0:00:12
937000 -- (-1080.276) (-1080.757) (-1080.879) [-1084.103] * (-1084.142) [-1075.208] (-1075.855) (-1074.249) -- 0:00:12
937500 -- (-1086.228) (-1081.152) (-1082.316) [-1084.253] * (-1082.476) (-1082.527) [-1077.471] (-1072.751) -- 0:00:12
938000 -- (-1089.072) (-1077.954) (-1078.222) [-1077.486] * (-1077.347) (-1078.226) (-1080.840) [-1074.254] -- 0:00:12
938500 -- (-1083.263) (-1080.609) [-1082.954] (-1080.069) * (-1081.087) [-1082.276] (-1075.354) (-1074.735) -- 0:00:11
939000 -- [-1077.896] (-1089.975) (-1082.155) (-1081.685) * (-1083.085) (-1083.728) [-1079.435] (-1073.765) -- 0:00:11
939500 -- (-1080.234) (-1083.286) (-1082.783) [-1083.688] * (-1078.678) (-1083.103) [-1074.883] (-1077.354) -- 0:00:11
940000 -- (-1078.155) (-1081.736) [-1077.567] (-1075.694) * (-1079.836) [-1078.822] (-1083.340) (-1076.759) -- 0:00:11
Average standard deviation of split frequencies: 0.004210
940500 -- (-1080.706) [-1079.206] (-1078.741) (-1075.382) * (-1076.350) [-1078.427] (-1083.608) (-1081.686) -- 0:00:11
941000 -- (-1081.869) (-1083.868) (-1082.021) [-1082.245] * (-1078.865) (-1075.973) (-1079.351) [-1086.328] -- 0:00:11
941500 -- (-1087.520) (-1081.284) [-1082.734] (-1087.408) * (-1078.359) [-1078.714] (-1081.932) (-1080.495) -- 0:00:11
942000 -- (-1082.296) (-1079.454) [-1083.447] (-1082.422) * (-1076.247) (-1078.941) (-1083.913) [-1074.029] -- 0:00:11
942500 -- (-1079.373) [-1083.854] (-1077.456) (-1079.975) * (-1082.615) (-1083.348) (-1081.186) [-1077.363] -- 0:00:11
943000 -- (-1078.984) [-1077.874] (-1078.050) (-1082.733) * (-1077.470) (-1082.441) (-1079.474) [-1075.030] -- 0:00:11
943500 -- (-1078.788) (-1079.905) (-1084.587) [-1086.980] * [-1075.282] (-1089.332) (-1082.861) (-1076.726) -- 0:00:11
944000 -- (-1085.921) (-1082.709) (-1077.673) [-1079.620] * (-1077.796) [-1075.442] (-1093.316) (-1075.429) -- 0:00:10
944500 -- [-1083.613] (-1079.553) (-1078.017) (-1077.088) * (-1083.782) [-1081.949] (-1093.027) (-1081.690) -- 0:00:10
945000 -- [-1081.184] (-1083.529) (-1078.140) (-1086.012) * (-1085.756) (-1078.869) (-1079.694) [-1077.988] -- 0:00:10
Average standard deviation of split frequencies: 0.003987
945500 -- (-1087.083) (-1077.208) [-1086.800] (-1078.091) * (-1078.394) [-1078.385] (-1083.812) (-1078.308) -- 0:00:10
946000 -- [-1074.059] (-1084.864) (-1074.604) (-1078.913) * (-1076.859) (-1080.935) (-1079.667) [-1081.208] -- 0:00:10
946500 -- [-1077.016] (-1081.052) (-1083.224) (-1075.386) * (-1081.281) (-1074.320) [-1075.253] (-1082.348) -- 0:00:10
947000 -- (-1080.017) (-1077.991) [-1078.313] (-1077.049) * (-1082.984) (-1081.687) (-1078.294) [-1081.512] -- 0:00:10
947500 -- (-1083.160) [-1076.153] (-1078.599) (-1075.116) * (-1088.385) (-1081.939) [-1077.917] (-1082.260) -- 0:00:10
948000 -- [-1080.703] (-1079.727) (-1083.378) (-1079.190) * (-1081.857) (-1077.345) (-1075.286) [-1076.275] -- 0:00:10
948500 -- (-1081.230) (-1076.311) (-1081.527) [-1078.217] * (-1078.136) (-1091.144) (-1077.164) [-1076.132] -- 0:00:10
949000 -- (-1081.480) [-1079.370] (-1085.019) (-1073.940) * [-1076.151] (-1077.286) (-1078.366) (-1081.340) -- 0:00:09
949500 -- (-1084.449) (-1078.320) [-1077.837] (-1076.246) * (-1083.035) (-1081.724) [-1083.032] (-1075.708) -- 0:00:09
950000 -- (-1082.450) (-1081.001) (-1076.126) [-1084.166] * [-1085.967] (-1075.217) (-1080.794) (-1079.062) -- 0:00:09
Average standard deviation of split frequencies: 0.003372
950500 -- [-1076.021] (-1090.167) (-1079.701) (-1075.651) * [-1077.257] (-1077.044) (-1094.624) (-1076.894) -- 0:00:09
951000 -- [-1083.224] (-1073.035) (-1082.540) (-1075.268) * (-1090.136) (-1090.592) [-1081.965] (-1085.562) -- 0:00:09
951500 -- (-1086.398) [-1075.651] (-1089.904) (-1079.509) * (-1085.001) (-1080.503) (-1085.625) [-1073.670] -- 0:00:09
952000 -- [-1084.742] (-1077.881) (-1081.813) (-1086.927) * (-1077.400) (-1078.998) (-1077.981) [-1076.270] -- 0:00:09
952500 -- [-1078.847] (-1077.796) (-1079.109) (-1079.513) * (-1081.045) (-1074.540) [-1079.778] (-1078.184) -- 0:00:09
953000 -- [-1088.475] (-1076.786) (-1074.554) (-1078.810) * (-1079.607) (-1080.216) [-1082.046] (-1090.018) -- 0:00:09
953500 -- (-1076.733) (-1091.398) [-1081.403] (-1085.005) * (-1082.846) (-1077.317) (-1082.460) [-1077.188] -- 0:00:09
954000 -- [-1073.855] (-1083.093) (-1082.083) (-1081.863) * (-1079.215) (-1076.317) (-1081.959) [-1075.341] -- 0:00:08
954500 -- (-1081.045) [-1079.897] (-1077.525) (-1084.892) * [-1073.787] (-1078.912) (-1078.295) (-1084.886) -- 0:00:08
955000 -- [-1081.782] (-1088.354) (-1084.224) (-1080.944) * (-1085.251) (-1074.777) (-1080.021) [-1077.416] -- 0:00:08
Average standard deviation of split frequencies: 0.003550
955500 -- (-1082.637) [-1083.363] (-1083.046) (-1073.853) * [-1079.939] (-1079.156) (-1081.519) (-1079.194) -- 0:00:08
956000 -- (-1085.110) (-1089.019) (-1083.626) [-1077.807] * (-1077.931) [-1073.196] (-1082.257) (-1081.322) -- 0:00:08
956500 -- [-1081.856] (-1082.763) (-1081.458) (-1078.548) * (-1077.585) (-1087.044) [-1080.343] (-1083.556) -- 0:00:08
957000 -- (-1087.560) [-1079.282] (-1076.503) (-1085.582) * (-1077.430) [-1075.514] (-1083.401) (-1076.179) -- 0:00:08
957500 -- (-1080.466) (-1077.281) [-1074.659] (-1081.057) * (-1082.060) (-1077.927) [-1077.553] (-1078.182) -- 0:00:08
958000 -- (-1080.521) [-1079.478] (-1085.618) (-1078.293) * (-1081.129) (-1078.299) [-1076.073] (-1083.950) -- 0:00:08
958500 -- [-1078.283] (-1080.466) (-1082.715) (-1080.970) * (-1075.458) (-1080.802) [-1075.770] (-1083.754) -- 0:00:08
959000 -- (-1076.294) (-1079.782) [-1076.272] (-1079.120) * [-1080.853] (-1086.731) (-1079.336) (-1083.869) -- 0:00:07
959500 -- (-1080.741) [-1075.906] (-1076.172) (-1086.425) * (-1079.101) (-1079.438) (-1079.116) [-1079.751] -- 0:00:07
960000 -- [-1076.973] (-1084.192) (-1077.553) (-1090.208) * [-1084.045] (-1079.574) (-1077.384) (-1082.486) -- 0:00:07
Average standard deviation of split frequencies: 0.004318
960500 -- (-1080.318) (-1095.559) (-1076.314) [-1083.560] * (-1083.297) (-1083.962) [-1073.237] (-1078.477) -- 0:00:07
961000 -- (-1083.489) [-1072.106] (-1084.186) (-1076.658) * (-1078.912) [-1079.284] (-1078.641) (-1075.013) -- 0:00:07
961500 -- (-1081.498) (-1076.144) [-1075.859] (-1077.502) * [-1075.269] (-1080.507) (-1077.204) (-1073.773) -- 0:00:07
962000 -- [-1076.083] (-1077.335) (-1085.364) (-1078.739) * (-1079.231) [-1079.080] (-1077.207) (-1083.655) -- 0:00:07
962500 -- (-1074.428) [-1076.690] (-1078.603) (-1083.192) * [-1074.551] (-1081.132) (-1083.311) (-1084.149) -- 0:00:07
963000 -- (-1075.984) [-1077.431] (-1078.541) (-1081.279) * (-1080.256) (-1079.650) [-1075.642] (-1078.681) -- 0:00:07
963500 -- [-1076.031] (-1079.174) (-1080.326) (-1079.163) * (-1079.520) (-1081.311) (-1083.766) [-1083.930] -- 0:00:07
964000 -- (-1082.331) (-1077.920) (-1081.689) [-1076.511] * (-1078.759) (-1081.645) (-1077.727) [-1080.848] -- 0:00:07
964500 -- (-1077.627) (-1078.150) [-1086.300] (-1086.602) * [-1081.763] (-1091.686) (-1077.449) (-1081.495) -- 0:00:06
965000 -- [-1075.985] (-1078.758) (-1084.667) (-1079.949) * (-1074.997) (-1095.874) (-1076.056) [-1079.343] -- 0:00:06
Average standard deviation of split frequencies: 0.003904
965500 -- [-1072.370] (-1083.277) (-1077.574) (-1085.113) * (-1077.365) [-1083.553] (-1078.304) (-1076.421) -- 0:00:06
966000 -- (-1082.650) (-1086.290) (-1082.565) [-1080.607] * [-1078.606] (-1083.411) (-1075.415) (-1082.784) -- 0:00:06
966500 -- (-1075.397) (-1081.439) (-1077.341) [-1080.190] * [-1083.128] (-1082.963) (-1081.474) (-1080.582) -- 0:00:06
967000 -- (-1076.870) (-1076.782) (-1073.394) [-1076.321] * [-1084.364] (-1081.066) (-1078.565) (-1076.494) -- 0:00:06
967500 -- [-1075.239] (-1084.472) (-1078.356) (-1081.273) * (-1086.452) (-1089.560) (-1076.997) [-1079.493] -- 0:00:06
968000 -- (-1084.069) (-1089.227) [-1080.010] (-1078.098) * (-1078.744) (-1082.653) (-1080.044) [-1076.835] -- 0:00:06
968500 -- [-1078.491] (-1081.745) (-1081.463) (-1077.996) * (-1089.059) [-1075.959] (-1086.706) (-1080.312) -- 0:00:06
969000 -- (-1082.264) [-1074.586] (-1080.187) (-1076.134) * (-1082.896) [-1077.825] (-1086.030) (-1083.932) -- 0:00:06
969500 -- [-1072.797] (-1082.102) (-1080.618) (-1086.467) * (-1078.803) (-1085.412) [-1079.287] (-1079.661) -- 0:00:05
970000 -- (-1088.970) (-1079.611) [-1078.958] (-1079.450) * (-1084.749) (-1076.054) [-1080.078] (-1078.445) -- 0:00:05
Average standard deviation of split frequencies: 0.003885
970500 -- (-1078.118) [-1076.328] (-1086.300) (-1078.520) * [-1078.423] (-1083.923) (-1081.844) (-1079.527) -- 0:00:05
971000 -- [-1079.241] (-1077.142) (-1087.167) (-1080.320) * [-1078.905] (-1083.048) (-1085.487) (-1081.125) -- 0:00:05
971500 -- (-1080.080) (-1073.443) [-1085.408] (-1076.219) * (-1080.801) (-1084.236) [-1078.163] (-1081.566) -- 0:00:05
972000 -- (-1080.778) (-1076.033) (-1084.881) [-1083.233] * (-1085.136) (-1081.105) (-1082.453) [-1075.127] -- 0:00:05
972500 -- (-1081.310) (-1081.620) (-1080.714) [-1079.759] * (-1088.215) [-1083.150] (-1079.013) (-1073.764) -- 0:00:05
973000 -- (-1085.003) (-1077.517) (-1077.256) [-1080.003] * (-1088.268) (-1078.206) (-1092.405) [-1079.225] -- 0:00:05
973500 -- (-1083.201) (-1075.523) (-1080.964) [-1073.065] * (-1075.133) (-1080.269) [-1079.166] (-1075.631) -- 0:00:05
974000 -- (-1082.691) (-1078.468) [-1078.902] (-1081.584) * (-1082.444) (-1080.170) [-1077.494] (-1080.483) -- 0:00:05
974500 -- (-1082.259) (-1080.097) [-1082.383] (-1079.323) * (-1079.220) [-1079.605] (-1081.606) (-1079.326) -- 0:00:04
975000 -- (-1087.343) (-1078.148) [-1079.030] (-1080.404) * [-1083.049] (-1080.690) (-1081.568) (-1083.430) -- 0:00:04
Average standard deviation of split frequencies: 0.004444
975500 -- (-1086.794) (-1083.917) (-1075.430) [-1080.730] * [-1079.113] (-1084.608) (-1085.915) (-1079.166) -- 0:00:04
976000 -- [-1082.518] (-1081.281) (-1090.838) (-1086.635) * (-1081.892) (-1083.774) (-1081.478) [-1073.527] -- 0:00:04
976500 -- (-1081.246) [-1081.128] (-1084.341) (-1079.537) * [-1074.790] (-1080.802) (-1073.915) (-1081.632) -- 0:00:04
977000 -- (-1081.016) (-1074.402) [-1085.911] (-1083.462) * (-1076.901) (-1078.535) (-1079.440) [-1079.135] -- 0:00:04
977500 -- (-1085.009) (-1076.946) [-1076.486] (-1081.204) * [-1084.289] (-1085.431) (-1079.664) (-1076.596) -- 0:00:04
978000 -- (-1083.012) (-1077.648) [-1080.561] (-1075.847) * (-1074.462) (-1080.797) [-1074.776] (-1082.732) -- 0:00:04
978500 -- (-1079.216) (-1077.262) (-1076.587) [-1082.248] * (-1075.771) (-1078.148) (-1085.381) [-1082.457] -- 0:00:04
979000 -- [-1076.548] (-1079.568) (-1075.710) (-1085.417) * [-1081.000] (-1085.293) (-1080.657) (-1087.978) -- 0:00:04
979500 -- (-1083.987) [-1083.190] (-1079.111) (-1074.620) * (-1079.939) (-1080.046) (-1080.354) [-1080.001] -- 0:00:03
980000 -- (-1079.900) (-1080.723) (-1085.460) [-1075.567] * (-1080.753) (-1081.956) (-1080.805) [-1082.792] -- 0:00:03
Average standard deviation of split frequencies: 0.004615
980500 -- (-1081.367) [-1083.185] (-1082.337) (-1083.050) * (-1082.474) (-1083.574) [-1081.907] (-1075.832) -- 0:00:03
981000 -- [-1084.507] (-1084.859) (-1082.140) (-1080.690) * (-1085.424) [-1080.489] (-1079.252) (-1080.527) -- 0:00:03
981500 -- (-1080.239) (-1079.614) (-1074.266) [-1074.702] * (-1085.978) (-1081.700) (-1083.642) [-1075.236] -- 0:00:03
982000 -- (-1079.132) (-1087.558) (-1081.557) [-1074.293] * (-1078.215) (-1080.027) [-1073.804] (-1084.649) -- 0:00:03
982500 -- [-1076.355] (-1087.114) (-1077.768) (-1076.391) * (-1082.008) (-1079.582) [-1079.041] (-1082.986) -- 0:00:03
983000 -- (-1077.152) [-1079.617] (-1085.364) (-1082.979) * [-1074.623] (-1085.737) (-1083.193) (-1081.752) -- 0:00:03
983500 -- (-1083.547) (-1075.879) (-1083.040) [-1081.045] * [-1081.841] (-1081.779) (-1079.698) (-1077.823) -- 0:00:03
984000 -- (-1083.575) (-1073.080) [-1078.547] (-1078.330) * (-1079.352) (-1078.970) (-1080.784) [-1075.078] -- 0:00:03
984500 -- (-1084.768) (-1084.341) (-1087.608) [-1075.385] * (-1086.614) (-1078.110) (-1076.393) [-1074.829] -- 0:00:03
985000 -- (-1078.990) (-1074.536) [-1075.191] (-1077.997) * (-1085.342) [-1078.039] (-1080.864) (-1077.900) -- 0:00:02
Average standard deviation of split frequencies: 0.004781
985500 -- (-1085.143) (-1082.324) (-1076.842) [-1080.888] * (-1084.268) [-1082.639] (-1078.243) (-1081.498) -- 0:00:02
986000 -- (-1080.629) (-1071.870) (-1075.640) [-1078.635] * (-1083.883) (-1078.584) [-1075.239] (-1078.965) -- 0:00:02
986500 -- (-1082.644) [-1077.074] (-1077.203) (-1085.854) * (-1079.978) [-1080.653] (-1071.893) (-1086.152) -- 0:00:02
987000 -- (-1075.297) (-1084.035) [-1077.399] (-1096.003) * [-1076.340] (-1081.586) (-1078.023) (-1077.973) -- 0:00:02
987500 -- (-1080.739) [-1077.654] (-1073.989) (-1082.888) * (-1077.099) (-1083.603) (-1074.590) [-1084.867] -- 0:00:02
988000 -- (-1081.313) [-1074.666] (-1080.841) (-1080.212) * (-1085.982) [-1076.786] (-1079.386) (-1082.482) -- 0:00:02
988500 -- [-1077.125] (-1077.914) (-1075.039) (-1082.908) * [-1082.626] (-1079.275) (-1079.543) (-1084.887) -- 0:00:02
989000 -- (-1080.534) [-1075.046] (-1076.688) (-1080.727) * (-1074.634) (-1081.137) (-1083.126) [-1081.065] -- 0:00:02
989500 -- (-1087.438) [-1077.652] (-1080.926) (-1082.872) * (-1075.502) [-1080.179] (-1075.421) (-1085.563) -- 0:00:02
990000 -- (-1081.179) (-1076.786) [-1074.861] (-1084.998) * (-1076.494) [-1079.847] (-1082.569) (-1083.620) -- 0:00:01
Average standard deviation of split frequencies: 0.005329
990500 -- (-1081.493) (-1074.255) [-1082.221] (-1074.772) * (-1076.027) (-1089.548) (-1083.143) [-1082.643] -- 0:00:01
991000 -- (-1080.347) (-1074.169) [-1077.227] (-1074.357) * (-1077.576) (-1077.135) [-1083.567] (-1080.133) -- 0:00:01
991500 -- (-1085.474) (-1075.815) (-1084.074) [-1083.863] * (-1078.815) (-1078.944) (-1077.458) [-1079.369] -- 0:00:01
992000 -- (-1076.556) (-1078.590) [-1074.598] (-1076.599) * (-1079.062) (-1081.973) (-1079.128) [-1083.136] -- 0:00:01
992500 -- (-1079.398) (-1087.197) (-1082.708) [-1076.757] * [-1075.704] (-1084.617) (-1080.600) (-1082.519) -- 0:00:01
993000 -- (-1076.726) [-1077.428] (-1082.435) (-1082.827) * [-1081.436] (-1085.243) (-1078.983) (-1081.229) -- 0:00:01
993500 -- [-1078.105] (-1078.780) (-1081.827) (-1081.907) * (-1076.524) (-1083.574) (-1074.691) [-1078.437] -- 0:00:01
994000 -- (-1075.578) [-1077.467] (-1078.620) (-1079.857) * (-1081.208) (-1079.820) [-1077.283] (-1079.191) -- 0:00:01
994500 -- [-1076.977] (-1082.242) (-1087.444) (-1078.910) * [-1073.842] (-1079.623) (-1079.232) (-1086.376) -- 0:00:01
995000 -- (-1075.642) (-1081.233) [-1080.184] (-1078.170) * (-1078.180) [-1085.632] (-1076.760) (-1087.052) -- 0:00:00
Average standard deviation of split frequencies: 0.005680
995500 -- [-1078.662] (-1082.055) (-1074.871) (-1076.010) * (-1074.078) [-1081.537] (-1079.339) (-1093.015) -- 0:00:00
996000 -- (-1078.359) (-1077.859) [-1075.224] (-1083.124) * (-1076.945) [-1084.234] (-1078.015) (-1084.204) -- 0:00:00
996500 -- (-1078.983) (-1075.808) [-1077.957] (-1074.716) * [-1077.351] (-1075.499) (-1087.106) (-1080.872) -- 0:00:00
997000 -- (-1076.019) [-1078.264] (-1077.428) (-1074.395) * (-1075.349) [-1080.966] (-1077.947) (-1081.653) -- 0:00:00
997500 -- [-1076.852] (-1081.212) (-1083.891) (-1080.323) * (-1078.471) (-1076.976) [-1077.805] (-1081.321) -- 0:00:00
998000 -- [-1075.555] (-1079.472) (-1084.647) (-1086.609) * (-1074.792) (-1077.608) [-1077.087] (-1081.528) -- 0:00:00
998500 -- [-1075.972] (-1081.498) (-1079.064) (-1085.948) * [-1072.632] (-1076.983) (-1079.896) (-1080.022) -- 0:00:00
999000 -- (-1080.248) [-1074.297] (-1081.037) (-1080.586) * (-1079.228) (-1082.982) [-1076.464] (-1078.222) -- 0:00:00
999500 -- (-1083.047) [-1072.390] (-1077.209) (-1080.792) * (-1080.263) [-1080.366] (-1081.797) (-1076.943) -- 0:00:00
1000000 -- (-1079.054) (-1073.851) [-1077.236] (-1077.865) * (-1080.250) (-1079.796) [-1080.671] (-1080.539) -- 0:00:00
Average standard deviation of split frequencies: 0.005276
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1079.054384 -- 17.076876
Chain 1 -- -1079.054384 -- 17.076876
Chain 2 -- -1073.851103 -- 15.423611
Chain 2 -- -1073.851104 -- 15.423611
Chain 3 -- -1077.235597 -- 15.275573
Chain 3 -- -1077.235602 -- 15.275573
Chain 4 -- -1077.864873 -- 18.086521
Chain 4 -- -1077.864874 -- 18.086521
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1080.250466 -- 15.756391
Chain 1 -- -1080.250469 -- 15.756391
Chain 2 -- -1079.796304 -- 16.925060
Chain 2 -- -1079.796305 -- 16.925060
Chain 3 -- -1080.671354 -- 16.462244
Chain 3 -- -1080.671353 -- 16.462244
Chain 4 -- -1080.538563 -- 16.428979
Chain 4 -- -1080.538565 -- 16.428979
Analysis completed in 3 mins 16 seconds
Analysis used 195.79 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1070.06
Likelihood of best state for "cold" chain of run 2 was -1070.06
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.6 % ( 49 %) Dirichlet(Revmat{all})
72.5 % ( 64 %) Slider(Revmat{all})
32.5 % ( 30 %) Dirichlet(Pi{all})
32.3 % ( 25 %) Slider(Pi{all})
57.1 % ( 28 %) Multiplier(Alpha{1,2})
51.1 % ( 29 %) Multiplier(Alpha{3})
72.4 % ( 49 %) Slider(Pinvar{all})
9.1 % ( 14 %) ExtSPR(Tau{all},V{all})
4.6 % ( 2 %) ExtTBR(Tau{all},V{all})
18.5 % ( 19 %) NNI(Tau{all},V{all})
23.6 % ( 24 %) ParsSPR(Tau{all},V{all})
26.3 % ( 32 %) Multiplier(V{all})
32.8 % ( 31 %) Nodeslider(V{all})
25.8 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.2 % ( 53 %) Dirichlet(Revmat{all})
72.1 % ( 52 %) Slider(Revmat{all})
30.9 % ( 18 %) Dirichlet(Pi{all})
33.2 % ( 24 %) Slider(Pi{all})
56.9 % ( 25 %) Multiplier(Alpha{1,2})
51.0 % ( 26 %) Multiplier(Alpha{3})
72.0 % ( 43 %) Slider(Pinvar{all})
9.2 % ( 12 %) ExtSPR(Tau{all},V{all})
4.6 % ( 3 %) ExtTBR(Tau{all},V{all})
18.7 % ( 17 %) NNI(Tau{all},V{all})
23.5 % ( 20 %) ParsSPR(Tau{all},V{all})
26.3 % ( 33 %) Multiplier(V{all})
32.7 % ( 48 %) Nodeslider(V{all})
25.6 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.67 0.53
2 | 166557 0.84 0.69
3 | 166558 166831 0.85
4 | 167154 166867 166033
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.67 0.54
2 | 166672 0.84 0.69
3 | 166755 166780 0.85
4 | 166517 166510 166766
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1077.09
| 1|
| |
| 2 1 |
| 1 2 2 1 2 1 |
| 2 1 21 2 1 2 2 22 |
| 1 * 1 12 2 2 1 21 2 1 |
| *1 * 1 1 11 22**2 1 1 2 |
|2 2 2 21 1 1 2 2 1 2 |
| 1 1 1 22 12 11 1212 1 1 2 1 2 |
| 2 12 2 1 1 1 1 1 |
| 22 2 2 1 22 2 2 1 2 2 |
| 2 2 1 22 2 1 2|
|1 * 1 1 1 2 1 1 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1080.52
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1075.67 -1084.97
2 -1075.93 -1088.14
--------------------------------------
TOTAL -1075.79 -1087.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.355865 0.002350 0.263453 0.451483 0.352930 1423.38 1457.80 1.000
r(A<->C){all} 0.166155 0.001634 0.089403 0.242955 0.162820 703.43 786.80 1.000
r(A<->G){all} 0.176313 0.001952 0.091315 0.259524 0.172833 697.67 824.54 1.000
r(A<->T){all} 0.100932 0.001293 0.034550 0.170886 0.097050 809.10 829.66 1.001
r(C<->G){all} 0.119717 0.001234 0.053541 0.186046 0.116557 844.10 971.15 1.000
r(C<->T){all} 0.361729 0.003250 0.249884 0.468734 0.358848 827.51 874.50 1.004
r(G<->T){all} 0.075154 0.000922 0.023789 0.137031 0.071469 831.66 851.40 1.002
pi(A){all} 0.254300 0.000416 0.213083 0.293189 0.253775 979.68 1175.25 1.000
pi(C){all} 0.270257 0.000409 0.233519 0.311621 0.269294 1049.58 1080.26 1.004
pi(G){all} 0.240103 0.000413 0.200019 0.279843 0.239742 1293.32 1397.16 1.001
pi(T){all} 0.235340 0.000413 0.196213 0.274689 0.235092 1282.18 1363.09 1.000
alpha{1,2} 0.318771 0.051775 0.000518 0.719519 0.265575 1389.31 1442.13 1.000
alpha{3} 1.734423 0.529780 0.568419 3.193125 1.597159 1367.20 1384.34 1.000
pinvar{all} 0.103088 0.006910 0.000016 0.262699 0.083518 1243.91 1360.80 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...***
9 -- ....**
10 -- ...**.
11 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 3002 1.000000 0.000000 1.000000 1.000000 2
8 3002 1.000000 0.000000 1.000000 1.000000 2
9 1484 0.494337 0.013191 0.485010 0.503664 2
10 1169 0.389407 0.007066 0.384410 0.394404 2
11 349 0.116256 0.006124 0.111925 0.120586 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.042138 0.000184 0.018862 0.069886 0.040970 1.000 2
length{all}[2] 0.022921 0.000091 0.005779 0.041486 0.021609 1.000 2
length{all}[3] 0.022762 0.000087 0.006842 0.041584 0.021518 1.000 2
length{all}[4] 0.023894 0.000097 0.006020 0.042644 0.022604 1.000 2
length{all}[5] 0.049255 0.000213 0.024396 0.080067 0.047395 1.000 2
length{all}[6] 0.088053 0.000447 0.048218 0.128000 0.086250 1.000 2
length{all}[7] 0.036236 0.000177 0.013300 0.062630 0.034497 1.000 2
length{all}[8] 0.060667 0.000294 0.028738 0.093447 0.059300 1.000 2
length{all}[9] 0.010794 0.000056 0.000006 0.024812 0.009180 0.999 2
length{all}[10] 0.009989 0.000052 0.000030 0.023283 0.008529 1.000 2
length{all}[11] 0.006135 0.000027 0.000028 0.016674 0.004887 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005276
Maximum standard deviation of split frequencies = 0.013191
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
| |
|----------------100----------------+------------------------------------ C5 (5)
+ |
| \------------------------------------ C6 (6)
|
| /------------------------------------ C2 (2)
\----------------100----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/-------------------- C1 (1)
|
| /------------ C4 (4)
| |
|----------------------------+------------------------ C5 (5)
+ |
| \------------------------------------------- C6 (6)
|
| /----------- C2 (2)
\----------------+
\----------- C3 (3)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 6 ls = 390
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
98 patterns at 130 / 130 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
95648 bytes for conP
13328 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5, 6), (2, 3)); MP score: 98
143472 bytes for conP, adjusted
0.099670 0.142505 0.054280 0.141006 0.259497 0.076502 0.046737 0.055553 0.300000 1.300000
ntime & nrate & np: 8 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 10
lnL0 = -1121.413224
Iterating by ming2
Initial: fx= 1121.413224
x= 0.09967 0.14251 0.05428 0.14101 0.25950 0.07650 0.04674 0.05555 0.30000 1.30000
1 h-m-p 0.0000 0.0120 127.3796 +++++YCCCC 1082.394508 4 0.0071 27 | 0/10
2 h-m-p 0.0004 0.0022 288.1455 +YCCCCC 1067.465257 5 0.0012 50 | 0/10
3 h-m-p 0.0004 0.0019 104.4411 YCYCCC 1064.236945 5 0.0009 71 | 0/10
4 h-m-p 0.0009 0.0072 110.0124 +CCYCCC 1045.853342 5 0.0055 95 | 0/10
5 h-m-p 0.0000 0.0001 2546.7022 CYCYCC 1041.269539 5 0.0001 117 | 0/10
6 h-m-p 0.0005 0.0024 46.7699 YCY 1041.061593 2 0.0003 133 | 0/10
7 h-m-p 0.0008 0.0038 13.3974 CC 1041.044775 1 0.0002 148 | 0/10
8 h-m-p 0.0004 0.0822 7.3580 +CYC 1040.993280 2 0.0015 165 | 0/10
9 h-m-p 0.0020 0.0529 5.6246 YC 1040.878438 1 0.0038 179 | 0/10
10 h-m-p 0.0056 0.0592 3.8565 CCCC 1040.443181 3 0.0097 198 | 0/10
11 h-m-p 0.0049 0.0646 7.6548 +YCYCCCC 1031.147430 6 0.0295 222 | 0/10
12 h-m-p 0.7791 3.8956 0.1185 CCCC 1029.053382 3 0.6593 241 | 0/10
13 h-m-p 0.4748 2.9831 0.1645 YCCC 1028.192604 3 0.3318 269 | 0/10
14 h-m-p 1.3828 8.0000 0.0395 CYC 1027.547099 2 1.2279 295 | 0/10
15 h-m-p 1.6000 8.0000 0.0294 YCC 1027.156986 2 1.3060 321 | 0/10
16 h-m-p 1.6000 8.0000 0.0105 CYC 1027.019141 2 1.7443 347 | 0/10
17 h-m-p 1.6000 8.0000 0.0086 C 1026.998277 0 1.6536 370 | 0/10
18 h-m-p 1.6000 8.0000 0.0058 CY 1026.991705 1 1.5336 395 | 0/10
19 h-m-p 1.6000 8.0000 0.0015 CC 1026.987400 1 2.3368 420 | 0/10
20 h-m-p 1.6000 8.0000 0.0013 CC 1026.986326 1 2.4692 445 | 0/10
21 h-m-p 1.6000 8.0000 0.0002 C 1026.986305 0 1.3039 468 | 0/10
22 h-m-p 1.2805 8.0000 0.0002 ++ 1026.986292 m 8.0000 491 | 0/10
23 h-m-p 1.6000 8.0000 0.0001 Y 1026.986289 0 1.2661 514 | 0/10
24 h-m-p 1.6000 8.0000 0.0001 Y 1026.986289 0 1.1694 537 | 0/10
25 h-m-p 1.6000 8.0000 0.0000 Y 1026.986289 0 1.1306 560 | 0/10
26 h-m-p 1.6000 8.0000 0.0000 Y 1026.986289 0 1.1074 583 | 0/10
27 h-m-p 1.6000 8.0000 0.0000 --------Y 1026.986289 0 0.0000 614
Out..
lnL = -1026.986289
615 lfun, 615 eigenQcodon, 4920 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5, 6), (2, 3)); MP score: 98
0.099670 0.142505 0.054280 0.141006 0.259497 0.076502 0.046737 0.055553 1.380088 0.786608 0.239734
ntime & nrate & np: 8 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.064416
np = 11
lnL0 = -1034.925612
Iterating by ming2
Initial: fx= 1034.925612
x= 0.09967 0.14251 0.05428 0.14101 0.25950 0.07650 0.04674 0.05555 1.38009 0.78661 0.23973
1 h-m-p 0.0000 0.0041 79.6199 ++++YYCCCC 1026.699198 5 0.0022 28 | 0/11
2 h-m-p 0.0004 0.0018 85.9436 CCCCC 1025.494939 4 0.0005 50 | 0/11
3 h-m-p 0.0008 0.0039 27.3814 YCCCCC 1024.902037 5 0.0017 73 | 0/11
4 h-m-p 0.0050 0.0251 7.6069 CCC 1024.848703 2 0.0018 91 | 0/11
5 h-m-p 0.0045 0.0866 3.1570 CCC 1024.822927 2 0.0038 109 | 0/11
6 h-m-p 0.0030 0.0608 4.0405 YC 1024.761392 1 0.0068 124 | 0/11
7 h-m-p 0.0012 0.0373 22.7910 +CCC 1024.457500 2 0.0059 143 | 0/11
8 h-m-p 0.0024 0.0120 49.0087 YYC 1024.232803 2 0.0020 159 | 0/11
9 h-m-p 0.0057 0.0283 13.0331 CCC 1024.190416 2 0.0015 177 | 0/11
10 h-m-p 0.0181 0.2707 1.0813 YC 1024.169434 1 0.0085 192 | 0/11
11 h-m-p 0.0015 0.1501 6.0726 ++CCCCC 1023.599595 4 0.0344 216 | 0/11
12 h-m-p 0.0023 0.0114 36.3595 YCCC 1023.487952 3 0.0013 235 | 0/11
13 h-m-p 0.6074 8.0000 0.0750 CCC 1023.446440 2 0.5739 253 | 0/11
14 h-m-p 1.6000 8.0000 0.0090 YC 1023.443255 1 0.8873 279 | 0/11
15 h-m-p 1.6000 8.0000 0.0007 YC 1023.443185 1 0.8221 305 | 0/11
16 h-m-p 1.6000 8.0000 0.0003 Y 1023.443183 0 0.7883 330 | 0/11
17 h-m-p 1.6000 8.0000 0.0000 Y 1023.443183 0 0.9535 355 | 0/11
18 h-m-p 1.6000 8.0000 0.0000 Y 1023.443183 0 0.8194 380 | 0/11
19 h-m-p 1.6000 8.0000 0.0000 Y 1023.443183 0 0.8733 405 | 0/11
20 h-m-p 1.6000 8.0000 0.0000 C 1023.443183 0 0.4000 430 | 0/11
21 h-m-p 1.1850 8.0000 0.0000 ----------Y 1023.443183 0 0.0000 465
Out..
lnL = -1023.443183
466 lfun, 1398 eigenQcodon, 7456 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (4, 5, 6), (2, 3)); MP score: 98
initial w for M2:NSpselection reset.
0.099670 0.142505 0.054280 0.141006 0.259497 0.076502 0.046737 0.055553 1.385124 1.301606 0.304419 0.499282 2.199788
ntime & nrate & np: 8 3 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.868061
np = 13
lnL0 = -1058.734242
Iterating by ming2
Initial: fx= 1058.734242
x= 0.09967 0.14251 0.05428 0.14101 0.25950 0.07650 0.04674 0.05555 1.38512 1.30161 0.30442 0.49928 2.19979
1 h-m-p 0.0000 0.0132 59.3701 ++++CYCCC 1056.377284 4 0.0017 30 | 0/13
2 h-m-p 0.0010 0.0049 94.9212 +CYCCC 1040.866861 4 0.0042 54 | 0/13
3 h-m-p 0.0004 0.0018 56.8104 YCCCC 1040.314243 4 0.0006 77 | 0/13
4 h-m-p 0.0021 0.0167 16.7768 YCCC 1039.698338 3 0.0051 98 | 0/13
5 h-m-p 0.0017 0.0171 49.8211 +YCCCCC 1037.143412 5 0.0076 124 | 0/13
6 h-m-p 0.0031 0.0156 118.7216 CCCC 1033.772300 3 0.0048 146 | 0/13
7 h-m-p 0.0030 0.0151 90.6800 CCCCC 1031.946902 4 0.0036 170 | 0/13
8 h-m-p 0.0041 0.0205 20.8230 YCCC 1031.715388 3 0.0023 191 | 0/13
9 h-m-p 0.0093 0.0950 5.2578 YCC 1031.629291 2 0.0040 210 | 0/13
10 h-m-p 0.0041 0.2070 5.2543 ++YCCC 1030.120250 3 0.0462 233 | 0/13
11 h-m-p 0.0174 0.0872 3.9931 YCCC 1029.983960 3 0.0109 254 | 0/13
12 h-m-p 0.0017 0.0625 24.9897 +++ 1025.715037 m 0.0625 271 | 1/13
13 h-m-p 0.2502 1.2508 0.6535 CCCCC 1024.432694 4 0.3574 295 | 1/13
14 h-m-p 0.2049 2.1152 1.1397 CYC 1023.779255 2 0.2187 326 | 1/13
15 h-m-p 1.3297 6.6486 0.1121 YYCC 1023.510041 3 0.9520 346 | 1/13
16 h-m-p 1.0288 7.9063 0.1038 YCC 1023.471263 2 0.5951 377 | 1/13
17 h-m-p 0.6651 8.0000 0.0928 CCC 1023.448899 2 0.9987 409 | 0/13
18 h-m-p 0.4580 8.0000 0.2025 +YC 1023.413957 1 1.3908 439 | 0/13
19 h-m-p 1.6000 8.0000 0.1107 YC 1023.403321 1 1.0915 469 | 0/13
20 h-m-p 1.6000 8.0000 0.0126 YC 1023.401741 1 0.8246 499 | 0/13
21 h-m-p 0.7906 8.0000 0.0132 YC 1023.401535 1 1.5726 529 | 0/13
22 h-m-p 0.6390 8.0000 0.0324 ++ 1023.400029 m 8.0000 558 | 0/13
23 h-m-p 1.1561 8.0000 0.2245 CYCC 1023.395086 3 2.0443 592 | 0/13
24 h-m-p 1.6000 8.0000 0.2413 CYC 1023.390907 2 1.4044 624 | 0/13
25 h-m-p 1.6000 8.0000 0.0501 CC 1023.388958 1 1.3026 655 | 0/13
26 h-m-p 0.1090 8.0000 0.5986 +CCC 1023.386807 2 0.6345 689 | 0/13
27 h-m-p 1.2991 8.0000 0.2924 CC 1023.384381 1 1.2991 720 | 0/13
28 h-m-p 1.6000 8.0000 0.0867 CC 1023.382676 1 1.2146 751 | 0/13
29 h-m-p 0.2137 8.0000 0.4930 +CCC 1023.380741 2 1.1424 785 | 0/13
30 h-m-p 1.6000 8.0000 0.2574 CC 1023.379406 1 2.2238 816 | 0/13
31 h-m-p 1.6000 8.0000 0.1246 CC 1023.378635 1 1.3113 847 | 0/13
32 h-m-p 0.2839 8.0000 0.5756 +YY 1023.377976 1 0.9750 878 | 0/13
33 h-m-p 1.6000 8.0000 0.3136 YC 1023.377489 1 2.5374 908 | 0/13
34 h-m-p 1.6000 8.0000 0.1848 C 1023.377224 0 1.8442 937 | 0/13
35 h-m-p 0.6768 8.0000 0.5036 YC 1023.377078 1 1.3310 967 | 0/13
36 h-m-p 1.6000 8.0000 0.3473 YC 1023.376975 1 2.7220 997 | 0/13
37 h-m-p 1.6000 8.0000 0.3233 C 1023.376927 0 2.1432 1026 | 0/13
38 h-m-p 1.6000 8.0000 0.3438 Y 1023.376907 0 2.8347 1055 | 0/13
39 h-m-p 1.6000 8.0000 0.3365 C 1023.376899 0 2.0562 1084 | 0/13
40 h-m-p 1.6000 8.0000 0.3770 C 1023.376895 0 2.2739 1113 | 0/13
41 h-m-p 1.6000 8.0000 0.3658 C 1023.376893 0 2.1674 1142 | 0/13
42 h-m-p 1.6000 8.0000 0.3556 C 1023.376893 0 2.4742 1171 | 0/13
43 h-m-p 1.6000 8.0000 0.3652 C 1023.376892 0 2.2774 1200 | 0/13
44 h-m-p 1.6000 8.0000 0.3528 C 1023.376892 0 2.3069 1229 | 0/13
45 h-m-p 1.6000 8.0000 0.3671 C 1023.376892 0 2.2148 1258 | 0/13
46 h-m-p 1.6000 8.0000 0.3591 C 1023.376892 0 2.4106 1287 | 0/13
47 h-m-p 1.6000 8.0000 0.3789 C 1023.376892 0 2.5265 1316 | 0/13
48 h-m-p 1.6000 8.0000 0.3937 C 1023.376892 0 2.4580 1345 | 0/13
49 h-m-p 1.6000 8.0000 0.1842 C 1023.376892 0 1.7481 1374 | 0/13
50 h-m-p 0.6716 8.0000 0.4794 +Y 1023.376892 0 4.1285 1404 | 0/13
51 h-m-p 1.6000 8.0000 0.0680 Y 1023.376892 0 1.1951 1433 | 0/13
52 h-m-p 0.5741 8.0000 0.1416 ++ 1023.376892 m 8.0000 1462 | 0/13
53 h-m-p 1.5128 8.0000 0.7489 -C 1023.376892 0 0.0945 1492 | 0/13
54 h-m-p 1.3853 8.0000 0.0511 Y 1023.376892 0 1.0976 1521 | 0/13
55 h-m-p 1.6000 8.0000 0.0267 Y 1023.376892 0 1.6000 1550 | 0/13
56 h-m-p 0.5513 8.0000 0.0774 ----Y 1023.376892 0 0.0005 1583 | 0/13
57 h-m-p 1.0708 8.0000 0.0000 ----------C 1023.376892 0 0.0000 1622 | 0/13
58 h-m-p 0.0160 8.0000 0.0000 ----------Y 1023.376892 0 0.0000 1661
Out..
lnL = -1023.376892
1662 lfun, 6648 eigenQcodon, 39888 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1033.606170 S = -973.595016 -51.769540
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 98 patterns 0:17
did 20 / 98 patterns 0:17
did 30 / 98 patterns 0:17
did 40 / 98 patterns 0:17
did 50 / 98 patterns 0:17
did 60 / 98 patterns 0:17
did 70 / 98 patterns 0:17
did 80 / 98 patterns 0:17
did 90 / 98 patterns 0:17
did 98 / 98 patterns 0:17
Time used: 0:17
Model 3: discrete
TREE # 1
(1, (4, 5, 6), (2, 3)); MP score: 98
0.099670 0.142505 0.054280 0.141006 0.259497 0.076502 0.046737 0.055553 1.397365 0.981222 0.001362 0.073056 0.163742 0.245677
ntime & nrate & np: 8 4 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.521891
np = 14
lnL0 = -1026.030298
Iterating by ming2
Initial: fx= 1026.030298
x= 0.09967 0.14251 0.05428 0.14101 0.25950 0.07650 0.04674 0.05555 1.39737 0.98122 0.00136 0.07306 0.16374 0.24568
1 h-m-p 0.0000 0.0143 30.1730 +++CYC 1025.707005 2 0.0008 25 | 0/14
2 h-m-p 0.0012 0.0118 18.5594 YCCC 1025.368379 3 0.0024 47 | 0/14
3 h-m-p 0.0010 0.0052 43.6364 CCC 1025.039447 2 0.0012 68 | 0/14
4 h-m-p 0.0021 0.0223 26.3126 CCC 1024.792516 2 0.0020 89 | 0/14
5 h-m-p 0.0030 0.0245 17.2385 YCCC 1024.675920 3 0.0019 111 | 0/14
6 h-m-p 0.0038 0.0206 8.6224 YCC 1024.630184 2 0.0022 131 | 0/14
7 h-m-p 0.0024 0.0298 7.7240 YCC 1024.562035 2 0.0049 151 | 0/14
8 h-m-p 0.0008 0.0041 46.0571 YCCC 1024.414218 3 0.0017 173 | 0/14
9 h-m-p 0.0038 0.0192 7.1111 CC 1024.403053 1 0.0012 192 | 0/14
10 h-m-p 0.0160 8.0000 0.7435 ++YCCC 1024.188160 3 0.6378 216 | 0/14
11 h-m-p 0.0039 0.0636 122.6665 CC 1024.109531 1 0.0015 249 | 0/14
12 h-m-p 0.0612 0.4189 2.9734 --YC 1024.107519 1 0.0018 269 | 0/14
13 h-m-p 0.0058 2.7028 0.9384 ++CCC 1024.066563 2 0.1531 292 | 0/14
14 h-m-p 0.2019 6.5207 0.7114 +YCC 1023.813759 2 1.2842 327 | 0/14
15 h-m-p 1.6000 8.0000 0.1469 YCC 1023.638833 2 2.6186 361 | 0/14
16 h-m-p 1.6000 8.0000 0.2083 CYC 1023.513087 2 1.8312 395 | 0/14
17 h-m-p 1.3209 8.0000 0.2888 YCCC 1023.413368 3 0.7451 431 | 0/14
18 h-m-p 1.3740 8.0000 0.1566 CC 1023.382044 1 1.6347 464 | 0/14
19 h-m-p 1.6000 8.0000 0.0490 YC 1023.377365 1 1.2141 496 | 0/14
20 h-m-p 1.6000 8.0000 0.0258 YC 1023.377004 1 1.0868 528 | 0/14
21 h-m-p 1.6000 8.0000 0.0023 C 1023.376926 0 2.0756 559 | 0/14
22 h-m-p 1.5704 8.0000 0.0030 C 1023.376892 0 1.6310 590 | 0/14
23 h-m-p 1.6000 8.0000 0.0007 Y 1023.376892 0 1.0299 621 | 0/14
24 h-m-p 1.6000 8.0000 0.0000 Y 1023.376892 0 1.0087 652 | 0/14
25 h-m-p 1.6000 8.0000 0.0000 Y 1023.376892 0 0.9120 683 | 0/14
26 h-m-p 1.6000 8.0000 0.0000 Y 1023.376892 0 0.4000 714 | 0/14
27 h-m-p 0.6792 8.0000 0.0000 -Y 1023.376892 0 0.0195 746
Out..
lnL = -1023.376892
747 lfun, 2988 eigenQcodon, 17928 P(t)
Time used: 0:23
Model 7: beta
TREE # 1
(1, (4, 5, 6), (2, 3)); MP score: 98
0.099670 0.142505 0.054280 0.141006 0.259497 0.076502 0.046737 0.055553 1.397365 1.097086 1.859473
ntime & nrate & np: 8 1 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.497307
np = 11
lnL0 = -1034.200436
Iterating by ming2
Initial: fx= 1034.200436
x= 0.09967 0.14251 0.05428 0.14101 0.25950 0.07650 0.04674 0.05555 1.39737 1.09709 1.85947
1 h-m-p 0.0000 0.0373 37.2690 +++YCCC 1033.719900 3 0.0007 24 | 0/11
2 h-m-p 0.0012 0.0146 23.4011 +YYCC 1032.891879 3 0.0038 43 | 0/11
3 h-m-p 0.0009 0.0098 98.5054 +YYCCC 1030.407216 4 0.0028 64 | 0/11
4 h-m-p 0.0008 0.0039 229.2048 CYCCCC 1026.830448 5 0.0016 87 | 0/11
5 h-m-p 0.0012 0.0062 74.2926 YCC 1026.384564 2 0.0008 104 | 0/11
6 h-m-p 0.0120 0.0599 4.4298 YC 1026.359845 1 0.0022 119 | 0/11
7 h-m-p 0.0019 0.1104 5.3663 +CYC 1026.274506 2 0.0082 137 | 0/11
8 h-m-p 0.0009 0.0371 48.0331 +YCCC 1025.742083 3 0.0059 157 | 0/11
9 h-m-p 0.0027 0.0137 73.4537 YYCC 1025.443780 3 0.0021 175 | 0/11
10 h-m-p 0.0423 0.3631 3.5697 -YC 1025.424388 1 0.0043 191 | 0/11
11 h-m-p 0.0025 0.3474 6.1356 ++CCCCC 1024.935380 4 0.0634 215 | 0/11
12 h-m-p 1.2150 6.0748 0.1257 YCC 1024.661559 2 0.6703 232 | 0/11
13 h-m-p 1.6000 8.0000 0.0465 YCC 1024.633046 2 1.1638 260 | 0/11
14 h-m-p 1.6000 8.0000 0.0175 YC 1024.630643 1 1.0305 286 | 0/11
15 h-m-p 1.6000 8.0000 0.0021 C 1024.630546 0 1.6040 311 | 0/11
16 h-m-p 0.6124 8.0000 0.0055 ++ 1024.630398 m 8.0000 336 | 0/11
17 h-m-p 1.6000 8.0000 0.0033 C 1024.630229 0 1.5604 361 | 0/11
18 h-m-p 0.4181 8.0000 0.0122 +C 1024.630201 0 1.5434 387 | 0/11
19 h-m-p 1.6000 8.0000 0.0001 Y 1024.630200 0 1.0549 412 | 0/11
20 h-m-p 1.6000 8.0000 0.0000 Y 1024.630200 0 0.9798 437 | 0/11
21 h-m-p 1.6000 8.0000 0.0000 Y 1024.630200 0 1.6000 462 | 0/11
22 h-m-p 1.6000 8.0000 0.0000 C 1024.630200 0 0.4000 487 | 0/11
23 h-m-p 0.7845 8.0000 0.0000 -----C 1024.630200 0 0.0002 517
Out..
lnL = -1024.630200
518 lfun, 5698 eigenQcodon, 41440 P(t)
Time used: 0:36
Model 8: beta&w>1
TREE # 1
(1, (4, 5, 6), (2, 3)); MP score: 98
initial w for M8:NSbetaw>1 reset.
0.099670 0.142505 0.054280 0.141006 0.259497 0.076502 0.046737 0.055553 1.380903 0.900000 0.702842 1.818396 2.798628
ntime & nrate & np: 8 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.499646
np = 13
lnL0 = -1037.154781
Iterating by ming2
Initial: fx= 1037.154781
x= 0.09967 0.14251 0.05428 0.14101 0.25950 0.07650 0.04674 0.05555 1.38090 0.90000 0.70284 1.81840 2.79863
1 h-m-p 0.0000 0.0009 129.9793 ++++ 1029.316756 m 0.0009 20 | 1/13
2 h-m-p 0.0029 0.0145 18.5831 CCCCC 1028.740058 4 0.0034 44 | 1/13
3 h-m-p 0.0012 0.0131 53.3539 +YYCCC 1026.902977 4 0.0041 67 | 1/13
4 h-m-p 0.0015 0.0075 44.5739 YYC 1026.581177 2 0.0011 85 | 1/13
5 h-m-p 0.0060 0.0307 8.4939 CC 1026.531713 1 0.0018 103 | 0/13
6 h-m-p 0.0005 0.0364 28.2587 CCC 1026.360532 2 0.0005 123 | 0/13
7 h-m-p 0.0023 0.0460 5.5147 CC 1026.321668 1 0.0028 141 | 0/13
8 h-m-p 0.0045 0.1694 3.4930 CC 1026.292658 1 0.0058 159 | 0/13
9 h-m-p 0.0033 0.1008 6.0894 +YCCC 1026.091471 3 0.0275 181 | 0/13
10 h-m-p 0.0016 0.0079 73.7458 +YCCC 1025.606542 3 0.0053 203 | 0/13
11 h-m-p 0.0286 0.1429 2.8538 ++ 1025.131098 m 0.1429 219 | 0/13
12 h-m-p 0.0000 0.0000 119.0665
h-m-p: 0.00000000e+00 0.00000000e+00 1.19066536e+02 1025.131098
.. | 0/13
13 h-m-p 0.0000 0.0041 33.4056 +++YC 1024.853154 1 0.0005 252 | 0/13
14 h-m-p 0.0003 0.0016 16.3744 YCCC 1024.773726 3 0.0007 273 | 0/13
15 h-m-p 0.0018 0.0463 6.2154 YC 1024.751861 1 0.0013 290 | 0/13
16 h-m-p 0.0014 0.0299 5.9522 CC 1024.730395 1 0.0021 308 | 0/13
17 h-m-p 0.0012 0.0451 10.3433 YC 1024.699045 1 0.0021 325 | 0/13
18 h-m-p 0.0021 0.0341 10.0729 YCC 1024.679047 2 0.0016 344 | 0/13
19 h-m-p 0.0024 0.1072 6.5195 YC 1024.670611 1 0.0013 361 | 0/13
20 h-m-p 0.0021 0.1348 3.8826 CC 1024.664568 1 0.0020 379 | 0/13
21 h-m-p 0.0034 0.1501 2.2033 YC 1024.657124 1 0.0060 396 | 0/13
22 h-m-p 0.0013 0.0932 10.3817 +YCC 1024.607455 2 0.0088 416 | 0/13
23 h-m-p 0.0087 0.1179 10.4835 CC 1024.598237 1 0.0017 434 | 0/13
24 h-m-p 0.0542 8.0000 0.3377 ++++ 1024.281662 m 8.0000 452 | 0/13
25 h-m-p 1.6000 8.0000 0.2312 CC 1024.118733 1 1.3687 483 | 0/13
26 h-m-p 0.4835 4.1125 0.6545 +YCCC 1024.004273 3 2.4647 518 | 0/13
27 h-m-p 1.5831 8.0000 1.0190 YCCC 1023.829368 3 2.7488 552 | 0/13
28 h-m-p 1.0854 5.4272 1.3371 +YC 1023.711965 1 2.7916 570 | 0/13
29 h-m-p 1.5267 8.0000 2.4450 CCC 1023.617088 2 2.3530 590 | 0/13
30 h-m-p 1.2227 6.1133 3.1487 +YC 1023.545141 1 3.0633 608 | 0/13
31 h-m-p 1.6000 8.0000 4.5976 YCCC 1023.500222 3 2.4723 629 | 0/13
32 h-m-p 1.6000 8.0000 6.2607 YC 1023.461990 1 3.1347 646 | 0/13
33 h-m-p 0.8448 4.2240 9.4567 +YC 1023.438630 1 2.7031 664 | 0/13
34 h-m-p 0.2206 1.1029 13.0413 ++ 1023.428244 m 1.1029 680 | 0/13
35 h-m-p 0.0000 0.0000 35.1031
h-m-p: 0.00000000e+00 0.00000000e+00 3.51031123e+01 1023.428244
.. | 0/13
36 h-m-p 0.0001 0.0459 1.0506 +YC 1023.427747 1 0.0009 711 | 0/13
37 h-m-p 0.0023 0.5846 0.4104 YC 1023.427646 1 0.0014 728 | 0/13
38 h-m-p 0.0026 1.2930 0.2532 C 1023.427627 0 0.0008 757 | 0/13
39 h-m-p 0.0035 1.7668 0.1419 C 1023.427618 0 0.0013 786 | 0/13
40 h-m-p 0.0045 2.2496 0.0775 C 1023.427615 0 0.0013 815 | 0/13
41 h-m-p 0.0121 6.0308 0.0827 Y 1023.427604 0 0.0064 844 | 0/13
42 h-m-p 0.0017 0.8358 0.5774 +YC 1023.427463 1 0.0128 875 | 0/13
43 h-m-p 0.0010 0.0660 7.2046 YC 1023.427129 1 0.0024 905 | 0/13
44 h-m-p 0.0037 0.0977 4.7138 YC 1023.426987 1 0.0016 922 | 0/13
45 h-m-p 0.0191 1.3038 0.3919 -C 1023.426973 0 0.0019 939 | 0/13
46 h-m-p 0.0060 3.0036 0.2185 ++CC 1023.426538 1 0.1194 972 | 0/13
47 h-m-p 0.3429 8.0000 0.0761 ++YC 1023.421913 1 4.5599 1004 | 0/13
48 h-m-p 1.6000 8.0000 0.0038 Y 1023.421905 0 1.0185 1033 | 0/13
49 h-m-p 1.6000 8.0000 0.0006 Y 1023.421904 0 3.1980 1062 | 0/13
50 h-m-p 1.2355 8.0000 0.0015 ++ 1023.421899 m 8.0000 1091 | 0/13
51 h-m-p 0.0150 0.0748 0.3597 ++ 1023.421888 m 0.0748 1120 | 1/13
52 h-m-p 0.4573 8.0000 0.0055 Y 1023.421887 0 0.3302 1149 | 1/13
53 h-m-p 0.7577 8.0000 0.0024 C 1023.421887 0 1.0338 1177 | 1/13
54 h-m-p 1.6000 8.0000 0.0005 C 1023.421887 0 1.3627 1205 | 1/13
55 h-m-p 1.6000 8.0000 0.0000 C 1023.421887 0 0.4000 1233 | 1/13
56 h-m-p 0.6135 8.0000 0.0000 -----------C 1023.421887 0 0.0000 1272
Out..
lnL = -1023.421887
1273 lfun, 15276 eigenQcodon, 112024 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1032.276948 S = -973.592682 -51.909130
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 98 patterns 1:12
did 20 / 98 patterns 1:12
did 30 / 98 patterns 1:12
did 40 / 98 patterns 1:13
did 50 / 98 patterns 1:13
did 60 / 98 patterns 1:13
did 70 / 98 patterns 1:13
did 80 / 98 patterns 1:13
did 90 / 98 patterns 1:13
did 98 / 98 patterns 1:14
Time used: 1:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=130
D_melanogaster_Ntf-2r-PA MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
D_sechellia_Ntf-2r-PA MSLNPQYEEIGKGFVQQYYAILDDLANRENAVNFYSVTDSFMTFEGHQIQ
D_simulans_Ntf-2r-PA MSLNPQYEEIGKGFVQQYYAIFDDPVNRENVVHFYSATDSFMTFEGRQIQ
D_yakuba_Ntf-2r-PA MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
D_erecta_Ntf-2r-PA MSLNPQYEDIGKGFVQQFYGIFDDPANRANVVNFYSATDSFMTFEGHQIQ
D_elegans_Ntf-2r-PA MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ
**** ***:*** ****:*.*:** .** *.::**..*********.***
D_melanogaster_Ntf-2r-PA GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
D_sechellia_Ntf-2r-PA GAPKILEKVQSLRFQKISIVITTVDSQPTFDGGVLIFVLGRLKCDDDPPH
D_simulans_Ntf-2r-PA GAPKILEKVQSLSFQKISIVITTVDSQPTFDGGVLISVLGRLKCDDDPPH
D_yakuba_Ntf-2r-PA GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
D_erecta_Ntf-2r-PA GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
D_elegans_Ntf-2r-PA GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH
************ **** ********** ****** *****:*******
D_melanogaster_Ntf-2r-PA AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA
D_sechellia_Ntf-2r-PA SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
D_simulans_Ntf-2r-PA SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA
D_yakuba_Ntf-2r-PA AYSQVFVLKANAGTFFVAHDIFRLNIHNSA
D_erecta_Ntf-2r-PA AFSQVFFLKANAGTFFVAHDIFRLNIHNSA
D_elegans_Ntf-2r-PA AFSQVFLLKANAGTFFVAHDIFRLNIHNSA
::**:*.**.*.*:::**************
>D_melanogaster_Ntf-2r-PA ATGTCTCTGAATCTGCAGTACGAGGACATTGGCAAGGAATTTGTCCAGCA GTACTACGCCATATTCGATGACCCGGCGAATCGGGAGAACGTGATTAATT TCTATAACGCTACCGACTCTTTCATGACCTTTGAAGGCAACCAAATACAG GGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT TGCCAGAGTGATAACCACAGTGGATTCGCAGCCAACTTCCGATGGCGGAG TTCTGATCATCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT GCATTCTCGCAGATCTTTTTGCTGAAGCCCAACGGAGGATCCCTCTTCGT GGCTCACGACATCTTCCGTCTGAACATCCACAACTCTGCC >D_sechellia_Ntf-2r-PA ATGTCGCTGAATCCGCAGTACGAGGAAATTGGAAAGGGATTTGTCCAGCA GTACTACGCCATATTGGATGACCTGGCGAATCGGGAGAACGCGGTTAATT TCTATAGCGTTACCGACTCTTTCATGACCTTTGAAGGCCACCAAATACAG GGAGCACCCAAGATTTTGGAAAAAGTTCAGAGCCTGAGATTTCAGAAGAT TAGCATAGTGATAACCACAGTGGATTCGCAGCCAACTTTCGATGGCGGAG TTCTGATCTTCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT TCCTTCTCGCAGATCTTTTTGCTGAAGCCGAACGGAGGATCCTTCTTGGT GGCCCACGACATCTTCCGCCTCAACATCCACAACTCTGCC >D_simulans_Ntf-2r-PA ATGTCGCTGAATCCGCAGTACGAGGAAATTGGAAAGGGGTTTGTCCAGCA GTACTACGCCATATTCGATGACCCGGTGAATCGGGAGAACGTGGTTCATT TCTATAGCGCTACCGACTCTTTCATGACCTTTGAAGGCCGCCAAATACAG GGAGCACCCAAGATTTTGGAAAAAGTTCAGAGCCTGAGCTTTCAGAAGAT TAGCATAGTGATAACCACAGTGGATTCGCAGCCAACTTTCGATGGCGGAG TTCTGATCTCCGTCCTTGGAAGACTAAAATGCGATGACGATCCCCCACAT TCCTTCTCGCAGATCTTTTTGCTGAAGCCGAACGGAGGATCCTTCCTTGT GGCCCACGACATCTTCCGTCTCAACATCCACAACTCTGCC >D_yakuba_Ntf-2r-PA ATGTCGCTGAATCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA GTACTATGCGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT TCTACAGCGCTACAGACTCTTTCATGACCTTTGAGGGCCACCAAATACAG GGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT TACCAGAGTGATAACCACAGTGGACTCGCAGCCTACCTTCGATGGCGGAG TTCTGATCAACGTCCTTGGAAGACTACAGTGCGATGACGATCCCCCACAC GCCTACTCGCAGGTCTTTGTCCTGAAGGCCAACGCAGGCACCTTCTTCGT GGCCCACGACATCTTCCGCCTGAACATCCACAACTCTGCC >D_erecta_Ntf-2r-PA ATGTCGCTGAACCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA GTTCTATGGGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT TCTACAGCGCTACCGACTCGTTCATGACCTTTGAAGGCCACCAAATTCAG GGCGCGCCCAAGATTCTGGAAAAAGTTCAGAGTCTGAGCTTTCAGAAGAT TAACAGAGTGATAACCACAGTGGACTCGCAGCCTACTTTCGATGGCGGGG TTTTGATCAACGTCCTTGGAAGACTGCAGTGCGATGACGATCCACCACAC GCCTTCTCACAGGTCTTCTTCCTGAAGGCCAACGCAGGAACATTCTTCGT GGCCCACGACATCTTCCGCCTCAACATCCACAACTCTGCC >D_elegans_Ntf-2r-PA ATGTCGCTGAATCCGCAGTACGAGGACATTGGCAAGGGATTTGTGCAGCA GTACTATGCGATATTCGATGACCCGGCGAATCGGGCGAACGTGGTTAATT TCTACAGCGCTACCGACTCCTTCATGACCTTTGAAGGTCACCAAATTCAG GGTGCACCTAAGATCCTCGAGAAAGTTCAGAGTCTGAGCTTTCAGAAGAT CAACCGTGTGATAACCACAGTGGATTCGCAGCCCACATTCGACGGTGGAG TGCTAATCAATGTCCTCGGAAGACTACAGTGCGATGATGATCCCCCGCAC GCCTTCTCGCAGGTATTTTTGCTAAAGGCCAACGCCGGCACCTTCTTCGT GGCCCACGACATCTTCCGTCTCAACATCCACAACTCTGCC
>D_melanogaster_Ntf-2r-PA MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA >D_sechellia_Ntf-2r-PA MSLNPQYEEIGKGFVQQYYAILDDLANRENAVNFYSVTDSFMTFEGHQIQ GAPKILEKVQSLRFQKISIVITTVDSQPTFDGGVLIFVLGRLKCDDDPPH SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA >D_simulans_Ntf-2r-PA MSLNPQYEEIGKGFVQQYYAIFDDPVNRENVVHFYSATDSFMTFEGRQIQ GAPKILEKVQSLSFQKISIVITTVDSQPTFDGGVLISVLGRLKCDDDPPH SFSQIFLLKPNGGSFLVAHDIFRLNIHNSA >D_yakuba_Ntf-2r-PA MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ GAPKILEKVQSLSFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH AYSQVFVLKANAGTFFVAHDIFRLNIHNSA >D_erecta_Ntf-2r-PA MSLNPQYEDIGKGFVQQFYGIFDDPANRANVVNFYSATDSFMTFEGHQIQ GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH AFSQVFFLKANAGTFFVAHDIFRLNIHNSA >D_elegans_Ntf-2r-PA MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQ GAPKILEKVQSLSFQKINRVITTVDSQPTFDGGVLINVLGRLQCDDDPPH AFSQVFLLKANAGTFFVAHDIFRLNIHNSA
#NEXUS
[ID: 0903319364]
begin taxa;
dimensions ntax=6;
taxlabels
D_melanogaster_Ntf-2r-PA
D_sechellia_Ntf-2r-PA
D_simulans_Ntf-2r-PA
D_yakuba_Ntf-2r-PA
D_erecta_Ntf-2r-PA
D_elegans_Ntf-2r-PA
;
end;
begin trees;
translate
1 D_melanogaster_Ntf-2r-PA,
2 D_sechellia_Ntf-2r-PA,
3 D_simulans_Ntf-2r-PA,
4 D_yakuba_Ntf-2r-PA,
5 D_erecta_Ntf-2r-PA,
6 D_elegans_Ntf-2r-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.04097007,(4:0.02260403,5:0.04739511,6:0.08624972)1.000:0.05929967,(2:0.02160932,3:0.02151814)1.000:0.03449749);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.04097007,(4:0.02260403,5:0.04739511,6:0.08624972):0.05929967,(2:0.02160932,3:0.02151814):0.03449749);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1075.67 -1084.97
2 -1075.93 -1088.14
--------------------------------------
TOTAL -1075.79 -1087.48
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.355865 0.002350 0.263453 0.451483 0.352930 1423.38 1457.80 1.000
r(A<->C){all} 0.166155 0.001634 0.089403 0.242955 0.162820 703.43 786.80 1.000
r(A<->G){all} 0.176313 0.001952 0.091315 0.259524 0.172833 697.67 824.54 1.000
r(A<->T){all} 0.100932 0.001293 0.034550 0.170886 0.097050 809.10 829.66 1.001
r(C<->G){all} 0.119717 0.001234 0.053541 0.186046 0.116557 844.10 971.15 1.000
r(C<->T){all} 0.361729 0.003250 0.249884 0.468734 0.358848 827.51 874.50 1.004
r(G<->T){all} 0.075154 0.000922 0.023789 0.137031 0.071469 831.66 851.40 1.002
pi(A){all} 0.254300 0.000416 0.213083 0.293189 0.253775 979.68 1175.25 1.000
pi(C){all} 0.270257 0.000409 0.233519 0.311621 0.269294 1049.58 1080.26 1.004
pi(G){all} 0.240103 0.000413 0.200019 0.279843 0.239742 1293.32 1397.16 1.001
pi(T){all} 0.235340 0.000413 0.196213 0.274689 0.235092 1282.18 1363.09 1.000
alpha{1,2} 0.318771 0.051775 0.000518 0.719519 0.265575 1389.31 1442.13 1.000
alpha{3} 1.734423 0.529780 0.568419 3.193125 1.597159 1367.20 1384.34 1.000
pinvar{all} 0.103088 0.006910 0.000016 0.262699 0.083518 1243.91 1360.80 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/330/Ntf-2r-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 130
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 3 4 | Ser TCT 3 2 2 2 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 6 7 7 7 11 8 | TCC 2 2 3 0 0 1 | TAC 3 3 3 4 2 3 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 4 2 0 1 1 | TCG 2 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 2 1 1 0 | Pro CCT 0 0 0 1 1 1 | His CAT 1 1 2 0 0 0 | Arg CGT 1 0 1 0 0 2
CTC 1 1 1 0 1 3 | CCC 3 2 2 2 1 2 | CAC 2 3 2 4 4 4 | CGC 0 1 1 1 1 0
CTA 1 1 1 1 0 3 | CCA 2 2 2 1 2 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 7 5 4 6 5 2 | CCG 1 2 3 2 2 3 | CAG 8 8 8 9 9 9 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 3 3 3 4 2 | Thr ACT 1 1 1 0 1 0 | Asn AAT 3 3 2 3 2 4 | Ser AGT 1 0 0 1 1 1
ATC 5 4 4 3 3 5 | ACC 3 3 3 5 3 4 | AAC 6 4 4 5 7 5 | AGC 1 3 4 2 2 2
ATA 3 4 4 3 2 2 | ACA 1 1 1 2 2 2 | Lys AAA 2 2 2 1 1 1 | Arg AGA 2 2 1 2 2 1
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 0 0 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 4 3 3 3 2 | Ala GCT 2 0 1 1 1 1 | Asp GAT 5 5 5 4 4 5 | Gly GGT 0 0 0 0 0 3
GTC 2 2 2 3 2 1 | GCC 3 3 3 4 4 5 | GAC 5 4 4 6 6 5 | GGC 3 2 2 4 4 2
GTA 0 0 0 0 0 1 | GCA 2 1 1 2 1 1 | Glu GAA 3 3 3 1 2 1 | GGA 5 7 6 4 3 3
GTG 4 3 5 5 5 6 | GCG 1 2 0 3 3 3 | GAG 2 2 2 2 1 2 | GGG 0 0 1 0 2 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Ntf-2r-PA
position 1: T:0.17692 C:0.23077 A:0.29231 G:0.30000
position 2: T:0.33077 C:0.20000 A:0.35385 G:0.11538
position 3: T:0.22308 C:0.35385 A:0.16923 G:0.25385
Average T:0.24359 C:0.26154 A:0.27179 G:0.22308
#2: D_sechellia_Ntf-2r-PA
position 1: T:0.20769 C:0.22308 A:0.27692 G:0.29231
position 2: T:0.34615 C:0.18462 A:0.33846 G:0.13077
position 3: T:0.19231 C:0.34615 A:0.18462 G:0.27692
Average T:0.24872 C:0.25128 A:0.26667 G:0.23333
#3: D_simulans_Ntf-2r-PA
position 1: T:0.20000 C:0.23846 A:0.26923 G:0.29231
position 2: T:0.33846 C:0.19231 A:0.33077 G:0.13846
position 3: T:0.20769 C:0.35385 A:0.16923 G:0.26923
Average T:0.24872 C:0.26154 A:0.25641 G:0.23333
#4: D_yakuba_Ntf-2r-PA
position 1: T:0.16923 C:0.23077 A:0.27692 G:0.32308
position 2: T:0.31538 C:0.21538 A:0.34615 G:0.12308
position 3: T:0.18462 C:0.39231 A:0.13846 G:0.28462
Average T:0.22308 C:0.27949 A:0.25385 G:0.24359
#5: D_erecta_Ntf-2r-PA
position 1: T:0.18462 C:0.22308 A:0.27692 G:0.31538
position 2: T:0.33077 C:0.20000 A:0.33846 G:0.13077
position 3: T:0.17692 C:0.40000 A:0.13077 G:0.29231
Average T:0.23077 C:0.27436 A:0.24872 G:0.24615
#6: D_elegans_Ntf-2r-PA
position 1: T:0.17692 C:0.23846 A:0.26923 G:0.31538
position 2: T:0.32308 C:0.20769 A:0.34615 G:0.12308
position 3: T:0.20769 C:0.39231 A:0.12308 G:0.27692
Average T:0.23590 C:0.27949 A:0.24615 G:0.23846
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 23 | Ser S TCT 11 | Tyr Y TAT 6 | Cys C TGT 0
TTC 46 | TCC 8 | TAC 18 | TGC 6
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 9 | TCG 17 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 3 | His H CAT 4 | Arg R CGT 4
CTC 7 | CCC 12 | CAC 19 | CGC 4
CTA 7 | CCA 9 | Gln Q CAA 6 | CGA 0
CTG 29 | CCG 13 | CAG 51 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 19 | Thr T ACT 4 | Asn N AAT 17 | Ser S AGT 4
ATC 24 | ACC 21 | AAC 31 | AGC 14
ATA 18 | ACA 9 | Lys K AAA 9 | Arg R AGA 10
Met M ATG 12 | ACG 0 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 17 | Ala A GCT 6 | Asp D GAT 28 | Gly G GGT 3
GTC 12 | GCC 22 | GAC 30 | GGC 17
GTA 1 | GCA 8 | Glu E GAA 13 | GGA 28
GTG 28 | GCG 12 | GAG 11 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18590 C:0.23077 A:0.27692 G:0.30641
position 2: T:0.33077 C:0.20000 A:0.34231 G:0.12692
position 3: T:0.19872 C:0.37308 A:0.15256 G:0.27564
Average T:0.23846 C:0.26795 A:0.25726 G:0.23632
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Ntf-2r-PA
D_sechellia_Ntf-2r-PA 0.6089 (0.0660 0.1084)
D_simulans_Ntf-2r-PA 0.5151 (0.0624 0.1211) 0.9843 (0.0340 0.0345)
D_yakuba_Ntf-2r-PA 0.2879 (0.0607 0.2108) 0.3149 (0.0715 0.2270) 0.2351 (0.0642 0.2732)
D_erecta_Ntf-2r-PA 0.1857 (0.0658 0.3545) 0.2155 (0.0730 0.3388) 0.1673 (0.0658 0.3932) 0.0757 (0.0168 0.2215)
D_elegans_Ntf-2r-PA 0.1099 (0.0587 0.5342) 0.1291 (0.0695 0.5382) 0.1112 (0.0623 0.5600) 0.0362 (0.0151 0.4169) 0.0245 (0.0134 0.5445)
Model 0: one-ratio
TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 98
lnL(ntime: 8 np: 10): -1026.986289 +0.000000
7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3
0.104339 0.140068 0.066961 0.137080 0.238653 0.084249 0.051103 0.057188 1.380088 0.146112
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87964
(1: 0.104339, (4: 0.066961, 5: 0.137080, 6: 0.238653): 0.140068, (2: 0.051103, 3: 0.057188): 0.084249);
(D_melanogaster_Ntf-2r-PA: 0.104339, (D_yakuba_Ntf-2r-PA: 0.066961, D_erecta_Ntf-2r-PA: 0.137080, D_elegans_Ntf-2r-PA: 0.238653): 0.140068, (D_sechellia_Ntf-2r-PA: 0.051103, D_simulans_Ntf-2r-PA: 0.057188): 0.084249);
Detailed output identifying parameters
kappa (ts/tv) = 1.38009
omega (dN/dS) = 0.14611
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.104 302.7 87.3 0.1461 0.0151 0.1031 4.6 9.0
7..8 0.140 302.7 87.3 0.1461 0.0202 0.1385 6.1 12.1
8..4 0.067 302.7 87.3 0.1461 0.0097 0.0662 2.9 5.8
8..5 0.137 302.7 87.3 0.1461 0.0198 0.1355 6.0 11.8
8..6 0.239 302.7 87.3 0.1461 0.0345 0.2359 10.4 20.6
7..9 0.084 302.7 87.3 0.1461 0.0122 0.0833 3.7 7.3
9..2 0.051 302.7 87.3 0.1461 0.0074 0.0505 2.2 4.4
9..3 0.057 302.7 87.3 0.1461 0.0083 0.0565 2.5 4.9
tree length for dN: 0.1271
tree length for dS: 0.8696
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 98
lnL(ntime: 8 np: 11): -1023.443183 +0.000000
7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3
0.105972 0.144832 0.063497 0.135325 0.245592 0.085741 0.052331 0.056976 1.385124 0.946093 0.104337
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89027
(1: 0.105972, (4: 0.063497, 5: 0.135325, 6: 0.245592): 0.144832, (2: 0.052331, 3: 0.056976): 0.085741);
(D_melanogaster_Ntf-2r-PA: 0.105972, (D_yakuba_Ntf-2r-PA: 0.063497, D_erecta_Ntf-2r-PA: 0.135325, D_elegans_Ntf-2r-PA: 0.245592): 0.144832, (D_sechellia_Ntf-2r-PA: 0.052331, D_simulans_Ntf-2r-PA: 0.056976): 0.085741);
Detailed output identifying parameters
kappa (ts/tv) = 1.38512
dN/dS (w) for site classes (K=2)
p: 0.94609 0.05391
w: 0.10434 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.106 302.7 87.3 0.1526 0.0157 0.1032 4.8 9.0
7..8 0.145 302.7 87.3 0.1526 0.0215 0.1410 6.5 12.3
8..4 0.063 302.7 87.3 0.1526 0.0094 0.0618 2.9 5.4
8..5 0.135 302.7 87.3 0.1526 0.0201 0.1318 6.1 11.5
8..6 0.246 302.7 87.3 0.1526 0.0365 0.2391 11.0 20.9
7..9 0.086 302.7 87.3 0.1526 0.0127 0.0835 3.9 7.3
9..2 0.052 302.7 87.3 0.1526 0.0078 0.0510 2.4 4.4
9..3 0.057 302.7 87.3 0.1526 0.0085 0.0555 2.6 4.8
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 98
lnL(ntime: 8 np: 13): -1023.376892 +0.000000
7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3
0.106481 0.145211 0.063276 0.135258 0.246542 0.085828 0.052444 0.056833 1.397365 0.958597 0.000000 0.109488 1.284156
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89187
(1: 0.106481, (4: 0.063276, 5: 0.135258, 6: 0.246542): 0.145211, (2: 0.052444, 3: 0.056833): 0.085828);
(D_melanogaster_Ntf-2r-PA: 0.106481, (D_yakuba_Ntf-2r-PA: 0.063276, D_erecta_Ntf-2r-PA: 0.135258, D_elegans_Ntf-2r-PA: 0.246542): 0.145211, (D_sechellia_Ntf-2r-PA: 0.052444, D_simulans_Ntf-2r-PA: 0.056833): 0.085828);
Detailed output identifying parameters
kappa (ts/tv) = 1.39737
dN/dS (w) for site classes (K=3)
p: 0.95860 0.00000 0.04140
w: 0.10949 1.00000 1.28416
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.106 302.5 87.5 0.1581 0.0162 0.1023 4.9 8.9
7..8 0.145 302.5 87.5 0.1581 0.0221 0.1395 6.7 12.2
8..4 0.063 302.5 87.5 0.1581 0.0096 0.0608 2.9 5.3
8..5 0.135 302.5 87.5 0.1581 0.0205 0.1299 6.2 11.4
8..6 0.247 302.5 87.5 0.1581 0.0375 0.2369 11.3 20.7
7..9 0.086 302.5 87.5 0.1581 0.0130 0.0825 3.9 7.2
9..2 0.052 302.5 87.5 0.1581 0.0080 0.0504 2.4 4.4
9..3 0.057 302.5 87.5 0.1581 0.0086 0.0546 2.6 4.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ntf-2r-PA)
Pr(w>1) post mean +- SE for w
68 A 0.987* 1.268
87 I 0.845 1.103
107 L 0.792 1.040
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ntf-2r-PA)
Pr(w>1) post mean +- SE for w
68 A 0.602 1.890 +- 1.396
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.131 0.869 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.481 0.227 0.108 0.058 0.036 0.025 0.020 0.017 0.015 0.014
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.061
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.042 0.891
sum of density on p0-p1 = 1.000000
Time used: 0:17
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 98
lnL(ntime: 8 np: 14): -1023.376892 +0.000000
7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3
0.106481 0.145211 0.063276 0.135258 0.246542 0.085828 0.052444 0.056833 1.397365 0.100445 0.858151 0.109488 0.109488 1.284156
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89187
(1: 0.106481, (4: 0.063276, 5: 0.135258, 6: 0.246542): 0.145211, (2: 0.052444, 3: 0.056833): 0.085828);
(D_melanogaster_Ntf-2r-PA: 0.106481, (D_yakuba_Ntf-2r-PA: 0.063276, D_erecta_Ntf-2r-PA: 0.135258, D_elegans_Ntf-2r-PA: 0.246542): 0.145211, (D_sechellia_Ntf-2r-PA: 0.052444, D_simulans_Ntf-2r-PA: 0.056833): 0.085828);
Detailed output identifying parameters
kappa (ts/tv) = 1.39737
dN/dS (w) for site classes (K=3)
p: 0.10045 0.85815 0.04140
w: 0.10949 0.10949 1.28416
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.106 302.5 87.5 0.1581 0.0162 0.1023 4.9 8.9
7..8 0.145 302.5 87.5 0.1581 0.0221 0.1395 6.7 12.2
8..4 0.063 302.5 87.5 0.1581 0.0096 0.0608 2.9 5.3
8..5 0.135 302.5 87.5 0.1581 0.0205 0.1299 6.2 11.4
8..6 0.247 302.5 87.5 0.1581 0.0375 0.2369 11.3 20.7
7..9 0.086 302.5 87.5 0.1581 0.0130 0.0825 3.9 7.2
9..2 0.052 302.5 87.5 0.1581 0.0080 0.0504 2.4 4.4
9..3 0.057 302.5 87.5 0.1581 0.0086 0.0546 2.6 4.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ntf-2r-PA)
Pr(w>1) post mean +- SE for w
68 A 0.987* 1.268
87 I 0.845 1.103
107 L 0.792 1.040
Time used: 0:23
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 98
lnL(ntime: 8 np: 11): -1024.630200 +0.000000
7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3
0.105389 0.144188 0.064853 0.136223 0.243533 0.084985 0.052692 0.057245 1.380903 0.577567 3.094836
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.88911
(1: 0.105389, (4: 0.064853, 5: 0.136223, 6: 0.243533): 0.144188, (2: 0.052692, 3: 0.057245): 0.084985);
(D_melanogaster_Ntf-2r-PA: 0.105389, (D_yakuba_Ntf-2r-PA: 0.064853, D_erecta_Ntf-2r-PA: 0.136223, D_elegans_Ntf-2r-PA: 0.243533): 0.144188, (D_sechellia_Ntf-2r-PA: 0.052692, D_simulans_Ntf-2r-PA: 0.057245): 0.084985);
Detailed output identifying parameters
kappa (ts/tv) = 1.38090
Parameters in M7 (beta):
p = 0.57757 q = 3.09484
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00159 0.01076 0.02661 0.04909 0.07893 0.11767 0.16815 0.23597 0.33452 0.51575
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.105 302.7 87.3 0.1539 0.0158 0.1023 4.8 8.9
7..8 0.144 302.7 87.3 0.1539 0.0215 0.1400 6.5 12.2
8..4 0.065 302.7 87.3 0.1539 0.0097 0.0630 2.9 5.5
8..5 0.136 302.7 87.3 0.1539 0.0204 0.1323 6.2 11.5
8..6 0.244 302.7 87.3 0.1539 0.0364 0.2365 11.0 20.6
7..9 0.085 302.7 87.3 0.1539 0.0127 0.0825 3.8 7.2
9..2 0.053 302.7 87.3 0.1539 0.0079 0.0512 2.4 4.5
9..3 0.057 302.7 87.3 0.1539 0.0086 0.0556 2.6 4.9
Time used: 0:36
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5, 6), (2, 3)); MP score: 98
lnL(ntime: 8 np: 13): -1023.421887 +0.000000
7..1 7..8 8..4 8..5 8..6 7..9 9..2 9..3
0.106466 0.145210 0.063325 0.135326 0.246499 0.085786 0.052482 0.056839 1.397791 0.959920 12.399849 99.000000 1.297970
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89193
(1: 0.106466, (4: 0.063325, 5: 0.135326, 6: 0.246499): 0.145210, (2: 0.052482, 3: 0.056839): 0.085786);
(D_melanogaster_Ntf-2r-PA: 0.106466, (D_yakuba_Ntf-2r-PA: 0.063325, D_erecta_Ntf-2r-PA: 0.135326, D_elegans_Ntf-2r-PA: 0.246499): 0.145210, (D_sechellia_Ntf-2r-PA: 0.052482, D_simulans_Ntf-2r-PA: 0.056839): 0.085786);
Detailed output identifying parameters
kappa (ts/tv) = 1.39779
Parameters in M8 (beta&w>1):
p0 = 0.95992 p = 12.39985 q = 99.00000
(p1 = 0.04008) w = 1.29797
dN/dS (w) for site classes (K=11)
p: 0.09599 0.09599 0.09599 0.09599 0.09599 0.09599 0.09599 0.09599 0.09599 0.09599 0.04008
w: 0.06677 0.08090 0.09013 0.09795 0.10531 0.11273 0.12071 0.12997 0.14210 0.16379 1.29797
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.106 302.5 87.5 0.1586 0.0162 0.1022 4.9 8.9
7..8 0.145 302.5 87.5 0.1586 0.0221 0.1394 6.7 12.2
8..4 0.063 302.5 87.5 0.1586 0.0096 0.0608 2.9 5.3
8..5 0.135 302.5 87.5 0.1586 0.0206 0.1299 6.2 11.4
8..6 0.246 302.5 87.5 0.1586 0.0375 0.2366 11.4 20.7
7..9 0.086 302.5 87.5 0.1586 0.0131 0.0823 4.0 7.2
9..2 0.052 302.5 87.5 0.1586 0.0080 0.0504 2.4 4.4
9..3 0.057 302.5 87.5 0.1586 0.0087 0.0545 2.6 4.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ntf-2r-PA)
Pr(w>1) post mean +- SE for w
68 A 0.981* 1.276
87 I 0.818 1.085
107 L 0.768 1.026
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Ntf-2r-PA)
Pr(w>1) post mean +- SE for w
68 A 0.753 1.649 +- 1.011
87 I 0.528 1.280 +- 0.923
107 L 0.515 1.209 +- 0.780
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.996
p : 0.705 0.286 0.009 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.017 0.063 0.103 0.122 0.134 0.153 0.184 0.225
ws: 0.710 0.175 0.056 0.023 0.012 0.007 0.005 0.004 0.004 0.003
Time used: 1:14
Model 1: NearlyNeutral -1023.443183 Model 2: PositiveSelection -1023.376892 Model 0: one-ratio -1026.986289 Model 3: discrete -1023.376892 Model 7: beta -1024.6302 Model 8: beta&w>1 -1023.421887 Model 0 vs 1 7.086211999999932 Model 2 vs 1 0.13258199999995668 Model 8 vs 7 2.4166260000001785
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
