--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Wed Nov 23 06:33:47 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/314/mspo-PB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -4410.96 -4418.93 2 -4411.01 -4419.38 -------------------------------------- TOTAL -4410.99 -4419.18 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.476636 0.002801 0.381157 0.580889 0.471467 1304.30 1351.43 1.000 r(A<->C){all} 0.058782 0.000285 0.028831 0.094151 0.057724 786.44 950.01 1.000 r(A<->G){all} 0.238230 0.001196 0.172897 0.305937 0.237831 1076.90 1129.24 1.000 r(A<->T){all} 0.108730 0.000827 0.055297 0.164574 0.107444 578.62 888.89 1.000 r(C<->G){all} 0.095500 0.000333 0.061689 0.133421 0.094701 1345.71 1359.67 1.000 r(C<->T){all} 0.419414 0.001896 0.333084 0.504151 0.417475 856.32 957.42 1.000 r(G<->T){all} 0.079344 0.000555 0.034113 0.124766 0.078242 1047.87 1078.34 1.000 pi(A){all} 0.232590 0.000090 0.214692 0.251781 0.232700 1394.70 1447.85 1.000 pi(C){all} 0.308114 0.000103 0.289408 0.328941 0.307846 1313.47 1407.23 1.000 pi(G){all} 0.277976 0.000098 0.258736 0.296644 0.277676 1290.86 1373.64 1.000 pi(T){all} 0.181319 0.000070 0.164645 0.197662 0.181283 1240.06 1305.89 1.002 alpha{1,2} 0.064917 0.001653 0.000154 0.133360 0.062762 1153.15 1218.65 1.000 alpha{3} 2.376066 0.649268 0.921211 3.936698 2.268624 1395.76 1448.38 1.000 pinvar{all} 0.325988 0.004400 0.199642 0.457341 0.323899 1344.96 1389.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3851.338429 Model 2: PositiveSelection -3838.736035 Model 0: one-ratio -3920.83791 Model 3: discrete -3838.580039 Model 7: beta -3852.285111 Model 8: beta&w>1 -3838.592251 Model 0 vs 1 138.99896200000057 Model 2 vs 1 25.204788000000008 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_mspo-PB) Pr(w>1) post mean +- SE for w 202 F 1.000** 78.818 206 A 0.795 62.872 207 A 0.984* 77.578 474 I 0.982* 77.427 482 A 0.645 51.194 483 V 0.546 43.494 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_mspo-PB) Pr(w>1) post mean +- SE for w 24 L 0.511 3.854 +- 3.436 183 V 0.581 4.262 +- 3.462 202 F 0.995** 7.105 +- 2.661 206 A 0.926 6.686 +- 3.000 207 A 0.963* 6.927 +- 2.829 214 G 0.713 5.201 +- 3.497 215 G 0.598 4.498 +- 3.575 464 A 0.641 4.723 +- 3.537 474 I 0.975* 7.009 +- 2.761 482 A 0.669 4.953 +- 3.555 483 V 0.770 5.590 +- 3.433 Model 8 vs 7 27.38572000000022 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_mspo-PB) Pr(w>1) post mean +- SE for w 202 F 1.000** 77.243 206 A 0.836 64.762 207 A 0.988* 76.325 474 I 0.986* 76.220 482 A 0.681 52.905 483 V 0.602 46.909 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_mspo-PB) Pr(w>1) post mean +- SE for w 24 L 0.807 3.323 +- 1.864 29 N 0.890 3.597 +- 1.657 33 A 0.691 2.864 +- 1.934 53 P 0.535 2.315 +- 2.000 54 D 0.542 2.250 +- 1.842 55 E 0.516 2.224 +- 1.956 81 V 0.696 2.847 +- 1.875 183 V 0.911 3.693 +- 1.639 201 S 0.692 2.903 +- 1.984 202 F 0.999** 4.002 +- 1.420 205 T 0.573 2.379 +- 1.874 206 A 0.986* 3.965 +- 1.459 207 A 0.992** 3.984 +- 1.440 210 A 0.770 3.131 +- 1.781 214 G 0.940 3.807 +- 1.584 215 G 0.828 3.420 +- 1.853 464 A 0.881 3.602 +- 1.739 474 I 0.994** 3.989 +- 1.436 478 K 0.612 2.528 +- 1.847 479 A 0.570 2.418 +- 1.966 482 A 0.916 3.726 +- 1.645 483 V 0.963* 3.882 +- 1.523 493 S 0.511 2.168 +- 1.882
>C1 MGATPKTDFPAHWLLCILLALGSLSSKANAVSAYGASFISNPSIYAYSVE NQPDERESRDNNIKFAAEHGNLNSNSNLNRNYYYTDDPSPVSNLNPTASL ATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHYPDWRPTAQWTK TLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNAGEQQQVQMQLQ SQMQAGKSPSGGISSGTTSFNATAASTATPTGGSGGSGGSGGSGGTGTTT AERSVFDEFSMPAIPMGAGRSEAKVFVDSNHSLVSLMTRIVPSPDWFIGV DSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWPTEPQGVIYRITS RYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVFNIAEDDRKYETV QTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQNDDERQRIRSQLLA KMNPIYGSNNSLQPAPGQVVSVVPKNDKHAILQSIASSYRRAADASDANA SKPTPSAIGGGKAGGAVGGGAATRRRSSAQRRRDCRVSHWSEWTACSKSC GVGEMHRYRKVIKHGKRGGRQCPALQQSKWCGTERNCHGSQTYFNWSDSD T >C2 MGATPKTDFPAHWLLCILLALGSISSKASAVSSYGASFISNPSIYAYSVE NQAEQHESRDNSIKFAAEHGNLNSNSNLNRNYYFTDDPSPVPNLNLNLNP TASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHYPDWRPTA QWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNAGEQQQVQ MQSLMQTGKSPSGGITSSSSSSGTTTFNTTATPTGGSGGNGGNGGTTERS VFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMTRIVPSPDWFIGVDSFE LCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWPTEPQGVIYRITSRYPG HPAGSFYYPKSKRLPPIATFQFIKLREYELSEVFNIAEDDRKYETVQTQT HLDAEHNHVEMNNELSASIERERQTEQQQLQHNDDERQRIRSQLLAKMNP IYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASSYRRAADASDSNASKPT PFAAGGGGKAGGAVGGAASRRRSSAQRRRDCRVSHWSEWTACSKSCGVGE MHRYRKVIKHGKRGGRQCPALQQSKWCGTERNCHGSQSYFNWSDSDTooo o >C3 MGATPKTDFPAHWLLFILVALGSSSSFSRSSQAYAVSSYGASFISNPSIY AYSVENQPEQRETNNNIKFAEQNSNSNLNRNYYYTDDPSPIPNPTPSLAT PPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHYPDWRPTAQWTKTL GRTHNANYALYHIGQPATSAVKQFAESGRTDLLDSNAGEQQQMQMQLQTG KSPSGGTSSSSSTNSFNTTSTSSSTAASGGGNGGSPTTERSVFDEFSMPA IPLGAGRSEAKVFVDSNHSLVSLMTRIVPSPDWFIGVDSFELCVGGSWID TVTVELDPLDAGTDNGFTFTAPNWPTAPQGVIYRITSRYPGHPAGSFYYP KSKRLPPIATFQFIKLKEYELSEVFNIAEDDRKYETVQTQTHLDAEHNHV EMNNELSASIERERQTEQQQLQQNDDERQRIRSQLLAKMNPIYSSNNSLQ PAPGQVVSVVPKNDKHAILQSIASSYRRATDASNLNASNPTASQSPLAGG KVAGAGSGGGAGSGATRRRSMAQRRRDCRVSHWSEWTACSKSCGVGEMHR YRKVIKHGKRGGRQCPALQQSKWCGTERNCHGSQTYFNWSDSDToooooo o >C4 MGATPKTDFLAHWLLFILLGLGFISPKADAVGAYGASFISNPSIYAYSVE NQQGENVKFEDQNGILNSNSNLNRNYYFTDDPRPNSNPNTNLNADPTASL NTPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHYPDWRPTAQWTK TLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSSAGEQQQQQMQMQ TGKSPPGGTSSTNTTSPATNGGTTSTTTSTSTERSVFDEFSMPAIPLGAG RSEAKVFVDSNHSLVSLMTRIVPSPDWFIGVDSFELCVGGSWIDTVTVEL DPLDAGTDNGFTFTAPNWPTAPQGVIYRITSRYPAHPAGSFYYPKSKRLP PIATFQFIKLKEYELSEVFNIAEDDRKYETVQTQTHLDAEHNHVEMNNEL SASIERERQTEQQQLQQFDDDRQRIRSQLLAKMNPIYSSNNSLQPSPGQV VSVVPKNDKHAILQSIASSYRRATDAGNSNGSNPTAPQSPPAGGKLGGLE GAMGGATRRRSSAQRRRDCRVSHWSEWTACSKSCGIGEMHRYRKVIKHGK RGGRPCPALQQSKWCGTERNCHGSQTYFNWSDSDTooooooooooooooo o CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=635 C1 MGATPKTDFPAHWLLCILLALG-----SLSSKANAVSAYGASFISNPSIY C2 MGATPKTDFPAHWLLCILLALG-----SISSKASAVSSYGASFISNPSIY C3 MGATPKTDFPAHWLLFILVALGSSSSFSRSSQAYAVSSYGASFISNPSIY C4 MGATPKTDFLAHWLLFILLGLG-----FISPKADAVGAYGASFISNPSIY ********* ***** **:.** *.:* **.:************ C1 AYSVENQPDERESRDNNIKFAAEHGNLNSNSNLNRNYYYTDDPSPVS--- C2 AYSVENQAEQHESRDNSIKFAAEHGNLNSNSNLNRNYYFTDDPSPVPN-- C3 AYSVENQPEQRETN-NNIKFAEQ----NSNSNLNRNYYYTDDPSPIP--- C4 AYSVENQQGE------NVKFEDQNGILNSNSNLNRNYYFTDDPRPNSNPN ******* : .:** : ***********:**** * . C1 ---NLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY C2 LNLNLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY C3 -----NPTPSLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY C4 TNLNADPTASLNTPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY :**.** ************************************** C1 PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA C2 PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA C3 PDWRPTAQWTKTLGRTHNANYALYHIGQPATSAVKQFAESGRTDLLDSNA C4 PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSSA *******************************:****************.* C1 GEQQQVQMQLQSQMQAGKSPSGGISSG-TTSFNATAASTATPTGGSGGSG C2 GEQQQVQMQ--SLMQTGKSPSGGITSSSSSSGTTTFNTTATPTGGSGGNG C3 GEQQQMQMQ----LQTGKSPSGGTSSS---SSTNSFNTTSTSSSTAASGG C4 GEQQQQQMQ----MQTGKSPPGGTSSTNTTSPATNGGTTSTTTSTS---- ***** *** :*:****.** :* * . :*:*.:. : C1 GSGGSGGTGTTTAERSVFDEFSMPAIPMGAGRSEAKVFVDSNHSLVSLMT C2 GNGG-------TTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT C3 GNGGS-----PTTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT C4 ------------TERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT :**************:********************** C1 RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP C2 RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP C3 RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP C4 RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP ************************************************** C1 TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF C2 TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLREYELSEVF C3 TAPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF C4 TAPQGVIYRITSRYPAHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF * *************.*************************:******** C1 NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND C2 NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQHND C3 NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND C4 NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQFD ***********************************************: * C1 DERQRIRSQLLAKMNPIYGSNNSLQPAPGQVVSVVPKNDKHAILQSIASS C2 DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS C3 DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS C4 DDRQRIRSQLLAKMNPIYSSNNSLQPSPGQVVSVVPKNDKHAILQSIASS *:****************.*******:*********************** C1 YRRAADASDANASKPTP--SAIGGG-KAGGAVGGG---AATRRRSSAQRR C2 YRRAADASDSNASKPTP--FAAGGGGKAGGAVGG----AASRRRSSAQRR C3 YRRATDASNLNASNPTASQSPLAGGKVAGAGSGGGAGSGATRRRSMAQRR C4 YRRATDAGNSNGSNPTAPQSPPAGG-KLGGLEGAMG--GATRRRSSAQRR ****:**.: *.*:**. . .** *. *. .*:**** **** C1 RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG C2 RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG C3 RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG C4 RDCRVSHWSEWTACSKSCGIGEMHRYRKVIKHGKRGGRPCPALQQSKWCG *******************:****************** *********** C1 TERNCHGSQTYFNWSDSDT---------------- C2 TERNCHGSQSYFNWSDSDToooo------------ C3 TERNCHGSQTYFNWSDSDTooooooo--------- C4 TERNCHGSQTYFNWSDSDToooooooooooooooo *********:********* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] gins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 601 type PROTEIN Struct Unchecked Input File /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 601 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10006] Library Relaxation: Multi_proc [72] Relaxation Summary: [10006]--->[8986] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/314/mspo-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.295 Mb, Max= 30.747 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MGATPKTDFPAHWLLCILLALG-----SLSSKANAVSAYGASFISNPSIY AYSVENQPDERESRDNNIKFAAEHGNLNSNSNLNRNYYYTDDPSPVS--- ---NLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA GEQQQVQMQLQSQMQAGKSPSGGISSG-TTSFNATAASTATPTGGSGGSG GSGGSGGTGTTTAERSVFDEFSMPAIPMGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND DERQRIRSQLLAKMNPIYGSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRAADASDANASKPTP--SAIGGG-KAGGAVGGG---AATRRRSSAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQTYFNWSDSDT---------------- >C2 MGATPKTDFPAHWLLCILLALG-----SISSKASAVSSYGASFISNPSIY AYSVENQAEQHESRDNSIKFAAEHGNLNSNSNLNRNYYFTDDPSPVPN-- LNLNLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA GEQQQVQMQ--SLMQTGKSPSGGITSSSSSSGTTTFNTTATPTGGSGGNG GNGG-------TTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLREYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQHND DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRAADASDSNASKPTP--FAAGGGGKAGGAVGG----AASRRRSSAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQSYFNWSDSDToooo------------ >C3 MGATPKTDFPAHWLLFILVALGSSSSFSRSSQAYAVSSYGASFISNPSIY AYSVENQPEQRETN-NNIKFAEQ----NSNSNLNRNYYYTDDPSPIP--- -----NPTPSLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATSAVKQFAESGRTDLLDSNA GEQQQMQMQ----LQTGKSPSGGTSSS---SSTNSFNTTSTSSSTAASGG GNGGS-----PTTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TAPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRATDASNLNASNPTASQSPLAGGKVAGAGSGGGAGSGATRRRSMAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQTYFNWSDSDTooooooo--------- >C4 MGATPKTDFLAHWLLFILLGLG-----FISPKADAVGAYGASFISNPSIY AYSVENQQGE------NVKFEDQNGILNSNSNLNRNYYFTDDPRPNSNPN TNLNADPTASLNTPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSSA GEQQQQQMQ----MQTGKSPPGGTSSTNTTSPATNGGTTSTTTSTS---- ------------TERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TAPQGVIYRITSRYPAHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQFD DDRQRIRSQLLAKMNPIYSSNNSLQPSPGQVVSVVPKNDKHAILQSIASS YRRATDAGNSNGSNPTAPQSPPAGG-KLGGLEGAMG--GATRRRSSAQRR RDCRVSHWSEWTACSKSCGIGEMHRYRKVIKHGKRGGRPCPALQQSKWCG TERNCHGSQTYFNWSDSDToooooooooooooooo FORMAT of file /tmp/tmp2021340218792711352aln Not Supported[FATAL:T-COFFEE] >C1 MGATPKTDFPAHWLLCILLALG-----SLSSKANAVSAYGASFISNPSIY AYSVENQPDERESRDNNIKFAAEHGNLNSNSNLNRNYYYTDDPSPVS--- ---NLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA GEQQQVQMQLQSQMQAGKSPSGGISSG-TTSFNATAASTATPTGGSGGSG GSGGSGGTGTTTAERSVFDEFSMPAIPMGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND DERQRIRSQLLAKMNPIYGSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRAADASDANASKPTP--SAIGGG-KAGGAVGGG---AATRRRSSAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQTYFNWSDSDT---------------- >C2 MGATPKTDFPAHWLLCILLALG-----SISSKASAVSSYGASFISNPSIY AYSVENQAEQHESRDNSIKFAAEHGNLNSNSNLNRNYYFTDDPSPVPN-- LNLNLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA GEQQQVQMQ--SLMQTGKSPSGGITSSSSSSGTTTFNTTATPTGGSGGNG GNGG-------TTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLREYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQHND DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRAADASDSNASKPTP--FAAGGGGKAGGAVGG----AASRRRSSAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQSYFNWSDSDToooo------------ >C3 MGATPKTDFPAHWLLFILVALGSSSSFSRSSQAYAVSSYGASFISNPSIY AYSVENQPEQRETN-NNIKFAEQ----NSNSNLNRNYYYTDDPSPIP--- -----NPTPSLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATSAVKQFAESGRTDLLDSNA GEQQQMQMQ----LQTGKSPSGGTSSS---SSTNSFNTTSTSSSTAASGG GNGGS-----PTTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TAPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRATDASNLNASNPTASQSPLAGGKVAGAGSGGGAGSGATRRRSMAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQTYFNWSDSDTooooooo--------- >C4 MGATPKTDFLAHWLLFILLGLG-----FISPKADAVGAYGASFISNPSIY AYSVENQQGE------NVKFEDQNGILNSNSNLNRNYYFTDDPRPNSNPN TNLNADPTASLNTPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSSA GEQQQQQMQ----MQTGKSPPGGTSSTNTTSPATNGGTTSTTTSTS---- ------------TERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TAPQGVIYRITSRYPAHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQFD DDRQRIRSQLLAKMNPIYSSNNSLQPSPGQVVSVVPKNDKHAILQSIASS YRRATDAGNSNGSNPTAPQSPPAGG-KLGGLEGAMG--GATRRRSSAQRR RDCRVSHWSEWTACSKSCGIGEMHRYRKVIKHGKRGGRPCPALQQSKWCG TERNCHGSQTYFNWSDSDToooooooooooooooo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:635 S:93 BS:635 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 94.25 C1 C2 94.25 TOP 1 0 94.25 C2 C1 94.25 BOT 0 2 90.22 C1 C3 90.22 TOP 2 0 90.22 C3 C1 90.22 BOT 0 3 88.70 C1 C4 88.70 TOP 3 0 88.70 C4 C1 88.70 BOT 1 2 90.94 C2 C3 90.94 TOP 2 1 90.94 C3 C2 90.94 BOT 1 3 88.16 C2 C4 88.16 TOP 3 1 88.16 C4 C2 88.16 BOT 2 3 89.95 C3 C4 89.95 TOP 3 2 89.95 C4 C3 89.95 AVG 0 C1 * 91.06 AVG 1 C2 * 91.12 AVG 2 C3 * 90.37 AVG 3 C4 * 88.94 TOT TOT * 90.37 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGGAGCGACACCGAAAACAGACTTTCCGGCTCACTGGCTGCTGTGTAT C2 ATGGGAGCGACACCGAAAACAGACTTTCCGGCCCACTGGCTGCTGTGCAT C3 ATGGGAGCGACACCGAAAACAGACTTTCCGGCCCACTGGCTGCTGTTTAT C4 ATGGGAGCGACACCGAAAACAGACTTTCTGGCCCACTGGCTGCTGTTTAT **************************** *** ************* ** C1 CCTTCTGGCTCTCGGC---------------TCCTTATCCTCGAAAGCGA C2 CCTCCTGGCTCTCGGC---------------TCCATATCCTCGAAAGCGA C3 CCTGGTGGCCCTGGGCTCCTCCTCCTCCTTTTCTAGATCCTCTCAAGCGT C4 CCTTTTGGGCCTCGGC---------------TTTATTTCCCCGAAAGCGG *** *** ** *** * : :*** * .***** C1 ATGCCGTTAGTGCTTATGGCGCCTCCTTCATTTCGAACCCATCCATATAT C2 GTGCCGTCAGTTCATATGGCGCCTCCTTCATCTCGAACCCATCCATATAC C3 ATGCCGTTAGTTCTTATGGCGCCTCCTTCATCTCGAACCCATCTATATAT C4 ATGCCGTTGGTGCCTATGGCGCCTCCTTCATCTCCAACCCATCGATATAC .****** .** * ***************** ** ******** ***** C1 GCATACAGTGTCGAAAATCAGCCGGATGAACGCGAGTCCAGGGACAACAA C2 GCATACAGTGTCGAAAATCAGGCGGAACAACACGAGTCCAGGGACAACAG C3 GCCTATAGTGTTGAAAATCAACCCGAACAGCGGGAAACCAAC---AACAA C4 GCCTATAGTGTGGAGAATCAGCAGGGGGAG------------------AA **.** ***** **.*****. . *. *. *. C1 CATCAAGTTTGCCGCTGAGCACGGCAATCTGAATTCCAATTCCAATCTGA C2 CATCAAGTTTGCCGCCGAGCACGGCAATCTGAATTCAAATTCCAATCTGA C3 CATCAAGTTTGCCGAACAG------------AATTCCAATTCCAATTTAA C4 CGTCAAGTTCGAAGACCAGAATGGCATTCTGAATTCCAATTCGAATCTGA *.******* *..*. ** *****.***** *** *.* C1 ATCGTAATTACTACTACACCGATGATCCCAGTCCCGTTTCC--------- C2 ATCGCAATTACTACTTCACCGATGATCCCAGTCCCGTTCCGAAT------ C3 ATCGTAATTACTACTATACCGATGATCCAAGTCCAATTCCG--------- C4 ATCGTAATTACTACTTCACCGATGATCCCAGACCCAATTCCAATCCCAAT **** **********: ***********.**:**..:* * C1 ---------AATCTGAATCCGACTGCCTCGCTGGCCACGCCTCCCGCCAC C2 CTGAATCTGAATCTGAATCCGACTGCCTCGCTGGCCACGCCCCCTGCCAC C3 ---------------AATCCAACTCCATCGCTGGCCACGCCTCCTGCCAC C4 ACGAATTTGAATGCCGATCCAACCGCCTCGCTAAACACGCCCCCTGCCAC .****.** *.*****...****** ** ***** C1 CCAGCCCGCCCCGCAGACGGGCTGCACCCTGGACCGCCTGGCCGTCTACA C2 CCAGCCCGCCCCCCAGACGGGCTGCACCCTGGACCGGCTGGCCGTCTACA C3 TCAGCCTGCCCCGCAGACGGGTTGCACTCTGGACCGGCTGGCTGTGTACA C4 CCAGCCCGCCCCCCAGACGGGCTGCACCCTGGACCGGCTGGCCGTCTACA ***** ***** ******** ***** ******** ***** ** **** C1 AGGTCGTCTTGCACACCTACTGGACCCGGGAGCTCTTCCCCAAGCACTAT C2 AGGTGGTCCTGCACACCTACTGGACCCGGGAGCTCTTCCCCAAGCACTAT C3 AGGTTGTCCTGCACACCTACTGGACCCGCGAACTCTTCCCCAAACATTAT C4 AGGTCGTCCTCCACACCTACTGGACCCGCGAGCTCTTCCCAAAACACTAT **** *** * ***************** **.********.**.** *** C1 CCCGACTGGCGACCCACCGCCCAGTGGACCAAGACATTAGGTCGCACCCA C2 CCCGACTGGCGACCCACCGCCCAGTGGACCAAGACATTAGGTCGCACCCA C3 CCGGACTGGCGACCCACCGCCCAGTGGACCAAGACATTAGGTCGCACCCA C4 CCCGACTGGCGACCCACTGCCCAGTGGACCAAGACATTAGGTCGCACCCA ** ************** ******************************** C1 CAATGCCAACTATGCACTGTACCACATTGGACAACCGGCGACGGCGGCTG C2 CAATGCCAACTATGCACTGTACCACATTGGACAACCGGCGACGGCGGCTG C3 CAATGCCAACTATGCACTGTACCACATTGGACAGCCGGCGACATCGGCTG C4 CAATGCCAACTATGCCCTGTACCACATCGGACAGCCGGCGACGGCGGCTG ***************.*********** *****.********. ****** C1 TCAAACAGTTTGCGGAATCGGGACGAACGGATCTGCTGGACAGCAATGCC C2 TCAAACAGTTTGCGGAATCGGGCCGCACGGATCTGCTGGACAGCAATGCC C3 TCAAACAGTTTGCGGAATCGGGTCGAACGGATCTGCTGGACAGCAATGCC C4 TCAAACAGTTTGCGGAGTCGGGTCGAACCGATCTGCTGGACAGCAGTGCC ****************.***** **.** ****************.**** C1 GGCGAGCAGCAGCAGGTCCAGATGCAGCTGCAGTCGCAGATGCAGGCGGG C2 GGCGAGCAGCAGCAGGTCCAGATGCAG------TCGCTGATGCAGACGGG C3 GGCGAACAGCAGCAAATGCAGATGCAG------------TTGCAGACGGG C4 GGCGAGCAGCAGCAGCAGCAGATGCAG------------ATGCAGACGGG *****.********. : ********* :*****.**** C1 CAAATCCCCATCAGGTGGGATCAGCAGCGGC---ACGACTAGTTTCAACG C2 CAAATCCCCATCAGGTGGGATCACCAGCAGCAGCAGCAGCAGCGGGACCA C3 GAAATCCCCATCAGGTGGAACCAGCAGCAGC---------AGCAGCACCA C4 CAAATCCCCTCCAGGTGGTACAAGCTCCACCAACACCACATCGCCAGCCA ********: ******* * .* *: *. * : ..*. C1 CCACAGCCGCATCCACAGCCACACCCACTGGTGGTAGTGGTGGCAGCGGT C2 CTACTTTCAACACCACAGCCACGCCCACTGGTGGTAGTGGTGGCAATGGC C3 ACAGTTTCAACACCACATCCACATCCTCATCTACAGCCGCCAGCGGTGGC C4 CCAATGGTGGGACCACCAGCACCACTACCAGCACCAGC------------ . * : . :****. *** * :* . . C1 GGCAGCGGTGGCAGCGGTGGCACTGGCACCACCACCGCCGAGCGCAGCGT C2 GGCAATGGTGGC---------------------ACCACCGAGCGCAGCGT C3 GGTAATGGTGGTAGT---------------CCTACCACCGAGCGCAGTGT C4 ------------------------------------ACCGAACGCAGTGT .****.***** ** C1 GTTCGATGAGTTCAGCATGCCGGCGATTCCGATGGGCGCCGGACGCAGTG C2 GTTCGACGAGTTCAGCATGCCGGCGATTCCGTTGGGCGCCGGACGCAGTG C3 GTTCGATGAGTTCAGCATGCCGGCGATTCCATTGGGCGCCGGACGCAGTG C4 GTTCGACGAGTTCAGCATGCCGGCGATTCCATTGGGCGCCGGACGCAGCG ****** ***********************.:**************** * C1 AGGCAAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA C2 AGGCAAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA C3 AGGCAAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA C4 AGGCGAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA ****.********************************************* C1 CGCATTGTTCCCTCGCCGGACTGGTTCATCGGCGTGGATTCGTTCGAGCT C2 CGCATTGTTCCCTCGCCGGACTGGTTCATCGGCGTGGATTCGTTCGAGCT C3 CGCATTGTTCCCTCGCCGGATTGGTTCATCGGTGTGGATTCGTTCGAGCT C4 CGCATTGTTCCCTCGCCGGACTGGTTCATCGGCGTCGACTCTTTCGAGCT ******************** *********** ** ** ** ******** C1 CTGCGTGGGTGGCTCCTGGATCGATACGGTGACCGTTGAGCTGGATCCTT C2 CTGCGTGGGTGGCTCCTGGATCGATACGGTGACCGTTGAGCTGGATCCTT C3 CTGCGTGGGTGGCTCTTGGATCGATACCGTAACCGTGGAACTGGATCCTT C4 CTGCGTGGGTGGCTCCTGGATCGATACGGTGACCGTTGAGCTGGATCCTT *************** *********** **.***** **.********** C1 TGGATGCGGGCACGGATAATGGCTTCACCTTCACGGCGCCCAACTGGCCA C2 TGGATGCGGGCACGGATAATGGCTTCACCTTCACGGCGCCCAACTGGCCA C3 TGGATGCGGGCACGGATAATGGTTTTACCTTCACGGCACCCAACTGGCCA C4 TGGATGCGGGCACGGATAATGGCTTCACCTTCACGGCGCCCAACTGGCCA ********************** ** ***********.************ C1 ACAGAACCTCAGGGCGTCATCTATCGGATCACCTCGCGTTATCCTGGACA C2 ACAGAGCCGCAGGGCGTCATCTATCGGATCACCTCGCGTTATCCTGGCCA C3 ACAGCACCTCAGGGCGTCATCTATCGGATCACCTCACGTTATCCTGGCCA C4 ACAGCACCTCAGGGCGTCATCTATCGGATCACCTCCCGTTATCCTGCCCA ****..** ************************** ********** .** C1 TCCTGCGGGTAGCTTTTATTATCCGAAGAGCAAACGATTGCCGCCCATCG C2 TCCTGCGGGCAGCTTTTATTATCCGAAGAGCAAGCGGCTGCCGCCCATCG C3 TCCGGCGGGTAGCTTTTATTATCCAAAGAGCAAGCGTTTGCCGCCCATCG C4 TCCTGCGGGTAGCTTTTATTATCCGAAGAGCAAGCGATTGCCGCCCATCG *** ***** **************.********.** ************ C1 CCACGTTCCAGTTTATCAAGCTGAAGGAGTACGAGCTGAGCGAGGTGTTT C2 CCACGTTCCAGTTTATCAAGCTGAGGGAGTACGAGCTGAGCGAGGTGTTC C3 CCACGTTCCAGTTTATCAAGCTGAAGGAGTACGAGCTGAGCGAGGTATTC C4 CCACGTTTCAGTTTATCAAGCTGAAGGAGTATGAGCTGAGCGAGGTGTTC ******* ****************.****** **************.** C1 AACATTGCCGAGGACGATCGCAAGTACGAGACGGTCCAGACCCAGACCCA C2 AACATTGCCGAGGACGATCGCAAGTATGAGACGGTCCAGACGCAGACCCA C3 AACATTGCCGAGGACGATCGCAAGTATGAAACGGTGCAGACCCAAACCCA C4 AACATTGCCGAGGACGATCGTAAGTACGAGACGGTCCAGACCCAGACCCA ******************** ***** **.***** ***** **.***** C1 CCTGGACGCGGAGCACAATCACGTGGAGATGAACAACGAGTTGTCCGCCA C2 CCTGGACGCGGAGCACAATCACGTGGAGATGAACAACGAGTTGTCCGCCA C3 CCTGGATGCGGAGCACAATCATGTGGAGATGAACAACGAGCTGTCCGCCA C4 CCTTGATGCGGAGCACAACCACGTGGAGATGAACAACGAGCTGTCGGCCA *** ** *********** ** ****************** **** **** C1 GCATCGAACGGGAACGACAAACGGAGCAGCAGCAGTTGCAGCAGAACGAC C2 GCATCGAACGGGAGCGACAAACGGAGCAGCAGCAGTTGCAGCACAACGAC C3 GCATTGAACGAGAGCGACAAACAGAGCAGCAACAGTTGCAGCAAAATGAC C4 GCATCGAACGGGAGCGACAAACGGAGCAGCAACAGTTGCAGCAGTTCGAC **** *****.**.********.********.*********** :: *** C1 GACGAGAGGCAGCGCATTCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT C2 GACGAGAGGCAGCGCATCCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT C3 GACGAGAGGCAGCGAATTCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT C4 GACGACAGGCAGCGAATCCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT ***** ********.** ******************************** C1 CTATGGCAGCAACAACAGCCTGCAGCCGGCACCTGGTCAGGTGGTCAGTG C2 CTACAGCAGCAACAACAGCCTCCAGCCGGCACCTGGTCAGGTGGTCAGTG C3 CTATAGCAGCAACAACAGCCTGCAGCCGGCACCTGGTCAGGTGGTCAGTG C4 CTACAGCAGCAACAATAGCCTGCAACCGTCACCTGGTCAGGTGGTCAGCG *** .********** ***** **.*** ******************* * C1 TGGTGCCGAAGAACGACAAGCATGCGATCCTGCAGAGCATCGCCAGCAGC C2 TGGTGCCGAAAAACGACAAACATGCGATCCTGCAGAGCATCGCCAGCAGC C3 TGGTGCCAAAGAACGACAAGCATGCGATCCTGCAGAGCATCGCCAGCAGC C4 TGGTGCCGAAGAACGACAAGCATGCGATCCTGCAGAGTATCGCCAGCAGC *******.**.********.***************** ************ C1 TATCGGCGTGCCGCAGATGCCAGCGATGCAAACGCCTCCAAACCGACACC C2 TATCGGCGTGCCGCAGATGCCAGCGATTCGAATGCTTCCAAGCCGACACC C3 TATCGGCGTGCCACAGATGCCAGCAATTTAAACGCCTCCAATCCGACAGC C4 TATCGGCGTGCCACAGATGCTGGCAATTCAAACGGCTCCAACCCAACGGC ************.******* .**.** .** * ***** **.**. * C1 A------TCCGCGATTGGTGGTGGC---AAGGCCGGTGGTGCGGTGGGCG C2 A------TTCGCGGCTGGTGGTGGTGGCAAGGCCGGTGGTGCTGTTGGTG C3 CTCGCAATCACCACTAGCGGGTGGCAAGGTCGCTGGTGCTGGCAGTGGGG C4 CCCGCAGTCACCACCGGCGGGTGGC---AAGTTGGGTGGTTTGGAGGGTG . * . *. * ***** .: **** * . ** * C1 GTGGT---------GCTGCCACCCGCAGGCGGAGCTCCGCGCAGCGTCGT C2 GT------------GCTGCCTCCCGCAGGCGGAGCTCCGCGCAGCGTCGT C3 GTGGGGCTGGAAGTGGTGCCACCCGCAGGCGAAGCATGGCGCAAAGGCGA C4 CCATGGGT------GGTGCGACCCGCAGGCGGAGCTCGGCACAGCGGCGT * *** :**********.***: **.**..* **: C1 CGTGATTGCCGCGTGAGCCACTGGTCCGAGTGGACGGCCTGCAGCAAAAG C2 CGTGATTGCCGCGTGAGCCACTGGTCCGAGTGGACGGCCTGCAGCAAAAG C3 CGCGACTGCCGCGTTAGCCACTGGTCAGAGTGGACGGCATGCAGCAAAAG C4 CGCGACTGCCGCGTGAGCCACTGGTCCGAGTGGACGGCCTGCAGCAAGAG ** ** ******** ***********.***********.********.** C1 TTGCGGCGTCGGCGAGATGCATCGCTACCGCAAGGTCATAAAGCACGGCA C2 CTGCGGCGTCGGCGAGATGCATCGCTACCGCAAGGTCATAAAGCACGGCA C3 CTGCGGCGTTGGCGAGATGCACCGCTACCGCAAGGTCATCAAGCACGGCA C4 CTGCGGCATCGGCGAGATGCACCGCTACCGCAAGGTCATCAAGCACGGCA ******.* *********** *****************.********** C1 AGAGGGGCGGACGACAGTGCCCGGCGCTCCAGCAGTCCAAGTGGTGCGGC C2 AGAGGGGCGGACGACAGTGCCCGGCGCTCCAGCAGTCCAAGTGGTGCGGC C3 AACGGGGCGGACGACAATGCCCGGCGCTCCAGCAGTCCAAGTGGTGCGGC C4 AAAGGGGCGGACGGCCCTGCCCGGCGCTCCAGCAATCCAAGTGGTGCGGC *..**********.*. *****************.*************** C1 ACCGAGCGCAACTGTCACGGGTCGCAGACCTATTTTAATTGGTCCGATTC C2 ACCGAGCGCAACTGCCACGGGTCGCAGAGCTACTTTAATTGGTCCGATTC C3 ACCGAGCGCAACTGTCACGGGTCGCAAACTTATTTTAATTGGTCTGATTC C4 ACCGAGCGCAACTGTCACGGGTCACAGACCTATTTTAATTGGTCCGATTC ************** ********.**.* ** *********** ***** C1 CGACACA------------------------------------------- C2 CGACACA------------------------------------------- C3 CGACACA------------------------------------------- C4 CGACACA------------------------------------------- ******* C1 ----- C2 ----- C3 ----- C4 ----- >C1 ATGGGAGCGACACCGAAAACAGACTTTCCGGCTCACTGGCTGCTGTGTAT CCTTCTGGCTCTCGGC---------------TCCTTATCCTCGAAAGCGA ATGCCGTTAGTGCTTATGGCGCCTCCTTCATTTCGAACCCATCCATATAT GCATACAGTGTCGAAAATCAGCCGGATGAACGCGAGTCCAGGGACAACAA CATCAAGTTTGCCGCTGAGCACGGCAATCTGAATTCCAATTCCAATCTGA ATCGTAATTACTACTACACCGATGATCCCAGTCCCGTTTCC--------- ---------AATCTGAATCCGACTGCCTCGCTGGCCACGCCTCCCGCCAC CCAGCCCGCCCCGCAGACGGGCTGCACCCTGGACCGCCTGGCCGTCTACA AGGTCGTCTTGCACACCTACTGGACCCGGGAGCTCTTCCCCAAGCACTAT CCCGACTGGCGACCCACCGCCCAGTGGACCAAGACATTAGGTCGCACCCA CAATGCCAACTATGCACTGTACCACATTGGACAACCGGCGACGGCGGCTG TCAAACAGTTTGCGGAATCGGGACGAACGGATCTGCTGGACAGCAATGCC GGCGAGCAGCAGCAGGTCCAGATGCAGCTGCAGTCGCAGATGCAGGCGGG CAAATCCCCATCAGGTGGGATCAGCAGCGGC---ACGACTAGTTTCAACG CCACAGCCGCATCCACAGCCACACCCACTGGTGGTAGTGGTGGCAGCGGT GGCAGCGGTGGCAGCGGTGGCACTGGCACCACCACCGCCGAGCGCAGCGT GTTCGATGAGTTCAGCATGCCGGCGATTCCGATGGGCGCCGGACGCAGTG AGGCAAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA CGCATTGTTCCCTCGCCGGACTGGTTCATCGGCGTGGATTCGTTCGAGCT CTGCGTGGGTGGCTCCTGGATCGATACGGTGACCGTTGAGCTGGATCCTT TGGATGCGGGCACGGATAATGGCTTCACCTTCACGGCGCCCAACTGGCCA ACAGAACCTCAGGGCGTCATCTATCGGATCACCTCGCGTTATCCTGGACA TCCTGCGGGTAGCTTTTATTATCCGAAGAGCAAACGATTGCCGCCCATCG CCACGTTCCAGTTTATCAAGCTGAAGGAGTACGAGCTGAGCGAGGTGTTT AACATTGCCGAGGACGATCGCAAGTACGAGACGGTCCAGACCCAGACCCA CCTGGACGCGGAGCACAATCACGTGGAGATGAACAACGAGTTGTCCGCCA GCATCGAACGGGAACGACAAACGGAGCAGCAGCAGTTGCAGCAGAACGAC GACGAGAGGCAGCGCATTCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT CTATGGCAGCAACAACAGCCTGCAGCCGGCACCTGGTCAGGTGGTCAGTG TGGTGCCGAAGAACGACAAGCATGCGATCCTGCAGAGCATCGCCAGCAGC TATCGGCGTGCCGCAGATGCCAGCGATGCAAACGCCTCCAAACCGACACC A------TCCGCGATTGGTGGTGGC---AAGGCCGGTGGTGCGGTGGGCG GTGGT---------GCTGCCACCCGCAGGCGGAGCTCCGCGCAGCGTCGT CGTGATTGCCGCGTGAGCCACTGGTCCGAGTGGACGGCCTGCAGCAAAAG TTGCGGCGTCGGCGAGATGCATCGCTACCGCAAGGTCATAAAGCACGGCA AGAGGGGCGGACGACAGTGCCCGGCGCTCCAGCAGTCCAAGTGGTGCGGC ACCGAGCGCAACTGTCACGGGTCGCAGACCTATTTTAATTGGTCCGATTC CGACACA------------------------------------------- ----- >C2 ATGGGAGCGACACCGAAAACAGACTTTCCGGCCCACTGGCTGCTGTGCAT CCTCCTGGCTCTCGGC---------------TCCATATCCTCGAAAGCGA GTGCCGTCAGTTCATATGGCGCCTCCTTCATCTCGAACCCATCCATATAC GCATACAGTGTCGAAAATCAGGCGGAACAACACGAGTCCAGGGACAACAG CATCAAGTTTGCCGCCGAGCACGGCAATCTGAATTCAAATTCCAATCTGA ATCGCAATTACTACTTCACCGATGATCCCAGTCCCGTTCCGAAT------ CTGAATCTGAATCTGAATCCGACTGCCTCGCTGGCCACGCCCCCTGCCAC CCAGCCCGCCCCCCAGACGGGCTGCACCCTGGACCGGCTGGCCGTCTACA AGGTGGTCCTGCACACCTACTGGACCCGGGAGCTCTTCCCCAAGCACTAT CCCGACTGGCGACCCACCGCCCAGTGGACCAAGACATTAGGTCGCACCCA CAATGCCAACTATGCACTGTACCACATTGGACAACCGGCGACGGCGGCTG TCAAACAGTTTGCGGAATCGGGCCGCACGGATCTGCTGGACAGCAATGCC GGCGAGCAGCAGCAGGTCCAGATGCAG------TCGCTGATGCAGACGGG CAAATCCCCATCAGGTGGGATCACCAGCAGCAGCAGCAGCAGCGGGACCA CTACTTTCAACACCACAGCCACGCCCACTGGTGGTAGTGGTGGCAATGGC GGCAATGGTGGC---------------------ACCACCGAGCGCAGCGT GTTCGACGAGTTCAGCATGCCGGCGATTCCGTTGGGCGCCGGACGCAGTG AGGCAAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA CGCATTGTTCCCTCGCCGGACTGGTTCATCGGCGTGGATTCGTTCGAGCT CTGCGTGGGTGGCTCCTGGATCGATACGGTGACCGTTGAGCTGGATCCTT TGGATGCGGGCACGGATAATGGCTTCACCTTCACGGCGCCCAACTGGCCA ACAGAGCCGCAGGGCGTCATCTATCGGATCACCTCGCGTTATCCTGGCCA TCCTGCGGGCAGCTTTTATTATCCGAAGAGCAAGCGGCTGCCGCCCATCG CCACGTTCCAGTTTATCAAGCTGAGGGAGTACGAGCTGAGCGAGGTGTTC AACATTGCCGAGGACGATCGCAAGTATGAGACGGTCCAGACGCAGACCCA CCTGGACGCGGAGCACAATCACGTGGAGATGAACAACGAGTTGTCCGCCA GCATCGAACGGGAGCGACAAACGGAGCAGCAGCAGTTGCAGCACAACGAC GACGAGAGGCAGCGCATCCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT CTACAGCAGCAACAACAGCCTCCAGCCGGCACCTGGTCAGGTGGTCAGTG TGGTGCCGAAAAACGACAAACATGCGATCCTGCAGAGCATCGCCAGCAGC TATCGGCGTGCCGCAGATGCCAGCGATTCGAATGCTTCCAAGCCGACACC A------TTCGCGGCTGGTGGTGGTGGCAAGGCCGGTGGTGCTGTTGGTG GT------------GCTGCCTCCCGCAGGCGGAGCTCCGCGCAGCGTCGT CGTGATTGCCGCGTGAGCCACTGGTCCGAGTGGACGGCCTGCAGCAAAAG CTGCGGCGTCGGCGAGATGCATCGCTACCGCAAGGTCATAAAGCACGGCA AGAGGGGCGGACGACAGTGCCCGGCGCTCCAGCAGTCCAAGTGGTGCGGC ACCGAGCGCAACTGCCACGGGTCGCAGAGCTACTTTAATTGGTCCGATTC CGACACA------------------------------------------- ----- >C3 ATGGGAGCGACACCGAAAACAGACTTTCCGGCCCACTGGCTGCTGTTTAT CCTGGTGGCCCTGGGCTCCTCCTCCTCCTTTTCTAGATCCTCTCAAGCGT ATGCCGTTAGTTCTTATGGCGCCTCCTTCATCTCGAACCCATCTATATAT GCCTATAGTGTTGAAAATCAACCCGAACAGCGGGAAACCAAC---AACAA CATCAAGTTTGCCGAACAG------------AATTCCAATTCCAATTTAA ATCGTAATTACTACTATACCGATGATCCAAGTCCAATTCCG--------- ---------------AATCCAACTCCATCGCTGGCCACGCCTCCTGCCAC TCAGCCTGCCCCGCAGACGGGTTGCACTCTGGACCGGCTGGCTGTGTACA AGGTTGTCCTGCACACCTACTGGACCCGCGAACTCTTCCCCAAACATTAT CCGGACTGGCGACCCACCGCCCAGTGGACCAAGACATTAGGTCGCACCCA CAATGCCAACTATGCACTGTACCACATTGGACAGCCGGCGACATCGGCTG TCAAACAGTTTGCGGAATCGGGTCGAACGGATCTGCTGGACAGCAATGCC GGCGAACAGCAGCAAATGCAGATGCAG------------TTGCAGACGGG GAAATCCCCATCAGGTGGAACCAGCAGCAGC---------AGCAGCACCA ACAGTTTCAACACCACATCCACATCCTCATCTACAGCCGCCAGCGGTGGC GGTAATGGTGGTAGT---------------CCTACCACCGAGCGCAGTGT GTTCGATGAGTTCAGCATGCCGGCGATTCCATTGGGCGCCGGACGCAGTG AGGCAAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA CGCATTGTTCCCTCGCCGGATTGGTTCATCGGTGTGGATTCGTTCGAGCT CTGCGTGGGTGGCTCTTGGATCGATACCGTAACCGTGGAACTGGATCCTT TGGATGCGGGCACGGATAATGGTTTTACCTTCACGGCACCCAACTGGCCA ACAGCACCTCAGGGCGTCATCTATCGGATCACCTCACGTTATCCTGGCCA TCCGGCGGGTAGCTTTTATTATCCAAAGAGCAAGCGTTTGCCGCCCATCG CCACGTTCCAGTTTATCAAGCTGAAGGAGTACGAGCTGAGCGAGGTATTC AACATTGCCGAGGACGATCGCAAGTATGAAACGGTGCAGACCCAAACCCA CCTGGATGCGGAGCACAATCATGTGGAGATGAACAACGAGCTGTCCGCCA GCATTGAACGAGAGCGACAAACAGAGCAGCAACAGTTGCAGCAAAATGAC GACGAGAGGCAGCGAATTCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT CTATAGCAGCAACAACAGCCTGCAGCCGGCACCTGGTCAGGTGGTCAGTG TGGTGCCAAAGAACGACAAGCATGCGATCCTGCAGAGCATCGCCAGCAGC TATCGGCGTGCCACAGATGCCAGCAATTTAAACGCCTCCAATCCGACAGC CTCGCAATCACCACTAGCGGGTGGCAAGGTCGCTGGTGCTGGCAGTGGGG GTGGGGCTGGAAGTGGTGCCACCCGCAGGCGAAGCATGGCGCAAAGGCGA CGCGACTGCCGCGTTAGCCACTGGTCAGAGTGGACGGCATGCAGCAAAAG CTGCGGCGTTGGCGAGATGCACCGCTACCGCAAGGTCATCAAGCACGGCA AACGGGGCGGACGACAATGCCCGGCGCTCCAGCAGTCCAAGTGGTGCGGC ACCGAGCGCAACTGTCACGGGTCGCAAACTTATTTTAATTGGTCTGATTC CGACACA------------------------------------------- ----- >C4 ATGGGAGCGACACCGAAAACAGACTTTCTGGCCCACTGGCTGCTGTTTAT CCTTTTGGGCCTCGGC---------------TTTATTTCCCCGAAAGCGG ATGCCGTTGGTGCCTATGGCGCCTCCTTCATCTCCAACCCATCGATATAC GCCTATAGTGTGGAGAATCAGCAGGGGGAG------------------AA CGTCAAGTTCGAAGACCAGAATGGCATTCTGAATTCCAATTCGAATCTGA ATCGTAATTACTACTTCACCGATGATCCCAGACCCAATTCCAATCCCAAT ACGAATTTGAATGCCGATCCAACCGCCTCGCTAAACACGCCCCCTGCCAC CCAGCCCGCCCCCCAGACGGGCTGCACCCTGGACCGGCTGGCCGTCTACA AGGTCGTCCTCCACACCTACTGGACCCGCGAGCTCTTCCCAAAACACTAT CCCGACTGGCGACCCACTGCCCAGTGGACCAAGACATTAGGTCGCACCCA CAATGCCAACTATGCCCTGTACCACATCGGACAGCCGGCGACGGCGGCTG TCAAACAGTTTGCGGAGTCGGGTCGAACCGATCTGCTGGACAGCAGTGCC GGCGAGCAGCAGCAGCAGCAGATGCAG------------ATGCAGACGGG CAAATCCCCTCCAGGTGGTACAAGCTCCACCAACACCACATCGCCAGCCA CCAATGGTGGGACCACCAGCACCACTACCAGCACCAGC------------ ------------------------------------ACCGAACGCAGTGT GTTCGACGAGTTCAGCATGCCGGCGATTCCATTGGGCGCCGGACGCAGCG AGGCGAAAGTGTTTGTCGACAGCAATCACAGTCTGGTCTCGCTAATGACA CGCATTGTTCCCTCGCCGGACTGGTTCATCGGCGTCGACTCTTTCGAGCT CTGCGTGGGTGGCTCCTGGATCGATACGGTGACCGTTGAGCTGGATCCTT TGGATGCGGGCACGGATAATGGCTTCACCTTCACGGCGCCCAACTGGCCA ACAGCACCTCAGGGCGTCATCTATCGGATCACCTCCCGTTATCCTGCCCA TCCTGCGGGTAGCTTTTATTATCCGAAGAGCAAGCGATTGCCGCCCATCG CCACGTTTCAGTTTATCAAGCTGAAGGAGTATGAGCTGAGCGAGGTGTTC AACATTGCCGAGGACGATCGTAAGTACGAGACGGTCCAGACCCAGACCCA CCTTGATGCGGAGCACAACCACGTGGAGATGAACAACGAGCTGTCGGCCA GCATCGAACGGGAGCGACAAACGGAGCAGCAACAGTTGCAGCAGTTCGAC GACGACAGGCAGCGAATCCGGTCCCAGCTGTTGGCCAAAATGAATCCCAT CTACAGCAGCAACAATAGCCTGCAACCGTCACCTGGTCAGGTGGTCAGCG TGGTGCCGAAGAACGACAAGCATGCGATCCTGCAGAGTATCGCCAGCAGC TATCGGCGTGCCACAGATGCTGGCAATTCAAACGGCTCCAACCCAACGGC CCCGCAGTCACCACCGGCGGGTGGC---AAGTTGGGTGGTTTGGAGGGTG CCATGGGT------GGTGCGACCCGCAGGCGGAGCTCGGCACAGCGGCGT CGCGACTGCCGCGTGAGCCACTGGTCCGAGTGGACGGCCTGCAGCAAGAG CTGCGGCATCGGCGAGATGCACCGCTACCGCAAGGTCATCAAGCACGGCA AAAGGGGCGGACGGCCCTGCCCGGCGCTCCAGCAATCCAAGTGGTGCGGC ACCGAGCGCAACTGTCACGGGTCACAGACCTATTTTAATTGGTCCGATTC CGACACA------------------------------------------- ----- >C1 MGATPKTDFPAHWLLCILLALGoooooSLSSKANAVSAYGASFISNPSIY AYSVENQPDERESRDNNIKFAAEHGNLNSNSNLNRNYYYTDDPSPVSooo oooNLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA GEQQQVQMQLQSQMQAGKSPSGGISSGoTTSFNATAASTATPTGGSGGSG GSGGSGGTGTTTAERSVFDEFSMPAIPMGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND DERQRIRSQLLAKMNPIYGSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRAADASDANASKPTPooSAIGGGoKAGGAVGGGoooAATRRRSSAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQTYFNWSDSDT >C2 MGATPKTDFPAHWLLCILLALGoooooSISSKASAVSSYGASFISNPSIY AYSVENQAEQHESRDNSIKFAAEHGNLNSNSNLNRNYYFTDDPSPVPNoo LNLNLNPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNA GEQQQVQMQooSLMQTGKSPSGGITSSSSSSGTTTFNTTATPTGGSGGNG GNGGoooooooTTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLREYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQHND DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRAADASDSNASKPTPooFAAGGGGKAGGAVGGooooAASRRRSSAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQSYFNWSDSDT >C3 MGATPKTDFPAHWLLFILVALGSSSSFSRSSQAYAVSSYGASFISNPSIY AYSVENQPEQRETNoNNIKFAEQooooNSNSNLNRNYYYTDDPSPIPooo oooooNPTPSLATPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATSAVKQFAESGRTDLLDSNA GEQQQMQMQooooLQTGKSPSGGTSSSoooSSTNSFNTTSTSSSTAASGG GNGGSoooooPTTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TAPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQND DERQRIRSQLLAKMNPIYSSNNSLQPAPGQVVSVVPKNDKHAILQSIASS YRRATDASNLNASNPTASQSPLAGGKVAGAGSGGGAGSGATRRRSMAQRR RDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPALQQSKWCG TERNCHGSQTYFNWSDSDT >C4 MGATPKTDFLAHWLLFILLGLGoooooFISPKADAVGAYGASFISNPSIY AYSVENQQGEooooooNVKFEDQNGILNSNSNLNRNYYFTDDPRPNSNPN TNLNADPTASLNTPPATQPAPQTGCTLDRLAVYKVVLHTYWTRELFPKHY PDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSSA GEQQQQQMQooooMQTGKSPPGGTSSTNTTSPATNGGTTSTTTSTSoooo ooooooooooooTERSVFDEFSMPAIPLGAGRSEAKVFVDSNHSLVSLMT RIVPSPDWFIGVDSFELCVGGSWIDTVTVELDPLDAGTDNGFTFTAPNWP TAPQGVIYRITSRYPAHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIERERQTEQQQLQQFD DDRQRIRSQLLAKMNPIYSSNNSLQPSPGQVVSVVPKNDKHAILQSIASS YRRATDAGNSNGSNPTAPQSPPAGGoKLGGLEGAMGooGATRRRSSAQRR RDCRVSHWSEWTACSKSCGIGEMHRYRKVIKHGKRGGRPCPALQQSKWCG TERNCHGSQTYFNWSDSDT MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 1905 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479882477 Setting output file names to "/opt/ADOPS/314/mspo-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1604152100 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 1783901760 Seed = 2006340268 Swapseed = 1479882477 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 74 unique site patterns Division 2 has 73 unique site patterns Division 3 has 108 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4825.795017 -- -26.620141 Chain 2 -- -4718.059687 -- -26.620141 Chain 3 -- -4832.283748 -- -26.620141 Chain 4 -- -4825.795017 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4718.059687 -- -26.620141 Chain 2 -- -4825.795017 -- -26.620141 Chain 3 -- -4718.059687 -- -26.620141 Chain 4 -- -4825.795017 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4825.795] (-4718.060) (-4832.284) (-4825.795) * [-4718.060] (-4825.795) (-4718.060) (-4825.795) 500 -- [-4478.023] (-4498.536) (-4506.814) (-4506.791) * (-4498.682) [-4503.209] (-4523.277) (-4501.127) -- 0:00:00 1000 -- [-4446.315] (-4466.818) (-4472.737) (-4477.264) * [-4439.192] (-4465.790) (-4454.605) (-4486.501) -- 0:00:00 1500 -- [-4418.541] (-4429.985) (-4436.526) (-4450.703) * (-4418.886) (-4426.977) [-4425.845] (-4434.357) -- 0:11:05 2000 -- (-4411.266) [-4412.897] (-4430.815) (-4431.566) * [-4417.471] (-4418.667) (-4419.786) (-4430.327) -- 0:08:19 2500 -- [-4411.420] (-4415.063) (-4426.872) (-4421.159) * [-4420.473] (-4415.956) (-4418.406) (-4424.028) -- 0:06:39 3000 -- [-4420.242] (-4420.100) (-4418.799) (-4411.043) * [-4414.799] (-4418.896) (-4409.451) (-4416.113) -- 0:05:32 3500 -- [-4417.815] (-4411.829) (-4411.207) (-4414.136) * [-4412.267] (-4413.270) (-4412.071) (-4423.806) -- 0:04:44 4000 -- [-4413.111] (-4415.926) (-4416.357) (-4412.973) * [-4418.978] (-4413.682) (-4422.096) (-4419.139) -- 0:04:09 4500 -- (-4412.976) (-4416.535) [-4412.364] (-4409.757) * (-4421.667) [-4413.892] (-4423.958) (-4411.526) -- 0:07:22 5000 -- (-4411.457) (-4412.960) (-4420.621) [-4409.515] * (-4411.039) [-4414.081] (-4424.137) (-4411.116) -- 0:06:38 Average standard deviation of split frequencies: 0.000000 5500 -- (-4415.801) [-4413.333] (-4412.092) (-4410.917) * (-4411.877) (-4417.737) (-4410.943) [-4410.430] -- 0:06:01 6000 -- (-4421.174) [-4417.310] (-4416.180) (-4412.046) * (-4411.710) (-4416.435) [-4414.566] (-4406.129) -- 0:05:31 6500 -- (-4414.997) [-4409.838] (-4411.639) (-4413.872) * (-4415.089) (-4411.098) [-4414.928] (-4411.342) -- 0:05:05 7000 -- (-4413.506) (-4419.473) (-4412.514) [-4411.108] * (-4416.387) (-4415.281) (-4416.960) [-4412.360] -- 0:04:43 7500 -- (-4414.664) (-4415.811) (-4418.013) [-4413.811] * [-4408.885] (-4414.311) (-4415.965) (-4416.612) -- 0:04:24 8000 -- (-4411.266) (-4415.715) (-4416.680) [-4412.567] * [-4411.687] (-4415.438) (-4417.254) (-4414.427) -- 0:06:12 8500 -- (-4419.039) [-4410.855] (-4416.619) (-4414.514) * (-4412.648) (-4413.461) [-4413.721] (-4418.885) -- 0:05:49 9000 -- (-4420.614) (-4418.105) [-4412.668] (-4412.413) * (-4410.800) (-4415.012) [-4415.834] (-4413.724) -- 0:05:30 9500 -- (-4416.566) (-4416.463) [-4414.994] (-4419.972) * (-4413.889) [-4412.020] (-4417.115) (-4415.468) -- 0:05:12 10000 -- [-4416.197] (-4415.052) (-4413.474) (-4425.066) * [-4410.383] (-4410.080) (-4415.529) (-4419.247) -- 0:04:57 Average standard deviation of split frequencies: 0.000000 10500 -- (-4416.223) (-4419.947) (-4411.888) [-4411.726] * (-4417.512) (-4412.790) [-4412.907] (-4412.021) -- 0:04:42 11000 -- (-4415.706) (-4413.065) (-4416.174) [-4410.886] * [-4412.690] (-4416.337) (-4414.982) (-4417.626) -- 0:04:29 11500 -- (-4422.411) (-4411.319) [-4409.050] (-4412.705) * (-4421.585) (-4410.019) (-4411.622) [-4410.149] -- 0:05:43 12000 -- (-4414.969) (-4413.056) (-4409.755) [-4409.844] * [-4414.026] (-4420.343) (-4413.330) (-4410.761) -- 0:05:29 12500 -- (-4415.049) (-4416.638) [-4411.570] (-4412.697) * (-4411.262) (-4412.171) (-4413.691) [-4412.485] -- 0:05:16 13000 -- (-4419.740) (-4414.855) [-4410.663] (-4420.493) * (-4412.356) [-4413.752] (-4412.990) (-4409.295) -- 0:05:03 13500 -- [-4415.408] (-4419.254) (-4409.373) (-4413.206) * [-4416.134] (-4417.675) (-4410.209) (-4415.312) -- 0:04:52 14000 -- (-4414.345) [-4413.726] (-4417.685) (-4421.918) * [-4414.145] (-4415.178) (-4412.080) (-4412.479) -- 0:04:41 14500 -- (-4418.832) (-4416.091) [-4413.967] (-4414.521) * [-4409.504] (-4418.802) (-4409.635) (-4411.976) -- 0:05:39 15000 -- [-4414.687] (-4422.485) (-4416.061) (-4414.245) * [-4413.586] (-4422.318) (-4409.824) (-4415.050) -- 0:05:28 Average standard deviation of split frequencies: 0.000000 15500 -- (-4417.191) (-4418.589) (-4419.851) [-4412.224] * [-4411.031] (-4418.539) (-4407.013) (-4412.600) -- 0:05:17 16000 -- (-4411.374) (-4414.751) [-4411.768] (-4413.077) * [-4412.970] (-4414.725) (-4413.636) (-4415.391) -- 0:05:07 16500 -- (-4411.914) (-4410.864) [-4420.832] (-4413.958) * (-4414.140) (-4418.966) (-4412.343) [-4417.224] -- 0:04:58 17000 -- (-4410.590) (-4409.520) [-4416.506] (-4414.648) * (-4414.069) [-4413.013] (-4414.005) (-4410.288) -- 0:04:49 17500 -- (-4412.838) [-4410.073] (-4417.575) (-4413.637) * (-4418.946) (-4413.276) [-4413.251] (-4409.181) -- 0:04:40 18000 -- (-4417.650) [-4412.181] (-4417.450) (-4413.270) * (-4414.683) [-4416.186] (-4412.917) (-4416.158) -- 0:05:27 18500 -- (-4413.652) (-4414.572) (-4418.915) [-4410.701] * (-4417.200) [-4412.241] (-4412.954) (-4415.343) -- 0:05:18 19000 -- (-4413.834) (-4414.140) [-4419.615] (-4411.822) * (-4420.448) (-4413.820) (-4412.148) [-4420.091] -- 0:05:09 19500 -- (-4413.317) (-4415.987) (-4413.726) [-4415.154] * (-4417.694) (-4408.603) [-4411.319] (-4421.647) -- 0:05:01 20000 -- (-4414.967) (-4411.624) [-4415.582] (-4415.162) * (-4414.723) [-4407.330] (-4415.322) (-4414.028) -- 0:04:54 Average standard deviation of split frequencies: 0.000000 20500 -- (-4412.411) (-4410.672) (-4412.033) [-4411.818] * (-4417.704) [-4410.166] (-4415.648) (-4416.474) -- 0:04:46 21000 -- (-4409.714) (-4415.311) (-4410.537) [-4413.519] * (-4414.148) (-4414.627) [-4411.144] (-4413.349) -- 0:04:39 21500 -- (-4419.170) (-4421.446) [-4411.288] (-4412.753) * [-4414.246] (-4413.263) (-4413.177) (-4425.361) -- 0:05:18 22000 -- (-4415.069) [-4412.556] (-4410.776) (-4413.517) * (-4416.419) [-4409.865] (-4412.880) (-4411.954) -- 0:05:11 22500 -- (-4418.057) (-4411.814) (-4413.636) [-4411.215] * [-4414.415] (-4415.952) (-4414.039) (-4414.728) -- 0:05:04 23000 -- (-4417.502) [-4410.556] (-4418.295) (-4413.760) * [-4416.729] (-4417.016) (-4414.550) (-4415.342) -- 0:04:57 23500 -- (-4422.568) [-4414.461] (-4412.535) (-4413.080) * (-4422.606) (-4415.116) [-4413.655] (-4412.410) -- 0:04:50 24000 -- (-4426.183) (-4415.896) [-4416.918] (-4410.193) * [-4412.238] (-4415.435) (-4415.935) (-4413.217) -- 0:04:44 24500 -- (-4420.566) [-4413.618] (-4413.428) (-4407.799) * (-4419.312) [-4416.875] (-4416.951) (-4416.529) -- 0:04:38 25000 -- (-4410.279) (-4426.310) (-4425.151) [-4411.969] * (-4414.462) (-4413.932) [-4417.887] (-4412.641) -- 0:05:12 Average standard deviation of split frequencies: 0.000000 25500 -- [-4411.107] (-4423.157) (-4410.882) (-4414.709) * [-4411.635] (-4412.226) (-4417.589) (-4416.026) -- 0:05:05 26000 -- (-4416.631) (-4412.615) [-4414.395] (-4419.938) * (-4409.196) (-4418.249) [-4422.730] (-4409.101) -- 0:04:59 26500 -- (-4414.092) (-4414.087) [-4412.876] (-4424.087) * (-4411.303) (-4417.753) (-4420.334) [-4410.268] -- 0:04:53 27000 -- (-4419.715) (-4411.575) [-4415.370] (-4414.446) * (-4414.932) [-4413.988] (-4419.220) (-4413.307) -- 0:04:48 27500 -- (-4412.559) [-4410.960] (-4412.735) (-4415.465) * (-4412.644) [-4411.918] (-4414.981) (-4416.132) -- 0:04:42 28000 -- (-4411.457) (-4413.013) [-4413.504] (-4422.840) * (-4417.304) (-4414.654) [-4415.240] (-4416.152) -- 0:04:37 28500 -- (-4414.921) [-4408.910] (-4412.203) (-4419.336) * (-4414.084) [-4409.168] (-4416.405) (-4414.709) -- 0:05:06 29000 -- [-4411.826] (-4414.091) (-4415.454) (-4418.128) * (-4417.103) [-4417.761] (-4411.583) (-4419.864) -- 0:05:01 29500 -- (-4418.114) [-4413.522] (-4414.367) (-4419.124) * (-4415.613) [-4411.689] (-4414.503) (-4421.809) -- 0:04:56 30000 -- (-4413.245) (-4413.014) [-4418.514] (-4415.852) * (-4417.145) [-4418.257] (-4414.751) (-4408.259) -- 0:04:51 Average standard deviation of split frequencies: 0.000000 30500 -- (-4410.816) (-4419.715) [-4415.777] (-4413.951) * (-4419.789) (-4414.507) (-4414.829) [-4409.838] -- 0:04:46 31000 -- (-4411.800) (-4413.498) [-4414.591] (-4419.274) * (-4411.758) (-4414.926) [-4412.879] (-4410.254) -- 0:04:41 31500 -- [-4418.273] (-4409.887) (-4416.289) (-4416.984) * [-4419.015] (-4420.013) (-4412.096) (-4409.957) -- 0:05:07 32000 -- (-4416.984) (-4412.379) (-4413.765) [-4409.580] * (-4416.309) (-4417.865) (-4413.792) [-4414.254] -- 0:05:02 32500 -- (-4415.571) (-4413.048) [-4411.457] (-4410.468) * (-4414.804) (-4413.505) [-4410.890] (-4415.261) -- 0:04:57 33000 -- (-4420.312) (-4417.196) [-4413.578] (-4413.604) * (-4421.490) (-4411.151) (-4411.825) [-4415.996] -- 0:04:53 33500 -- (-4418.171) (-4413.279) [-4408.948] (-4418.698) * (-4414.004) (-4416.063) [-4414.830] (-4411.805) -- 0:04:48 34000 -- (-4412.404) (-4412.933) [-4417.360] (-4416.993) * (-4414.892) (-4417.264) (-4416.503) [-4420.502] -- 0:04:44 34500 -- [-4417.212] (-4418.670) (-4413.152) (-4415.033) * [-4413.682] (-4410.649) (-4409.273) (-4411.812) -- 0:04:39 35000 -- [-4413.352] (-4422.941) (-4414.385) (-4413.677) * [-4413.806] (-4416.941) (-4410.715) (-4416.111) -- 0:05:03 Average standard deviation of split frequencies: 0.000000 35500 -- (-4419.714) (-4413.962) [-4417.219] (-4412.669) * (-4414.081) (-4417.134) [-4416.814] (-4417.578) -- 0:04:58 36000 -- (-4413.169) (-4414.306) [-4417.235] (-4415.763) * (-4413.549) [-4418.329] (-4409.850) (-4413.578) -- 0:04:54 36500 -- (-4416.636) (-4412.430) (-4415.193) [-4416.625] * [-4410.202] (-4421.163) (-4418.897) (-4415.115) -- 0:04:50 37000 -- [-4413.462] (-4416.194) (-4411.870) (-4416.445) * [-4412.456] (-4417.349) (-4409.163) (-4419.307) -- 0:04:46 37500 -- (-4418.434) [-4416.167] (-4415.988) (-4414.973) * (-4411.707) (-4419.116) [-4412.979] (-4416.011) -- 0:04:42 38000 -- (-4415.969) (-4415.414) (-4412.794) [-4418.617] * (-4413.607) [-4415.726] (-4417.406) (-4411.118) -- 0:04:38 38500 -- (-4411.835) (-4417.695) [-4414.674] (-4417.045) * [-4411.822] (-4416.599) (-4410.882) (-4412.674) -- 0:04:59 39000 -- (-4419.948) (-4414.180) [-4412.784] (-4413.720) * (-4414.778) [-4418.773] (-4416.317) (-4412.095) -- 0:04:55 39500 -- (-4422.760) (-4414.407) (-4412.062) [-4414.983] * (-4411.421) (-4423.059) [-4410.831] (-4415.785) -- 0:04:51 40000 -- (-4418.221) (-4413.796) (-4417.583) [-4411.022] * [-4411.703] (-4414.314) (-4410.844) (-4412.835) -- 0:04:48 Average standard deviation of split frequencies: 0.000000 40500 -- (-4417.993) (-4415.538) (-4417.247) [-4411.003] * [-4414.540] (-4416.789) (-4409.716) (-4413.158) -- 0:04:44 41000 -- (-4417.413) (-4418.364) [-4405.611] (-4413.424) * (-4411.662) (-4411.182) (-4413.377) [-4416.734] -- 0:04:40 41500 -- (-4409.013) (-4413.834) (-4408.640) [-4413.200] * [-4417.379] (-4413.502) (-4418.838) (-4413.925) -- 0:04:37 42000 -- [-4419.046] (-4411.267) (-4412.911) (-4422.091) * (-4416.401) (-4415.327) (-4415.082) [-4419.372] -- 0:04:56 42500 -- (-4415.558) [-4417.490] (-4413.042) (-4414.758) * (-4416.368) (-4414.329) (-4411.264) [-4412.530] -- 0:04:52 43000 -- (-4418.946) (-4412.097) [-4411.007] (-4414.858) * (-4418.102) (-4414.202) (-4415.040) [-4412.578] -- 0:04:49 43500 -- (-4412.583) (-4415.690) [-4413.129] (-4409.939) * (-4417.781) (-4410.695) (-4416.361) [-4409.874] -- 0:04:45 44000 -- [-4416.317] (-4420.629) (-4412.654) (-4410.359) * (-4418.325) (-4413.312) (-4416.166) [-4411.156] -- 0:04:42 44500 -- [-4420.152] (-4415.824) (-4417.792) (-4411.471) * [-4416.931] (-4410.446) (-4412.163) (-4415.655) -- 0:04:39 45000 -- [-4421.216] (-4413.607) (-4413.390) (-4411.382) * (-4415.223) (-4415.021) (-4411.180) [-4409.307] -- 0:04:35 Average standard deviation of split frequencies: 0.000000 45500 -- (-4415.935) (-4413.366) [-4413.109] (-4417.074) * (-4411.173) (-4420.348) [-4409.661] (-4409.293) -- 0:04:53 46000 -- (-4417.093) (-4413.925) [-4414.243] (-4413.836) * (-4416.277) (-4413.143) [-4413.438] (-4415.587) -- 0:04:50 46500 -- (-4417.339) (-4415.475) [-4418.094] (-4415.653) * (-4414.576) (-4415.416) (-4414.912) [-4414.810] -- 0:04:47 47000 -- (-4417.351) [-4414.606] (-4416.899) (-4416.873) * [-4416.418] (-4416.681) (-4410.016) (-4415.574) -- 0:04:43 47500 -- (-4415.102) (-4408.156) [-4416.093] (-4410.025) * (-4420.643) [-4419.851] (-4411.178) (-4420.835) -- 0:04:40 48000 -- (-4412.744) (-4416.148) (-4417.898) [-4415.361] * [-4420.840] (-4412.110) (-4413.560) (-4417.349) -- 0:04:37 48500 -- [-4410.408] (-4413.913) (-4414.303) (-4414.383) * [-4417.315] (-4414.942) (-4419.028) (-4424.646) -- 0:04:34 49000 -- [-4412.490] (-4413.758) (-4417.606) (-4414.015) * (-4416.018) [-4411.023] (-4411.635) (-4416.468) -- 0:04:51 49500 -- (-4413.615) (-4412.493) (-4411.620) [-4419.560] * [-4415.478] (-4409.505) (-4416.066) (-4418.789) -- 0:04:48 50000 -- (-4409.985) (-4413.251) (-4423.543) [-4412.720] * (-4411.085) (-4408.983) (-4416.800) [-4411.813] -- 0:04:45 Average standard deviation of split frequencies: 0.000000 50500 -- (-4408.340) (-4412.384) (-4420.987) [-4416.962] * [-4411.507] (-4418.942) (-4415.133) (-4417.005) -- 0:04:42 51000 -- (-4408.360) [-4422.426] (-4418.574) (-4413.063) * [-4412.126] (-4420.478) (-4414.099) (-4416.470) -- 0:04:39 51500 -- (-4412.950) (-4418.960) [-4414.377] (-4414.631) * [-4409.386] (-4411.980) (-4417.453) (-4419.483) -- 0:04:36 52000 -- [-4410.791] (-4419.766) (-4410.311) (-4409.910) * (-4409.749) [-4418.689] (-4410.828) (-4412.631) -- 0:04:33 52500 -- (-4413.739) (-4416.543) (-4414.288) [-4413.905] * (-4413.833) (-4410.889) (-4414.178) [-4418.404] -- 0:04:48 53000 -- (-4411.496) (-4414.231) (-4415.898) [-4413.406] * (-4409.437) [-4413.553] (-4410.478) (-4420.011) -- 0:04:45 53500 -- (-4414.544) (-4414.946) (-4414.600) [-4417.856] * [-4411.918] (-4418.358) (-4417.664) (-4420.903) -- 0:04:43 54000 -- [-4412.201] (-4413.454) (-4409.253) (-4413.336) * (-4415.009) [-4418.507] (-4425.055) (-4417.791) -- 0:04:40 54500 -- (-4410.755) [-4413.725] (-4412.445) (-4413.957) * (-4413.781) (-4419.322) [-4413.580] (-4414.664) -- 0:04:37 55000 -- (-4409.800) (-4411.828) [-4418.811] (-4414.230) * (-4409.958) (-4417.560) [-4412.947] (-4417.349) -- 0:04:34 Average standard deviation of split frequencies: 0.000000 55500 -- [-4412.895] (-4413.444) (-4412.037) (-4411.072) * [-4411.664] (-4420.155) (-4418.224) (-4414.882) -- 0:04:49 56000 -- [-4409.820] (-4415.254) (-4416.903) (-4414.661) * (-4413.403) [-4413.441] (-4417.776) (-4409.782) -- 0:04:46 56500 -- [-4412.666] (-4411.845) (-4419.248) (-4413.684) * (-4417.612) [-4424.665] (-4411.640) (-4415.589) -- 0:04:43 57000 -- (-4410.197) [-4416.813] (-4415.384) (-4413.425) * (-4414.889) [-4415.393] (-4413.274) (-4414.787) -- 0:04:41 57500 -- [-4418.865] (-4412.973) (-4414.406) (-4414.109) * [-4417.319] (-4416.795) (-4419.349) (-4415.846) -- 0:04:38 58000 -- (-4413.796) (-4414.105) [-4412.468] (-4410.809) * [-4416.962] (-4412.920) (-4415.354) (-4417.116) -- 0:04:52 58500 -- (-4414.330) (-4416.620) [-4417.593] (-4412.090) * (-4413.190) [-4418.255] (-4417.278) (-4413.300) -- 0:04:49 59000 -- (-4419.297) [-4419.227] (-4413.310) (-4415.658) * [-4413.650] (-4415.554) (-4421.363) (-4409.142) -- 0:04:47 59500 -- (-4414.057) (-4414.315) [-4414.002] (-4412.272) * (-4412.501) (-4411.243) (-4416.349) [-4407.709] -- 0:04:44 60000 -- (-4415.034) (-4414.774) [-4410.431] (-4423.446) * (-4412.179) [-4411.704] (-4413.072) (-4409.228) -- 0:04:42 Average standard deviation of split frequencies: 0.000000 60500 -- (-4416.120) (-4415.553) [-4409.293] (-4411.166) * (-4420.501) [-4414.315] (-4415.157) (-4412.101) -- 0:04:39 61000 -- (-4415.183) (-4416.285) [-4419.980] (-4410.521) * (-4411.143) (-4415.416) [-4408.460] (-4413.891) -- 0:04:52 61500 -- (-4417.827) (-4413.032) (-4416.245) [-4411.625] * (-4412.542) (-4415.228) (-4412.769) [-4411.542] -- 0:04:49 62000 -- (-4415.821) (-4416.877) [-4415.497] (-4414.923) * (-4414.604) (-4415.484) [-4409.711] (-4413.671) -- 0:04:47 62500 -- [-4412.642] (-4415.838) (-4423.308) (-4419.238) * (-4415.374) [-4414.167] (-4414.424) (-4416.515) -- 0:04:45 63000 -- [-4413.648] (-4416.374) (-4411.193) (-4418.863) * (-4412.926) (-4408.050) [-4415.319] (-4411.789) -- 0:04:42 63500 -- [-4410.670] (-4415.456) (-4419.588) (-4414.106) * (-4410.851) (-4409.632) [-4417.223] (-4421.945) -- 0:04:40 64000 -- (-4420.985) (-4421.724) (-4414.893) [-4411.840] * [-4415.182] (-4410.937) (-4413.941) (-4412.485) -- 0:04:37 64500 -- (-4416.005) (-4418.014) [-4412.488] (-4415.287) * [-4408.242] (-4420.470) (-4414.267) (-4412.377) -- 0:04:50 65000 -- (-4424.381) (-4421.852) [-4410.425] (-4422.672) * [-4412.496] (-4417.639) (-4413.738) (-4410.415) -- 0:04:47 Average standard deviation of split frequencies: 0.000000 65500 -- (-4413.410) (-4420.138) [-4413.516] (-4428.955) * [-4411.312] (-4417.063) (-4417.508) (-4413.280) -- 0:04:45 66000 -- (-4410.047) (-4410.618) [-4412.830] (-4413.727) * [-4411.822] (-4414.787) (-4412.724) (-4413.284) -- 0:04:43 66500 -- (-4414.925) [-4413.153] (-4414.086) (-4412.500) * [-4408.526] (-4415.194) (-4418.086) (-4411.404) -- 0:04:40 67000 -- (-4413.302) (-4410.862) [-4413.787] (-4409.990) * [-4411.196] (-4414.005) (-4409.811) (-4412.724) -- 0:04:38 67500 -- (-4410.548) (-4414.309) (-4418.448) [-4411.568] * (-4407.256) [-4415.569] (-4415.701) (-4422.067) -- 0:04:36 68000 -- [-4417.226] (-4408.923) (-4414.004) (-4417.711) * (-4409.227) (-4411.549) [-4413.353] (-4410.956) -- 0:04:47 68500 -- [-4413.278] (-4407.221) (-4416.761) (-4414.234) * (-4410.870) [-4419.098] (-4412.374) (-4409.421) -- 0:04:45 69000 -- [-4417.304] (-4413.367) (-4416.534) (-4413.631) * (-4414.732) (-4417.113) [-4414.267] (-4413.246) -- 0:04:43 69500 -- (-4411.996) (-4416.940) [-4417.810] (-4413.837) * (-4411.413) (-4415.870) (-4422.833) [-4408.781] -- 0:04:41 70000 -- (-4415.535) (-4415.084) [-4417.695] (-4412.263) * [-4414.424] (-4421.556) (-4416.366) (-4414.861) -- 0:04:39 Average standard deviation of split frequencies: 0.000000 70500 -- (-4409.868) (-4414.523) (-4413.606) [-4410.669] * (-4418.511) (-4422.359) (-4418.634) [-4416.292] -- 0:04:36 71000 -- (-4414.367) (-4412.722) (-4418.249) [-4411.447] * (-4419.607) [-4410.014] (-4413.346) (-4413.703) -- 0:04:34 71500 -- (-4410.828) (-4409.457) (-4420.654) [-4419.155] * (-4409.800) (-4414.564) (-4413.328) [-4411.121] -- 0:04:45 72000 -- (-4413.886) (-4413.611) [-4410.476] (-4419.426) * [-4415.374] (-4413.489) (-4413.337) (-4414.222) -- 0:04:43 72500 -- (-4416.975) [-4413.080] (-4414.886) (-4412.064) * (-4419.621) (-4414.205) (-4415.678) [-4423.635] -- 0:04:41 73000 -- (-4415.300) (-4415.078) (-4411.992) [-4412.385] * (-4414.644) [-4412.957] (-4415.273) (-4415.779) -- 0:04:39 73500 -- [-4412.312] (-4410.408) (-4417.450) (-4418.300) * (-4411.218) (-4411.255) [-4415.781] (-4419.597) -- 0:04:37 74000 -- (-4415.260) (-4411.302) [-4415.710] (-4411.765) * (-4413.209) (-4412.700) (-4415.494) [-4414.513] -- 0:04:35 74500 -- (-4408.239) [-4411.640] (-4412.016) (-4412.813) * (-4416.245) (-4416.695) [-4413.613] (-4411.413) -- 0:04:33 75000 -- (-4410.637) [-4415.786] (-4408.221) (-4417.002) * (-4414.080) (-4416.926) [-4410.483] (-4414.074) -- 0:04:31 Average standard deviation of split frequencies: 0.000000 75500 -- [-4414.416] (-4412.596) (-4414.652) (-4413.974) * (-4418.545) (-4411.517) [-4411.950] (-4413.645) -- 0:04:41 76000 -- [-4410.085] (-4412.067) (-4412.169) (-4414.001) * (-4429.678) (-4409.500) (-4414.142) [-4417.729] -- 0:04:39 76500 -- (-4416.281) [-4417.144] (-4408.612) (-4419.815) * (-4414.897) [-4410.227] (-4409.746) (-4410.997) -- 0:04:37 77000 -- (-4415.498) [-4414.144] (-4413.640) (-4414.410) * (-4412.268) (-4414.705) (-4410.374) [-4414.589] -- 0:04:35 77500 -- (-4414.372) [-4412.500] (-4417.736) (-4415.520) * (-4417.582) (-4418.738) (-4412.960) [-4416.781] -- 0:04:33 78000 -- [-4419.660] (-4416.778) (-4410.394) (-4415.435) * (-4411.259) (-4417.028) (-4412.993) [-4408.409] -- 0:04:31 78500 -- (-4412.115) [-4413.880] (-4413.298) (-4417.152) * (-4411.453) [-4413.824] (-4408.711) (-4412.289) -- 0:04:29 79000 -- (-4423.828) (-4413.996) (-4414.700) [-4413.425] * (-4415.704) (-4415.463) (-4417.462) [-4411.634] -- 0:04:39 79500 -- (-4426.302) [-4409.147] (-4415.683) (-4412.120) * (-4415.174) (-4421.044) [-4418.938] (-4413.002) -- 0:04:37 80000 -- (-4421.941) (-4412.998) [-4416.926] (-4416.894) * (-4418.603) (-4413.853) (-4412.720) [-4409.769] -- 0:04:36 Average standard deviation of split frequencies: 0.000000 80500 -- [-4412.814] (-4412.783) (-4409.642) (-4413.146) * (-4418.706) (-4415.272) (-4415.800) [-4411.160] -- 0:04:34 81000 -- (-4414.180) (-4422.525) [-4413.272] (-4410.300) * (-4415.224) (-4418.982) [-4411.452] (-4415.441) -- 0:04:32 81500 -- [-4416.547] (-4409.719) (-4410.615) (-4412.419) * (-4412.884) (-4418.058) (-4410.798) [-4421.246] -- 0:04:30 82000 -- (-4426.585) (-4411.907) [-4410.916] (-4412.951) * (-4414.310) (-4414.033) (-4412.466) [-4418.055] -- 0:04:28 82500 -- [-4414.578] (-4416.338) (-4421.405) (-4415.052) * (-4408.510) [-4420.380] (-4412.722) (-4417.541) -- 0:04:38 83000 -- (-4410.260) [-4414.426] (-4413.033) (-4415.882) * (-4413.671) [-4414.442] (-4416.461) (-4415.369) -- 0:04:36 83500 -- (-4408.756) (-4413.245) [-4413.804] (-4415.829) * (-4413.207) [-4414.237] (-4424.935) (-4411.021) -- 0:04:34 84000 -- (-4413.067) (-4413.658) (-4413.162) [-4414.372] * [-4412.846] (-4425.558) (-4419.059) (-4417.922) -- 0:04:32 84500 -- (-4413.624) (-4412.260) [-4410.738] (-4413.269) * [-4415.892] (-4414.659) (-4419.443) (-4422.290) -- 0:04:30 85000 -- [-4415.105] (-4411.775) (-4420.755) (-4418.751) * [-4413.088] (-4415.100) (-4412.978) (-4416.116) -- 0:04:29 Average standard deviation of split frequencies: 0.000000 85500 -- (-4409.069) (-4413.927) [-4410.510] (-4414.226) * (-4412.804) (-4415.270) [-4408.603] (-4417.791) -- 0:04:27 86000 -- (-4411.393) (-4419.081) [-4410.903] (-4411.984) * [-4411.392] (-4417.588) (-4410.696) (-4409.960) -- 0:04:36 86500 -- (-4418.431) (-4417.623) [-4412.450] (-4416.790) * (-4410.780) (-4414.483) (-4416.397) [-4416.925] -- 0:04:34 87000 -- (-4418.335) (-4424.035) (-4410.410) [-4412.787] * (-4416.163) [-4411.558] (-4413.472) (-4415.854) -- 0:04:32 87500 -- (-4419.456) (-4413.090) [-4411.854] (-4409.349) * (-4419.239) (-4411.804) (-4411.239) [-4414.960] -- 0:04:31 88000 -- (-4411.960) [-4411.358] (-4421.455) (-4410.894) * [-4411.096] (-4415.028) (-4418.166) (-4412.634) -- 0:04:29 88500 -- (-4416.011) (-4417.682) [-4410.366] (-4412.065) * (-4412.539) [-4412.062] (-4418.519) (-4408.892) -- 0:04:27 89000 -- [-4415.483] (-4417.768) (-4413.689) (-4411.212) * [-4412.461] (-4412.983) (-4416.017) (-4413.268) -- 0:04:26 89500 -- (-4413.273) [-4417.289] (-4412.397) (-4425.386) * (-4411.461) [-4411.063] (-4420.465) (-4412.529) -- 0:04:34 90000 -- (-4413.609) (-4421.144) (-4411.080) [-4415.534] * (-4414.430) (-4414.250) [-4413.196] (-4414.985) -- 0:04:33 Average standard deviation of split frequencies: 0.000000 90500 -- (-4415.089) [-4414.002] (-4418.437) (-4418.721) * (-4414.132) (-4413.591) [-4413.323] (-4410.629) -- 0:04:31 91000 -- [-4412.696] (-4413.606) (-4416.195) (-4421.709) * (-4417.166) (-4416.245) (-4412.792) [-4412.146] -- 0:04:29 91500 -- (-4412.753) [-4414.335] (-4412.806) (-4415.477) * (-4412.466) (-4420.747) (-4417.610) [-4417.396] -- 0:04:28 92000 -- (-4419.074) (-4420.380) [-4411.032] (-4422.542) * (-4414.049) (-4413.997) [-4412.313] (-4411.822) -- 0:04:26 92500 -- (-4414.824) (-4414.490) [-4413.936] (-4423.950) * (-4417.464) (-4410.421) (-4417.584) [-4419.728] -- 0:04:24 93000 -- [-4411.410] (-4418.655) (-4418.918) (-4423.592) * [-4416.159] (-4415.014) (-4413.383) (-4418.442) -- 0:04:33 93500 -- [-4413.645] (-4413.515) (-4420.993) (-4423.839) * (-4416.306) [-4417.188] (-4417.172) (-4418.601) -- 0:04:31 94000 -- (-4412.543) (-4410.398) (-4414.408) [-4418.788] * (-4413.458) [-4413.394] (-4416.930) (-4416.014) -- 0:04:29 94500 -- (-4413.100) (-4417.116) [-4409.199] (-4415.091) * (-4412.965) (-4418.297) (-4416.957) [-4411.072] -- 0:04:28 95000 -- (-4413.437) (-4414.190) (-4415.854) [-4411.324] * (-4423.478) (-4414.257) (-4413.746) [-4409.343] -- 0:04:26 Average standard deviation of split frequencies: 0.000000 95500 -- (-4413.684) (-4420.042) [-4411.799] (-4413.440) * (-4415.306) [-4415.654] (-4421.264) (-4415.074) -- 0:04:25 96000 -- (-4411.901) (-4411.590) [-4413.058] (-4414.431) * (-4417.777) (-4411.598) (-4410.925) [-4413.835] -- 0:04:23 96500 -- (-4416.280) [-4412.310] (-4419.687) (-4412.744) * (-4412.048) (-4415.046) (-4410.024) [-4415.979] -- 0:04:31 97000 -- (-4424.259) [-4412.036] (-4412.697) (-4413.779) * (-4415.546) (-4415.908) [-4415.177] (-4416.132) -- 0:04:29 97500 -- (-4421.861) (-4411.319) (-4420.686) [-4411.878] * (-4415.713) (-4414.906) [-4411.588] (-4414.864) -- 0:04:28 98000 -- (-4423.857) (-4415.559) [-4416.140] (-4416.911) * (-4419.112) (-4413.772) [-4412.724] (-4409.771) -- 0:04:26 98500 -- [-4417.331] (-4414.901) (-4416.596) (-4412.022) * (-4420.984) (-4411.035) (-4410.300) [-4408.348] -- 0:04:25 99000 -- (-4424.094) (-4419.129) [-4416.829] (-4415.993) * (-4415.705) (-4408.087) [-4412.193] (-4413.750) -- 0:04:23 99500 -- (-4412.775) [-4419.186] (-4411.974) (-4418.742) * (-4413.683) (-4409.834) (-4412.207) [-4411.830] -- 0:04:22 100000 -- (-4415.066) (-4416.056) [-4413.668] (-4413.382) * (-4417.703) (-4413.246) (-4415.026) [-4415.356] -- 0:04:30 Average standard deviation of split frequencies: 0.000000 100500 -- (-4414.760) [-4419.996] (-4414.362) (-4420.592) * [-4415.567] (-4417.430) (-4413.774) (-4415.706) -- 0:04:28 101000 -- (-4420.518) [-4417.034] (-4415.858) (-4408.939) * (-4411.775) [-4409.889] (-4414.367) (-4415.536) -- 0:04:27 101500 -- (-4412.737) [-4415.632] (-4416.097) (-4412.102) * (-4418.820) (-4417.016) (-4414.417) [-4411.504] -- 0:04:25 102000 -- (-4422.963) (-4411.616) (-4412.101) [-4411.407] * (-4422.317) (-4417.840) (-4411.372) [-4408.604] -- 0:04:24 102500 -- (-4420.874) (-4415.936) [-4414.724] (-4411.147) * (-4414.182) (-4419.009) [-4412.987] (-4409.628) -- 0:04:22 103000 -- (-4410.713) (-4416.147) (-4425.231) [-4414.055] * (-4419.277) (-4426.868) (-4411.244) [-4412.335] -- 0:04:21 103500 -- [-4412.285] (-4415.629) (-4414.022) (-4412.890) * [-4413.909] (-4416.175) (-4413.360) (-4408.927) -- 0:04:28 104000 -- (-4422.444) (-4415.351) [-4415.386] (-4413.091) * (-4416.291) (-4414.007) (-4415.460) [-4413.135] -- 0:04:27 104500 -- (-4411.643) (-4416.666) (-4421.239) [-4416.252] * (-4418.312) [-4417.761] (-4414.947) (-4411.440) -- 0:04:25 105000 -- [-4411.023] (-4417.041) (-4418.067) (-4421.217) * [-4417.858] (-4421.242) (-4414.992) (-4410.001) -- 0:04:24 Average standard deviation of split frequencies: 0.000000 105500 -- [-4411.489] (-4415.034) (-4412.534) (-4418.616) * [-4416.733] (-4414.929) (-4418.737) (-4411.383) -- 0:04:22 106000 -- (-4413.810) (-4415.800) (-4415.152) [-4413.666] * (-4417.138) [-4416.123] (-4412.087) (-4414.952) -- 0:04:21 106500 -- [-4414.309] (-4415.638) (-4416.314) (-4419.823) * (-4423.672) [-4411.854] (-4414.084) (-4415.776) -- 0:04:20 107000 -- (-4412.513) [-4413.399] (-4415.148) (-4416.554) * (-4410.925) (-4409.836) [-4412.400] (-4416.943) -- 0:04:27 107500 -- (-4416.164) (-4411.810) (-4414.949) [-4413.516] * (-4413.434) (-4411.241) (-4411.988) [-4410.208] -- 0:04:25 108000 -- (-4414.917) (-4413.298) [-4413.250] (-4414.645) * (-4411.523) (-4414.454) (-4412.768) [-4414.957] -- 0:04:24 108500 -- (-4414.719) (-4416.462) [-4413.391] (-4423.589) * (-4415.078) (-4410.533) [-4414.954] (-4418.301) -- 0:04:22 109000 -- (-4418.840) (-4412.972) (-4418.745) [-4422.000] * (-4412.390) [-4410.834] (-4411.638) (-4412.588) -- 0:04:21 109500 -- (-4415.786) (-4414.369) (-4417.592) [-4411.102] * (-4419.432) [-4408.839] (-4411.722) (-4414.523) -- 0:04:20 110000 -- (-4413.450) [-4412.858] (-4423.597) (-4416.129) * [-4412.328] (-4411.891) (-4410.860) (-4415.485) -- 0:04:18 Average standard deviation of split frequencies: 0.000000 110500 -- (-4412.542) (-4411.631) (-4420.805) [-4414.028] * (-4416.228) (-4413.185) (-4413.737) [-4412.205] -- 0:04:17 111000 -- (-4413.136) (-4413.888) [-4415.865] (-4417.884) * (-4411.203) (-4410.230) (-4415.461) [-4410.394] -- 0:04:24 111500 -- [-4417.614] (-4410.904) (-4416.921) (-4412.885) * (-4417.286) (-4409.232) [-4411.805] (-4415.067) -- 0:04:22 112000 -- (-4418.190) (-4417.746) (-4415.125) [-4418.439] * (-4415.910) (-4414.272) [-4414.434] (-4417.514) -- 0:04:21 112500 -- (-4415.101) (-4418.423) [-4411.683] (-4414.693) * (-4423.743) (-4417.597) (-4417.317) [-4415.984] -- 0:04:20 113000 -- [-4408.416] (-4416.768) (-4412.500) (-4415.035) * (-4414.111) [-4409.031] (-4414.615) (-4414.031) -- 0:04:19 113500 -- (-4414.207) (-4412.020) (-4422.451) [-4414.048] * [-4418.062] (-4411.344) (-4421.808) (-4419.607) -- 0:04:17 114000 -- (-4413.368) [-4416.705] (-4417.383) (-4417.032) * (-4411.330) (-4410.922) [-4410.425] (-4412.774) -- 0:04:16 114500 -- (-4418.226) (-4418.140) [-4415.571] (-4413.846) * (-4416.779) (-4411.745) (-4409.856) [-4416.987] -- 0:04:22 115000 -- [-4412.424] (-4420.198) (-4412.176) (-4413.771) * [-4416.750] (-4412.543) (-4414.458) (-4408.177) -- 0:04:21 Average standard deviation of split frequencies: 0.000000 115500 -- [-4412.801] (-4414.528) (-4412.826) (-4419.089) * (-4408.773) (-4420.370) (-4424.023) [-4412.958] -- 0:04:20 116000 -- (-4420.112) (-4412.189) (-4414.001) [-4417.545] * (-4414.956) (-4420.242) [-4416.180] (-4416.429) -- 0:04:19 116500 -- (-4413.225) (-4413.208) [-4415.543] (-4417.164) * (-4413.588) [-4409.413] (-4421.778) (-4415.063) -- 0:04:17 117000 -- [-4417.499] (-4411.896) (-4417.946) (-4416.765) * (-4418.494) (-4417.860) [-4413.425] (-4414.483) -- 0:04:16 117500 -- (-4413.570) [-4411.272] (-4409.213) (-4413.919) * [-4412.017] (-4412.338) (-4410.581) (-4411.080) -- 0:04:15 118000 -- (-4419.601) [-4414.064] (-4412.379) (-4413.448) * (-4410.412) (-4416.567) (-4414.825) [-4410.535] -- 0:04:21 118500 -- (-4412.119) (-4408.999) (-4414.383) [-4413.390] * (-4410.614) (-4424.873) (-4413.364) [-4410.973] -- 0:04:20 119000 -- [-4411.266] (-4415.653) (-4410.890) (-4413.058) * (-4412.960) (-4427.759) [-4416.282] (-4407.710) -- 0:04:19 119500 -- (-4414.406) [-4411.675] (-4416.410) (-4410.556) * [-4413.620] (-4417.926) (-4416.706) (-4418.158) -- 0:04:17 120000 -- (-4416.695) [-4417.130] (-4415.304) (-4412.777) * (-4412.921) (-4411.861) (-4415.857) [-4414.351] -- 0:04:16 Average standard deviation of split frequencies: 0.000000 120500 -- (-4417.073) (-4414.753) [-4414.566] (-4409.115) * (-4418.184) [-4416.192] (-4415.113) (-4414.401) -- 0:04:15 121000 -- (-4413.062) (-4414.174) [-4415.921] (-4416.493) * [-4412.478] (-4417.960) (-4414.165) (-4418.069) -- 0:04:14 121500 -- (-4414.183) (-4413.018) (-4419.767) [-4412.613] * [-4412.388] (-4416.622) (-4415.956) (-4413.918) -- 0:04:20 122000 -- (-4415.989) (-4412.195) (-4413.027) [-4412.712] * (-4412.411) (-4418.574) [-4417.568] (-4413.771) -- 0:04:19 122500 -- (-4418.309) (-4416.307) [-4411.061] (-4414.864) * (-4412.440) (-4419.005) (-4421.975) [-4414.879] -- 0:04:17 123000 -- (-4410.545) (-4418.425) (-4418.831) [-4410.429] * (-4413.475) (-4418.783) [-4416.226] (-4413.995) -- 0:04:16 123500 -- (-4410.760) (-4412.140) (-4410.098) [-4414.112] * [-4415.123] (-4420.070) (-4411.598) (-4414.335) -- 0:04:15 124000 -- (-4418.327) (-4409.346) [-4413.930] (-4417.280) * (-4415.179) [-4412.972] (-4411.318) (-4413.462) -- 0:04:14 124500 -- (-4413.686) (-4411.712) (-4412.157) [-4413.880] * (-4412.711) [-4410.902] (-4420.487) (-4411.230) -- 0:04:13 125000 -- (-4416.528) (-4412.044) (-4412.927) [-4413.999] * [-4417.410] (-4417.056) (-4416.870) (-4408.563) -- 0:04:19 Average standard deviation of split frequencies: 0.000000 125500 -- [-4412.087] (-4420.638) (-4411.365) (-4418.742) * (-4412.136) (-4414.371) [-4415.770] (-4412.372) -- 0:04:17 126000 -- (-4419.604) [-4417.128] (-4415.592) (-4413.066) * (-4412.724) (-4411.347) [-4418.248] (-4410.314) -- 0:04:16 126500 -- (-4416.414) [-4419.771] (-4412.508) (-4420.010) * (-4416.677) (-4410.696) (-4414.767) [-4413.890] -- 0:04:15 127000 -- (-4413.364) (-4418.980) (-4411.170) [-4413.928] * (-4419.186) (-4413.153) (-4417.318) [-4413.340] -- 0:04:14 127500 -- (-4414.425) (-4418.195) [-4415.473] (-4406.106) * [-4419.142] (-4424.972) (-4419.508) (-4411.026) -- 0:04:13 128000 -- (-4418.433) (-4413.312) [-4414.592] (-4408.920) * (-4415.565) [-4412.585] (-4417.652) (-4412.964) -- 0:04:12 128500 -- (-4412.001) [-4416.631] (-4410.116) (-4411.987) * (-4411.918) [-4415.680] (-4420.929) (-4415.613) -- 0:04:17 129000 -- [-4412.306] (-4415.257) (-4414.293) (-4414.995) * (-4412.153) [-4413.197] (-4421.556) (-4415.533) -- 0:04:16 129500 -- (-4413.466) (-4416.267) (-4415.660) [-4413.373] * [-4407.810] (-4417.066) (-4420.295) (-4417.902) -- 0:04:15 130000 -- (-4418.622) (-4413.193) (-4412.259) [-4409.822] * (-4417.061) (-4415.035) [-4413.856] (-4413.128) -- 0:04:14 Average standard deviation of split frequencies: 0.000000 130500 -- (-4411.649) (-4416.936) [-4412.769] (-4414.460) * (-4411.336) [-4418.372] (-4415.752) (-4419.439) -- 0:04:13 131000 -- [-4423.530] (-4418.594) (-4412.142) (-4415.081) * (-4416.822) [-4415.065] (-4415.571) (-4417.184) -- 0:04:12 131500 -- (-4417.736) (-4413.239) (-4417.115) [-4414.359] * [-4413.402] (-4416.318) (-4412.141) (-4411.621) -- 0:04:10 132000 -- (-4418.190) (-4409.472) [-4414.845] (-4418.701) * [-4416.683] (-4412.897) (-4413.552) (-4411.589) -- 0:04:16 132500 -- [-4415.215] (-4410.482) (-4415.884) (-4413.255) * (-4410.165) (-4416.071) [-4414.716] (-4411.614) -- 0:04:15 133000 -- (-4419.583) [-4418.642] (-4416.803) (-4411.684) * (-4409.401) (-4415.228) (-4417.137) [-4412.079] -- 0:04:14 133500 -- (-4416.400) [-4419.150] (-4413.556) (-4416.560) * [-4410.965] (-4415.333) (-4416.142) (-4411.643) -- 0:04:13 134000 -- (-4419.094) [-4413.261] (-4412.341) (-4415.020) * (-4412.460) (-4411.874) [-4412.393] (-4415.322) -- 0:04:12 134500 -- (-4416.813) (-4411.192) [-4411.944] (-4415.025) * [-4418.607] (-4416.365) (-4416.840) (-4416.179) -- 0:04:10 135000 -- (-4416.752) (-4412.373) [-4416.488] (-4414.069) * (-4416.597) (-4414.080) [-4411.547] (-4414.121) -- 0:04:09 Average standard deviation of split frequencies: 0.000000 135500 -- (-4416.630) (-4414.483) [-4410.100] (-4418.253) * (-4415.075) (-4419.366) (-4413.015) [-4409.608] -- 0:04:15 136000 -- (-4415.073) [-4413.322] (-4417.377) (-4422.991) * (-4416.925) (-4417.096) (-4422.485) [-4412.850] -- 0:04:14 136500 -- (-4410.684) [-4410.864] (-4412.908) (-4415.635) * (-4413.624) (-4410.908) [-4411.026] (-4412.812) -- 0:04:13 137000 -- (-4415.044) [-4410.032] (-4416.271) (-4414.012) * (-4416.442) (-4412.543) (-4412.781) [-4411.030] -- 0:04:11 137500 -- (-4413.295) (-4412.397) [-4411.694] (-4414.510) * (-4419.729) [-4413.011] (-4415.637) (-4408.357) -- 0:04:10 138000 -- (-4414.364) (-4413.750) (-4410.717) [-4413.456] * (-4417.433) (-4410.698) [-4413.328] (-4411.574) -- 0:04:09 138500 -- (-4415.700) (-4416.480) [-4412.481] (-4413.651) * (-4418.780) (-4414.654) (-4424.034) [-4416.111] -- 0:04:08 139000 -- [-4414.693] (-4417.737) (-4411.558) (-4410.522) * (-4414.381) (-4409.945) (-4416.989) [-4412.284] -- 0:04:13 139500 -- (-4414.393) [-4410.817] (-4414.308) (-4414.781) * (-4411.612) (-4411.776) [-4412.260] (-4412.406) -- 0:04:12 140000 -- (-4414.314) (-4412.007) (-4415.118) [-4408.104] * (-4415.801) (-4409.499) (-4410.060) [-4409.212] -- 0:04:11 Average standard deviation of split frequencies: 0.000000 140500 -- (-4412.068) [-4412.484] (-4412.257) (-4415.039) * (-4416.139) [-4418.082] (-4411.950) (-4409.894) -- 0:04:10 141000 -- (-4412.714) (-4416.415) [-4409.839] (-4416.861) * (-4414.844) (-4419.809) [-4416.005] (-4411.346) -- 0:04:09 141500 -- (-4409.551) [-4414.200] (-4420.999) (-4418.562) * (-4411.271) (-4415.182) (-4415.842) [-4412.828] -- 0:04:08 142000 -- (-4420.757) (-4413.797) (-4415.537) [-4413.007] * (-4421.187) (-4416.818) [-4418.136] (-4412.668) -- 0:04:07 142500 -- [-4413.115] (-4414.080) (-4423.923) (-4413.412) * (-4418.957) (-4415.163) [-4412.032] (-4410.411) -- 0:04:06 143000 -- (-4415.117) (-4412.462) (-4411.496) [-4410.923] * (-4421.228) (-4413.592) (-4410.982) [-4413.476] -- 0:04:11 143500 -- [-4413.470] (-4412.160) (-4411.556) (-4412.979) * (-4421.048) (-4415.439) (-4409.804) [-4413.087] -- 0:04:10 144000 -- [-4413.959] (-4413.591) (-4411.543) (-4413.302) * (-4412.587) (-4412.559) [-4416.592] (-4414.477) -- 0:04:09 144500 -- (-4411.321) (-4410.789) [-4410.910] (-4420.675) * [-4409.398] (-4417.541) (-4409.879) (-4411.832) -- 0:04:08 145000 -- (-4412.510) [-4415.295] (-4412.497) (-4426.838) * (-4411.907) (-4412.334) [-4416.951] (-4421.803) -- 0:04:07 Average standard deviation of split frequencies: 0.000000 145500 -- [-4416.178] (-4420.656) (-4412.941) (-4430.717) * [-4412.360] (-4412.367) (-4415.579) (-4415.485) -- 0:04:06 146000 -- [-4418.513] (-4417.703) (-4412.859) (-4432.433) * (-4413.873) (-4411.329) [-4416.054] (-4414.461) -- 0:04:05 146500 -- [-4416.742] (-4410.189) (-4414.039) (-4433.948) * (-4416.451) (-4411.341) (-4419.356) [-4413.238] -- 0:04:10 147000 -- [-4411.714] (-4409.380) (-4414.946) (-4424.408) * (-4414.571) [-4412.872] (-4411.300) (-4413.029) -- 0:04:09 147500 -- [-4414.065] (-4416.392) (-4413.452) (-4430.415) * (-4416.300) (-4413.441) [-4415.441] (-4414.140) -- 0:04:08 148000 -- (-4410.372) (-4421.323) [-4407.770] (-4414.758) * (-4413.929) [-4414.586] (-4416.487) (-4416.746) -- 0:04:07 148500 -- [-4417.570] (-4424.693) (-4411.771) (-4420.173) * (-4415.121) (-4411.930) (-4421.408) [-4419.186] -- 0:04:06 149000 -- (-4421.574) [-4410.201] (-4410.845) (-4419.718) * (-4426.824) [-4410.566] (-4418.464) (-4412.193) -- 0:04:05 149500 -- (-4420.960) (-4417.155) [-4416.338] (-4412.556) * (-4414.371) (-4409.319) (-4415.734) [-4418.939] -- 0:04:04 150000 -- (-4418.956) [-4412.096] (-4410.357) (-4416.269) * [-4411.550] (-4409.438) (-4432.255) (-4412.195) -- 0:04:09 Average standard deviation of split frequencies: 0.000000 150500 -- (-4415.681) (-4414.056) (-4416.859) [-4415.067] * (-4417.797) [-4417.606] (-4422.393) (-4413.840) -- 0:04:08 151000 -- [-4414.237] (-4417.658) (-4418.758) (-4414.160) * (-4416.972) (-4414.614) [-4412.139] (-4410.690) -- 0:04:07 151500 -- (-4411.340) (-4410.220) [-4409.223] (-4412.400) * [-4415.669] (-4411.640) (-4413.226) (-4415.141) -- 0:04:06 152000 -- (-4412.537) (-4416.032) [-4411.257] (-4409.410) * (-4411.264) (-4411.426) [-4418.352] (-4421.321) -- 0:04:05 152500 -- [-4411.142] (-4412.892) (-4411.332) (-4419.584) * (-4420.138) (-4413.972) (-4413.348) [-4417.891] -- 0:04:04 153000 -- (-4413.837) [-4414.572] (-4419.436) (-4410.197) * (-4421.516) (-4418.035) [-4409.233] (-4416.187) -- 0:04:03 153500 -- (-4412.120) [-4412.529] (-4415.948) (-4416.109) * (-4416.297) (-4417.121) (-4410.520) [-4418.402] -- 0:04:08 154000 -- (-4417.675) [-4415.537] (-4410.831) (-4419.912) * (-4416.036) (-4421.038) [-4411.800] (-4412.361) -- 0:04:07 154500 -- (-4421.395) (-4413.200) [-4418.865] (-4420.507) * (-4415.755) (-4421.346) [-4414.146] (-4418.385) -- 0:04:06 155000 -- (-4409.640) [-4410.651] (-4414.338) (-4414.561) * (-4414.812) (-4415.920) [-4409.791] (-4414.028) -- 0:04:05 Average standard deviation of split frequencies: 0.000000 155500 -- (-4412.380) [-4413.486] (-4411.211) (-4423.097) * (-4414.756) (-4413.577) [-4410.217] (-4416.808) -- 0:04:04 156000 -- [-4414.826] (-4413.749) (-4414.514) (-4414.749) * (-4416.097) (-4414.250) (-4409.671) [-4412.919] -- 0:04:03 156500 -- (-4414.228) [-4411.810] (-4412.172) (-4414.848) * (-4416.012) (-4414.702) [-4412.539] (-4413.346) -- 0:04:02 157000 -- (-4415.691) (-4413.212) [-4413.463] (-4414.770) * (-4413.184) (-4414.056) [-4410.748] (-4408.682) -- 0:04:06 157500 -- (-4413.420) [-4418.891] (-4413.312) (-4417.363) * (-4420.857) [-4413.754] (-4420.784) (-4415.880) -- 0:04:06 158000 -- (-4415.036) (-4424.079) (-4414.128) [-4415.605] * (-4417.205) (-4412.467) [-4411.901] (-4413.830) -- 0:04:05 158500 -- [-4416.319] (-4417.718) (-4417.690) (-4413.403) * (-4417.869) [-4410.331] (-4419.346) (-4413.752) -- 0:04:04 159000 -- (-4408.462) (-4423.753) (-4418.376) [-4411.357] * (-4416.033) [-4415.242] (-4421.961) (-4413.289) -- 0:04:03 159500 -- (-4411.228) (-4409.278) [-4412.546] (-4412.590) * [-4412.031] (-4414.475) (-4422.291) (-4408.885) -- 0:04:02 160000 -- (-4414.122) (-4415.660) (-4411.980) [-4419.162] * [-4411.706] (-4418.058) (-4412.495) (-4409.488) -- 0:04:01 Average standard deviation of split frequencies: 0.000000 160500 -- (-4411.475) [-4415.034] (-4414.881) (-4417.383) * (-4421.017) (-4417.257) (-4417.280) [-4412.452] -- 0:04:05 161000 -- (-4412.120) (-4410.414) (-4411.695) [-4419.125] * [-4415.300] (-4419.411) (-4415.447) (-4413.733) -- 0:04:04 161500 -- (-4413.305) (-4414.446) [-4411.282] (-4415.049) * [-4414.775] (-4412.772) (-4414.880) (-4415.199) -- 0:04:04 162000 -- (-4414.410) (-4411.304) (-4411.503) [-4411.350] * [-4412.923] (-4415.775) (-4415.057) (-4414.925) -- 0:04:03 162500 -- (-4420.621) (-4415.430) [-4417.441] (-4426.908) * (-4414.981) (-4415.478) [-4409.790] (-4413.325) -- 0:04:02 163000 -- (-4418.669) (-4414.291) [-4411.392] (-4420.316) * (-4412.058) (-4416.673) [-4412.850] (-4421.912) -- 0:04:01 163500 -- (-4417.597) (-4421.200) (-4416.510) [-4414.242] * (-4415.124) (-4408.472) [-4414.411] (-4410.587) -- 0:04:00 164000 -- [-4414.548] (-4422.730) (-4413.699) (-4420.095) * (-4413.177) (-4417.674) (-4417.993) [-4410.152] -- 0:04:04 164500 -- (-4415.831) (-4423.460) [-4413.506] (-4421.434) * [-4414.903] (-4417.717) (-4423.045) (-4411.566) -- 0:04:03 165000 -- (-4412.009) [-4415.618] (-4415.043) (-4418.135) * (-4413.359) (-4412.571) [-4417.566] (-4415.139) -- 0:04:02 Average standard deviation of split frequencies: 0.000000 165500 -- (-4412.509) (-4421.781) [-4417.704] (-4419.646) * (-4422.539) (-4413.534) [-4417.411] (-4415.398) -- 0:04:02 166000 -- [-4411.548] (-4417.586) (-4415.423) (-4413.201) * (-4414.507) (-4416.181) (-4417.718) [-4416.260] -- 0:04:01 166500 -- (-4412.378) [-4412.398] (-4423.701) (-4413.726) * (-4415.948) (-4411.878) [-4415.905] (-4417.363) -- 0:04:00 167000 -- (-4415.900) [-4424.125] (-4430.470) (-4413.083) * (-4416.920) [-4410.379] (-4414.698) (-4413.571) -- 0:03:59 167500 -- (-4417.019) (-4411.023) [-4413.350] (-4415.491) * (-4409.460) (-4417.634) (-4419.046) [-4413.991] -- 0:04:03 168000 -- (-4423.976) [-4415.101] (-4413.436) (-4417.547) * [-4411.663] (-4414.577) (-4418.612) (-4416.439) -- 0:04:02 168500 -- (-4415.047) (-4413.589) [-4414.981] (-4411.343) * [-4415.491] (-4414.404) (-4419.290) (-4410.412) -- 0:04:01 169000 -- (-4413.337) (-4413.491) (-4410.490) [-4418.584] * (-4413.867) [-4411.348] (-4413.641) (-4411.963) -- 0:04:00 169500 -- (-4411.904) (-4417.077) (-4411.976) [-4415.866] * (-4417.628) (-4412.920) (-4415.213) [-4410.670] -- 0:04:00 170000 -- (-4411.817) [-4414.095] (-4413.215) (-4412.297) * (-4420.323) (-4415.677) (-4416.422) [-4413.233] -- 0:03:59 Average standard deviation of split frequencies: 0.000000 170500 -- (-4412.167) [-4412.654] (-4416.109) (-4419.153) * [-4415.594] (-4414.541) (-4417.021) (-4411.527) -- 0:03:58 171000 -- (-4417.193) [-4419.272] (-4421.670) (-4412.611) * [-4419.276] (-4419.130) (-4412.012) (-4411.873) -- 0:04:02 171500 -- (-4416.496) (-4414.748) (-4424.677) [-4418.858] * (-4413.748) [-4411.682] (-4416.296) (-4415.610) -- 0:04:01 172000 -- [-4414.423] (-4416.221) (-4418.335) (-4415.441) * (-4412.897) (-4418.966) [-4414.601] (-4417.432) -- 0:04:00 172500 -- (-4411.061) (-4417.699) (-4421.656) [-4419.518] * (-4413.277) (-4410.594) (-4412.381) [-4409.665] -- 0:03:59 173000 -- (-4410.763) [-4412.944] (-4419.989) (-4419.750) * (-4414.596) [-4412.620] (-4417.878) (-4412.317) -- 0:03:59 173500 -- (-4410.425) [-4411.651] (-4417.095) (-4416.564) * (-4408.438) (-4414.809) (-4420.862) [-4418.502] -- 0:03:58 174000 -- (-4413.842) (-4410.735) [-4410.552] (-4412.881) * (-4415.442) (-4415.266) [-4415.557] (-4415.718) -- 0:03:57 174500 -- (-4421.955) [-4414.018] (-4410.880) (-4416.258) * (-4421.302) [-4409.969] (-4418.271) (-4412.932) -- 0:04:01 175000 -- [-4414.052] (-4418.097) (-4418.751) (-4417.604) * (-4416.720) (-4414.777) (-4410.491) [-4419.338] -- 0:04:00 Average standard deviation of split frequencies: 0.000000 175500 -- (-4412.605) (-4419.982) [-4418.318] (-4422.746) * (-4411.897) [-4415.569] (-4412.843) (-4413.965) -- 0:03:59 176000 -- [-4408.674] (-4424.406) (-4418.456) (-4414.852) * (-4414.454) [-4412.081] (-4421.331) (-4411.897) -- 0:03:58 176500 -- [-4412.799] (-4417.119) (-4421.343) (-4416.331) * (-4420.503) (-4416.712) [-4417.841] (-4414.065) -- 0:03:57 177000 -- [-4410.661] (-4419.226) (-4418.825) (-4414.867) * (-4419.853) [-4416.601] (-4410.687) (-4412.033) -- 0:03:57 177500 -- [-4411.522] (-4412.734) (-4419.386) (-4412.884) * (-4412.811) [-4416.201] (-4418.450) (-4423.665) -- 0:03:56 178000 -- (-4410.581) [-4414.270] (-4418.957) (-4411.381) * (-4411.397) (-4420.209) [-4411.902] (-4412.573) -- 0:04:00 178500 -- (-4412.425) [-4409.944] (-4417.946) (-4411.985) * [-4421.236] (-4426.280) (-4426.519) (-4414.832) -- 0:03:59 179000 -- (-4413.219) [-4411.026] (-4417.720) (-4416.064) * [-4415.853] (-4416.007) (-4415.728) (-4413.085) -- 0:03:58 179500 -- (-4414.823) [-4410.673] (-4414.432) (-4412.754) * (-4419.138) [-4408.743] (-4410.684) (-4417.812) -- 0:03:57 180000 -- (-4413.625) (-4415.744) [-4414.322] (-4414.586) * [-4413.047] (-4412.407) (-4416.443) (-4413.654) -- 0:03:56 Average standard deviation of split frequencies: 0.000000 180500 -- (-4420.385) (-4416.333) (-4418.742) [-4412.752] * (-4414.549) (-4410.748) (-4411.610) [-4408.777] -- 0:03:56 181000 -- (-4423.921) (-4416.690) (-4412.742) [-4411.460] * (-4416.555) (-4411.396) (-4413.473) [-4415.633] -- 0:03:55 181500 -- (-4420.371) (-4420.973) [-4413.204] (-4414.908) * (-4413.570) [-4416.411] (-4416.015) (-4422.153) -- 0:03:59 182000 -- [-4414.571] (-4411.680) (-4414.108) (-4415.793) * (-4413.736) [-4416.854] (-4413.088) (-4416.135) -- 0:03:58 182500 -- (-4421.753) (-4418.508) [-4410.481] (-4413.509) * (-4414.651) [-4412.401] (-4414.610) (-4413.547) -- 0:03:57 183000 -- (-4415.384) (-4415.794) [-4408.889] (-4416.482) * [-4417.863] (-4414.962) (-4411.459) (-4412.401) -- 0:03:56 183500 -- (-4420.838) (-4415.668) (-4411.997) [-4413.320] * (-4411.239) (-4417.451) (-4412.403) [-4410.911] -- 0:03:55 184000 -- (-4412.794) (-4421.599) [-4416.492] (-4414.350) * [-4410.867] (-4413.429) (-4417.493) (-4414.209) -- 0:03:55 184500 -- [-4412.277] (-4420.109) (-4412.041) (-4416.308) * (-4415.156) (-4416.330) [-4413.859] (-4415.763) -- 0:03:54 185000 -- (-4419.457) (-4414.194) [-4413.396] (-4420.682) * (-4415.212) (-4422.791) (-4414.181) [-4412.987] -- 0:03:53 Average standard deviation of split frequencies: 0.000000 185500 -- (-4415.802) [-4411.206] (-4418.227) (-4422.898) * (-4409.406) [-4416.969] (-4413.278) (-4420.072) -- 0:03:57 186000 -- (-4411.740) (-4414.782) [-4412.567] (-4416.066) * (-4409.891) (-4413.340) (-4414.026) [-4412.901] -- 0:03:56 186500 -- (-4416.729) (-4420.274) [-4420.006] (-4411.955) * [-4412.575] (-4411.442) (-4414.997) (-4412.804) -- 0:03:55 187000 -- (-4411.889) (-4414.160) (-4420.394) [-4417.795] * (-4411.326) (-4412.061) (-4418.153) [-4411.796] -- 0:03:54 187500 -- (-4419.898) [-4418.514] (-4410.827) (-4414.093) * (-4413.089) (-4412.944) (-4422.813) [-4418.857] -- 0:03:54 188000 -- (-4418.240) [-4412.405] (-4409.752) (-4416.843) * (-4414.458) (-4409.970) [-4414.185] (-4431.230) -- 0:03:53 188500 -- (-4426.609) [-4417.315] (-4409.780) (-4418.457) * (-4410.904) (-4410.908) [-4415.115] (-4416.665) -- 0:03:52 189000 -- (-4417.359) (-4410.415) [-4411.848] (-4423.000) * (-4417.633) (-4413.296) [-4422.635] (-4418.613) -- 0:03:56 189500 -- (-4418.652) (-4414.703) [-4418.252] (-4423.180) * (-4415.841) (-4416.617) (-4416.343) [-4410.960] -- 0:03:55 190000 -- (-4416.658) [-4411.251] (-4418.285) (-4410.257) * (-4415.815) (-4410.588) [-4421.303] (-4414.627) -- 0:03:54 Average standard deviation of split frequencies: 0.000000 190500 -- (-4422.927) (-4412.257) (-4415.806) [-4412.575] * (-4415.656) (-4409.584) (-4416.323) [-4412.623] -- 0:03:53 191000 -- (-4419.949) (-4413.248) (-4418.212) [-4418.459] * (-4413.006) [-4413.386] (-4415.574) (-4416.013) -- 0:03:52 191500 -- (-4418.739) (-4417.276) (-4420.870) [-4416.960] * (-4417.499) (-4412.256) [-4413.825] (-4413.359) -- 0:03:52 192000 -- (-4416.752) (-4412.941) [-4413.366] (-4411.436) * [-4413.597] (-4410.129) (-4415.159) (-4411.120) -- 0:03:51 192500 -- (-4412.346) (-4420.175) [-4417.820] (-4419.799) * (-4418.980) (-4412.686) (-4407.696) [-4409.547] -- 0:03:54 193000 -- (-4412.241) (-4420.445) (-4412.793) [-4417.701] * (-4418.641) (-4417.256) (-4410.722) [-4409.924] -- 0:03:54 193500 -- (-4421.252) [-4417.010] (-4421.447) (-4414.428) * (-4415.776) [-4419.216] (-4416.936) (-4411.336) -- 0:03:53 194000 -- (-4421.555) (-4412.171) (-4413.398) [-4413.410] * (-4408.193) (-4414.207) [-4415.066] (-4416.275) -- 0:03:52 194500 -- (-4416.496) (-4415.280) [-4413.638] (-4412.546) * (-4411.780) (-4412.481) (-4408.171) [-4414.115] -- 0:03:51 195000 -- [-4411.285] (-4416.136) (-4412.675) (-4413.861) * (-4412.319) [-4410.071] (-4411.086) (-4407.340) -- 0:03:51 Average standard deviation of split frequencies: 0.000000 195500 -- (-4420.106) [-4412.896] (-4413.134) (-4416.564) * (-4423.017) (-4413.674) [-4415.439] (-4421.123) -- 0:03:50 196000 -- [-4411.883] (-4418.536) (-4413.594) (-4415.995) * (-4410.954) [-4413.699] (-4416.377) (-4415.187) -- 0:03:53 196500 -- (-4411.197) (-4408.875) [-4417.324] (-4417.225) * (-4421.088) (-4419.283) [-4415.179] (-4412.873) -- 0:03:53 197000 -- [-4411.654] (-4418.267) (-4409.253) (-4412.863) * [-4415.643] (-4415.572) (-4415.143) (-4412.461) -- 0:03:52 197500 -- (-4419.044) (-4425.717) (-4417.276) [-4412.008] * (-4418.182) [-4416.174] (-4418.167) (-4410.924) -- 0:03:51 198000 -- (-4418.835) (-4417.533) [-4413.007] (-4413.044) * (-4428.332) [-4414.656] (-4414.618) (-4414.569) -- 0:03:50 198500 -- [-4416.152] (-4412.697) (-4413.983) (-4414.150) * (-4414.230) (-4417.818) (-4420.542) [-4412.587] -- 0:03:50 199000 -- (-4413.348) [-4417.830] (-4414.073) (-4414.952) * (-4414.762) (-4410.504) (-4415.930) [-4409.494] -- 0:03:49 199500 -- (-4414.771) (-4416.682) [-4414.518] (-4422.895) * (-4422.658) (-4410.420) (-4418.051) [-4415.802] -- 0:03:52 200000 -- (-4414.148) (-4418.968) (-4410.181) [-4419.722] * [-4416.409] (-4419.077) (-4409.294) (-4417.361) -- 0:03:52 Average standard deviation of split frequencies: 0.000000 200500 -- [-4415.758] (-4415.847) (-4414.367) (-4420.862) * (-4418.127) [-4411.952] (-4412.140) (-4421.783) -- 0:03:51 201000 -- [-4411.729] (-4414.129) (-4414.036) (-4415.057) * [-4410.916] (-4415.880) (-4412.874) (-4413.074) -- 0:03:50 201500 -- (-4410.915) (-4409.657) (-4416.258) [-4413.461] * (-4410.341) (-4412.988) (-4416.537) [-4418.717] -- 0:03:49 202000 -- [-4412.972] (-4413.674) (-4410.925) (-4412.245) * [-4411.688] (-4417.912) (-4413.671) (-4414.902) -- 0:03:49 202500 -- (-4416.406) [-4416.099] (-4426.259) (-4409.581) * [-4409.714] (-4412.099) (-4415.879) (-4424.428) -- 0:03:48 203000 -- [-4412.489] (-4412.903) (-4419.314) (-4413.503) * [-4413.477] (-4412.220) (-4413.779) (-4419.076) -- 0:03:51 203500 -- (-4419.323) (-4419.302) (-4416.721) [-4412.078] * (-4411.648) (-4414.143) (-4419.411) [-4415.269] -- 0:03:50 204000 -- [-4416.692] (-4415.399) (-4413.381) (-4417.059) * (-4416.108) (-4415.962) [-4416.983] (-4416.273) -- 0:03:50 204500 -- (-4421.707) (-4413.994) (-4415.603) [-4413.506] * (-4420.572) [-4414.651] (-4411.955) (-4414.691) -- 0:03:49 205000 -- (-4423.527) [-4414.089] (-4415.275) (-4411.291) * (-4419.246) (-4414.984) [-4412.446] (-4416.940) -- 0:03:48 Average standard deviation of split frequencies: 0.000000 205500 -- (-4418.218) [-4410.357] (-4414.670) (-4420.743) * (-4410.771) (-4416.963) (-4423.316) [-4417.116] -- 0:03:48 206000 -- (-4422.975) [-4410.686] (-4422.914) (-4413.974) * (-4413.107) (-4415.844) [-4411.876] (-4421.519) -- 0:03:47 206500 -- (-4415.909) (-4413.647) (-4425.977) [-4415.535] * (-4420.376) (-4419.331) [-4410.739] (-4415.181) -- 0:03:46 207000 -- (-4414.634) [-4421.688] (-4420.791) (-4414.801) * (-4413.859) (-4416.921) [-4415.711] (-4411.353) -- 0:03:49 207500 -- [-4414.671] (-4415.520) (-4413.070) (-4414.359) * (-4417.192) [-4410.768] (-4416.650) (-4416.307) -- 0:03:49 208000 -- (-4421.071) (-4410.744) (-4419.938) [-4418.108] * (-4412.596) [-4412.575] (-4415.263) (-4414.986) -- 0:03:48 208500 -- (-4413.700) [-4411.216] (-4414.310) (-4417.504) * (-4413.500) (-4413.687) [-4415.563] (-4410.935) -- 0:03:47 209000 -- [-4412.734] (-4418.769) (-4409.677) (-4415.516) * (-4412.885) (-4417.340) [-4412.434] (-4415.927) -- 0:03:47 209500 -- (-4415.417) [-4412.704] (-4412.277) (-4419.990) * (-4410.243) (-4412.375) (-4417.455) [-4412.898] -- 0:03:46 210000 -- (-4413.266) (-4415.176) (-4415.082) [-4409.733] * (-4409.671) [-4416.299] (-4424.609) (-4413.190) -- 0:03:45 Average standard deviation of split frequencies: 0.000000 210500 -- (-4412.052) (-4413.754) (-4412.886) [-4408.758] * (-4411.398) (-4416.795) [-4422.182] (-4413.712) -- 0:03:48 211000 -- (-4417.425) (-4417.709) [-4414.053] (-4412.098) * [-4414.415] (-4408.366) (-4421.513) (-4414.012) -- 0:03:48 211500 -- (-4415.681) [-4418.220] (-4413.428) (-4410.890) * (-4413.713) [-4413.267] (-4415.543) (-4413.946) -- 0:03:47 212000 -- [-4414.554] (-4411.991) (-4411.322) (-4414.367) * (-4422.894) [-4413.432] (-4413.245) (-4415.087) -- 0:03:46 212500 -- (-4411.734) (-4415.277) [-4411.293] (-4406.731) * [-4415.636] (-4413.156) (-4413.083) (-4417.400) -- 0:03:46 213000 -- [-4414.857] (-4412.793) (-4416.224) (-4416.006) * [-4412.342] (-4424.761) (-4414.290) (-4415.256) -- 0:03:45 213500 -- [-4412.664] (-4414.595) (-4412.091) (-4413.623) * (-4417.196) (-4418.277) (-4420.756) [-4418.082] -- 0:03:44 214000 -- [-4412.297] (-4414.654) (-4415.598) (-4412.582) * [-4412.968] (-4412.147) (-4412.952) (-4416.291) -- 0:03:47 214500 -- (-4411.848) (-4414.735) [-4415.740] (-4416.398) * (-4408.682) (-4420.820) (-4412.839) [-4412.630] -- 0:03:47 215000 -- [-4409.513] (-4423.830) (-4414.227) (-4417.825) * (-4412.466) (-4415.315) [-4411.047] (-4418.586) -- 0:03:46 Average standard deviation of split frequencies: 0.000000 215500 -- (-4417.649) (-4425.207) (-4414.680) [-4411.705] * (-4414.760) (-4416.762) [-4416.645] (-4417.317) -- 0:03:45 216000 -- (-4415.678) (-4414.078) [-4412.395] (-4420.239) * (-4414.383) (-4423.905) (-4413.484) [-4413.227] -- 0:03:45 216500 -- (-4416.298) [-4418.285] (-4414.042) (-4413.702) * (-4414.891) (-4420.215) [-4408.365] (-4416.747) -- 0:03:44 217000 -- (-4415.940) (-4416.254) [-4416.205] (-4411.664) * (-4422.422) (-4414.389) (-4417.976) [-4409.069] -- 0:03:43 217500 -- (-4416.412) (-4411.712) [-4409.676] (-4413.595) * (-4417.417) [-4416.417] (-4413.736) (-4412.989) -- 0:03:46 218000 -- [-4415.677] (-4413.062) (-4422.340) (-4414.483) * (-4415.168) [-4411.581] (-4418.408) (-4411.956) -- 0:03:45 218500 -- (-4414.611) (-4413.083) (-4413.385) [-4413.480] * (-4416.209) [-4413.088] (-4418.720) (-4413.991) -- 0:03:45 219000 -- [-4413.212] (-4415.073) (-4417.523) (-4410.378) * (-4419.731) [-4411.478] (-4416.359) (-4418.826) -- 0:03:44 219500 -- (-4415.692) (-4408.991) (-4420.913) [-4418.455] * (-4412.060) [-4410.707] (-4415.412) (-4410.215) -- 0:03:44 220000 -- (-4412.023) [-4412.613] (-4415.202) (-4420.117) * (-4414.230) [-4412.017] (-4409.189) (-4414.483) -- 0:03:43 Average standard deviation of split frequencies: 0.000000 220500 -- (-4412.468) [-4411.307] (-4415.551) (-4413.214) * (-4413.622) [-4415.235] (-4411.790) (-4421.237) -- 0:03:42 221000 -- [-4410.890] (-4413.399) (-4411.920) (-4418.140) * (-4417.265) (-4415.833) [-4408.635] (-4411.417) -- 0:03:45 221500 -- [-4411.804] (-4416.374) (-4414.854) (-4417.910) * (-4418.418) (-4416.665) (-4413.660) [-4407.945] -- 0:03:44 222000 -- (-4421.424) (-4418.363) (-4419.953) [-4414.557] * [-4415.935] (-4412.909) (-4415.225) (-4412.764) -- 0:03:44 222500 -- [-4413.499] (-4417.095) (-4424.513) (-4416.161) * (-4415.000) (-4417.356) [-4413.139] (-4419.244) -- 0:03:43 223000 -- (-4413.418) (-4415.582) [-4416.244] (-4419.462) * [-4415.622] (-4411.674) (-4415.773) (-4416.537) -- 0:03:42 223500 -- (-4415.232) [-4414.931] (-4426.110) (-4413.558) * (-4412.772) (-4414.799) [-4415.889] (-4408.938) -- 0:03:42 224000 -- (-4416.572) (-4421.093) (-4417.039) [-4414.045] * (-4418.546) (-4416.798) (-4414.442) [-4416.005] -- 0:03:41 224500 -- [-4411.222] (-4412.904) (-4415.414) (-4411.912) * (-4412.397) (-4413.417) (-4419.772) [-4413.413] -- 0:03:44 225000 -- (-4411.219) (-4414.704) [-4413.498] (-4415.191) * (-4413.126) [-4411.188] (-4420.863) (-4416.898) -- 0:03:43 Average standard deviation of split frequencies: 0.000000 225500 -- [-4416.556] (-4409.861) (-4413.679) (-4422.160) * [-4412.474] (-4417.912) (-4415.586) (-4414.506) -- 0:03:43 226000 -- [-4420.902] (-4416.038) (-4421.494) (-4419.819) * (-4419.924) [-4410.022] (-4415.539) (-4412.889) -- 0:03:42 226500 -- [-4411.625] (-4416.790) (-4414.023) (-4414.402) * (-4417.987) [-4409.151] (-4417.971) (-4414.713) -- 0:03:41 227000 -- (-4417.873) (-4411.815) [-4415.806] (-4417.468) * (-4415.043) (-4413.379) [-4414.010] (-4414.845) -- 0:03:41 227500 -- (-4410.217) (-4412.287) (-4412.181) [-4414.232] * (-4411.797) [-4415.674] (-4412.411) (-4417.787) -- 0:03:40 228000 -- [-4414.681] (-4410.559) (-4415.362) (-4416.022) * (-4414.366) [-4416.144] (-4419.062) (-4412.403) -- 0:03:43 228500 -- (-4414.241) (-4414.906) [-4411.188] (-4417.761) * [-4411.786] (-4416.423) (-4418.945) (-4418.655) -- 0:03:42 229000 -- [-4414.131] (-4420.300) (-4412.325) (-4410.725) * [-4410.713] (-4415.390) (-4415.602) (-4413.635) -- 0:03:42 229500 -- (-4413.827) (-4418.746) (-4414.022) [-4416.268] * [-4417.020] (-4414.826) (-4413.266) (-4409.364) -- 0:03:41 230000 -- (-4410.693) (-4416.980) (-4414.415) [-4418.913] * [-4414.573] (-4415.697) (-4411.701) (-4415.720) -- 0:03:40 Average standard deviation of split frequencies: 0.000000 230500 -- (-4417.113) [-4417.046] (-4412.425) (-4415.522) * (-4413.978) [-4417.133] (-4412.730) (-4419.985) -- 0:03:40 231000 -- (-4417.432) (-4420.587) [-4413.643] (-4414.030) * (-4413.592) (-4418.389) (-4414.543) [-4414.790] -- 0:03:39 231500 -- (-4409.346) (-4410.858) [-4409.410] (-4413.954) * (-4412.078) (-4412.006) [-4420.630] (-4414.568) -- 0:03:42 232000 -- [-4414.196] (-4409.827) (-4412.940) (-4424.099) * (-4412.250) [-4409.678] (-4414.060) (-4421.555) -- 0:03:41 232500 -- (-4414.587) [-4409.751] (-4413.549) (-4413.961) * (-4412.304) [-4416.120] (-4415.251) (-4417.909) -- 0:03:41 233000 -- [-4417.518] (-4408.780) (-4410.640) (-4415.445) * (-4410.558) (-4414.774) (-4418.792) [-4410.468] -- 0:03:40 233500 -- (-4412.803) [-4413.899] (-4411.388) (-4410.506) * (-4411.620) (-4411.500) (-4413.934) [-4413.697] -- 0:03:39 234000 -- (-4412.654) (-4414.508) (-4411.088) [-4414.785] * (-4416.927) [-4415.949] (-4411.658) (-4417.191) -- 0:03:39 234500 -- [-4412.433] (-4418.752) (-4415.483) (-4414.926) * (-4415.150) (-4411.841) [-4414.553] (-4416.546) -- 0:03:38 235000 -- (-4414.701) (-4418.185) [-4410.734] (-4417.397) * (-4415.801) [-4413.565] (-4414.603) (-4426.263) -- 0:03:38 Average standard deviation of split frequencies: 0.000000 235500 -- (-4414.750) (-4416.899) (-4412.859) [-4416.165] * (-4419.874) (-4416.336) [-4414.652] (-4414.980) -- 0:03:40 236000 -- (-4413.150) (-4416.961) [-4410.566] (-4412.621) * (-4413.480) [-4410.473] (-4409.152) (-4412.176) -- 0:03:40 236500 -- (-4415.073) (-4415.778) (-4413.318) [-4413.487] * (-4412.778) (-4408.722) [-4410.454] (-4419.315) -- 0:03:39 237000 -- (-4412.188) [-4414.551] (-4414.095) (-4414.333) * [-4412.882] (-4418.345) (-4411.964) (-4417.524) -- 0:03:38 237500 -- (-4411.513) [-4411.302] (-4408.000) (-4412.630) * [-4413.887] (-4410.272) (-4411.545) (-4417.148) -- 0:03:38 238000 -- (-4414.904) [-4408.431] (-4415.280) (-4418.117) * (-4420.742) (-4415.141) [-4412.363] (-4413.028) -- 0:03:37 238500 -- (-4413.823) (-4413.854) [-4412.932] (-4414.546) * [-4418.227] (-4418.524) (-4415.811) (-4414.904) -- 0:03:37 239000 -- (-4417.814) (-4421.067) (-4415.378) [-4413.812] * (-4417.677) (-4413.137) [-4415.256] (-4418.518) -- 0:03:39 239500 -- [-4411.940] (-4409.574) (-4413.483) (-4424.113) * (-4413.827) (-4413.983) (-4414.776) [-4409.684] -- 0:03:39 240000 -- [-4410.785] (-4412.421) (-4411.699) (-4412.198) * [-4417.791] (-4417.523) (-4413.263) (-4419.065) -- 0:03:38 Average standard deviation of split frequencies: 0.000000 240500 -- (-4408.732) [-4411.444] (-4412.723) (-4413.826) * [-4412.113] (-4411.157) (-4411.995) (-4412.174) -- 0:03:37 241000 -- (-4415.644) [-4414.296] (-4415.315) (-4416.140) * (-4418.574) [-4416.611] (-4413.866) (-4412.442) -- 0:03:37 241500 -- (-4420.496) [-4413.347] (-4414.728) (-4415.294) * (-4421.791) (-4411.266) (-4416.501) [-4413.160] -- 0:03:36 242000 -- (-4415.101) [-4414.543] (-4409.517) (-4420.550) * (-4415.426) (-4409.712) (-4417.470) [-4415.713] -- 0:03:36 242500 -- (-4419.367) [-4411.560] (-4417.489) (-4412.032) * (-4412.397) [-4409.597] (-4426.022) (-4415.313) -- 0:03:38 243000 -- (-4418.433) (-4410.818) (-4413.159) [-4410.250] * (-4428.448) (-4413.010) (-4414.229) [-4420.865] -- 0:03:38 243500 -- (-4429.320) [-4410.211] (-4411.438) (-4421.463) * (-4416.682) (-4414.201) [-4408.441] (-4419.263) -- 0:03:37 244000 -- (-4420.782) (-4412.476) (-4414.089) [-4411.266] * (-4410.730) [-4414.859] (-4416.738) (-4415.028) -- 0:03:36 244500 -- (-4411.825) (-4419.925) (-4412.596) [-4412.907] * (-4412.109) [-4412.239] (-4416.139) (-4416.650) -- 0:03:36 245000 -- [-4410.944] (-4416.050) (-4414.751) (-4417.744) * [-4411.025] (-4411.096) (-4419.334) (-4419.036) -- 0:03:35 Average standard deviation of split frequencies: 0.000000 245500 -- [-4409.919] (-4412.790) (-4410.460) (-4418.113) * [-4417.794] (-4412.373) (-4414.496) (-4413.231) -- 0:03:35 246000 -- (-4410.695) (-4415.170) [-4412.227] (-4415.725) * (-4411.373) (-4411.155) (-4409.059) [-4412.573] -- 0:03:37 246500 -- (-4411.544) (-4418.427) [-4415.856] (-4421.980) * (-4408.841) [-4418.349] (-4422.482) (-4409.951) -- 0:03:37 247000 -- (-4414.000) [-4411.225] (-4413.673) (-4415.192) * [-4408.383] (-4414.653) (-4416.379) (-4414.439) -- 0:03:36 247500 -- (-4418.468) (-4413.749) (-4414.011) [-4415.527] * (-4410.174) (-4413.509) [-4411.467] (-4418.827) -- 0:03:35 248000 -- (-4416.498) [-4415.767] (-4413.393) (-4420.672) * (-4410.736) (-4414.151) (-4413.484) [-4413.426] -- 0:03:35 248500 -- (-4414.870) (-4414.695) [-4418.893] (-4413.123) * (-4419.598) (-4414.809) [-4417.092] (-4410.929) -- 0:03:34 249000 -- (-4412.512) [-4408.958] (-4420.449) (-4410.416) * (-4416.897) (-4411.679) (-4420.068) [-4414.767] -- 0:03:34 249500 -- (-4412.115) (-4415.884) (-4422.230) [-4412.801] * (-4410.500) [-4412.862] (-4417.773) (-4413.180) -- 0:03:36 250000 -- (-4417.796) (-4413.554) (-4422.305) [-4411.451] * (-4415.660) (-4418.664) (-4414.267) [-4411.956] -- 0:03:36 Average standard deviation of split frequencies: 0.000000 250500 -- (-4412.837) (-4414.751) [-4413.079] (-4409.865) * (-4412.837) (-4410.151) (-4418.868) [-4418.996] -- 0:03:35 251000 -- (-4416.349) [-4416.197] (-4409.766) (-4408.204) * (-4414.795) (-4415.701) [-4416.738] (-4412.549) -- 0:03:34 251500 -- (-4416.166) (-4416.744) (-4414.852) [-4417.121] * (-4414.532) (-4417.374) [-4409.572] (-4414.833) -- 0:03:34 252000 -- (-4414.306) [-4414.500] (-4412.645) (-4413.199) * (-4415.987) (-4420.338) [-4416.313] (-4412.631) -- 0:03:33 252500 -- [-4413.676] (-4419.150) (-4418.002) (-4413.384) * [-4411.351] (-4413.056) (-4412.649) (-4411.120) -- 0:03:33 253000 -- [-4413.216] (-4415.090) (-4415.306) (-4412.038) * (-4411.279) [-4412.188] (-4413.374) (-4409.839) -- 0:03:35 253500 -- (-4416.322) [-4415.887] (-4419.758) (-4410.925) * (-4423.024) [-4414.641] (-4414.439) (-4410.885) -- 0:03:34 254000 -- (-4411.668) (-4418.983) [-4413.080] (-4410.807) * (-4420.662) [-4414.264] (-4411.473) (-4412.778) -- 0:03:34 254500 -- (-4416.067) (-4413.343) [-4421.453] (-4417.836) * [-4413.687] (-4414.443) (-4413.608) (-4416.318) -- 0:03:33 255000 -- (-4418.997) (-4425.113) [-4415.556] (-4410.889) * (-4416.065) (-4419.246) (-4416.369) [-4418.816] -- 0:03:33 Average standard deviation of split frequencies: 0.000000 255500 -- (-4413.982) (-4421.839) [-4414.477] (-4412.253) * (-4414.926) [-4416.924] (-4419.128) (-4414.274) -- 0:03:32 256000 -- (-4411.626) [-4415.617] (-4412.525) (-4412.475) * (-4412.523) [-4417.049] (-4417.760) (-4413.341) -- 0:03:32 256500 -- (-4416.843) [-4415.216] (-4416.093) (-4412.866) * (-4415.427) [-4414.358] (-4416.215) (-4423.819) -- 0:03:34 257000 -- (-4417.304) [-4409.106] (-4416.040) (-4410.077) * (-4417.938) (-4412.452) (-4413.991) [-4420.805] -- 0:03:33 257500 -- [-4415.031] (-4413.483) (-4418.121) (-4413.589) * (-4408.180) (-4414.439) [-4416.915] (-4411.753) -- 0:03:33 258000 -- [-4415.210] (-4419.256) (-4423.106) (-4414.745) * [-4409.455] (-4419.278) (-4417.625) (-4409.621) -- 0:03:32 258500 -- (-4411.713) (-4421.639) [-4410.832] (-4417.300) * (-4412.582) (-4413.033) (-4412.551) [-4411.308] -- 0:03:32 259000 -- [-4413.489] (-4416.735) (-4417.048) (-4419.241) * (-4415.229) (-4419.846) (-4420.618) [-4418.757] -- 0:03:31 259500 -- (-4415.310) (-4410.847) [-4413.159] (-4414.466) * (-4413.625) (-4410.598) (-4414.157) [-4410.896] -- 0:03:31 260000 -- (-4412.230) (-4412.611) (-4411.254) [-4409.308] * (-4415.668) [-4410.316] (-4412.104) (-4416.174) -- 0:03:33 Average standard deviation of split frequencies: 0.000000 260500 -- (-4419.076) (-4411.709) (-4411.390) [-4411.495] * (-4413.692) (-4415.605) (-4410.318) [-4410.622] -- 0:03:32 261000 -- (-4416.786) (-4418.077) [-4412.533] (-4415.327) * (-4414.175) (-4417.608) [-4414.988] (-4415.280) -- 0:03:32 261500 -- (-4411.167) (-4416.157) (-4410.362) [-4415.022] * (-4416.198) [-4418.404] (-4416.084) (-4411.122) -- 0:03:31 262000 -- (-4418.669) (-4416.695) (-4416.613) [-4415.086] * (-4419.742) [-4416.870] (-4414.190) (-4414.846) -- 0:03:31 262500 -- (-4412.191) [-4413.549] (-4412.718) (-4423.615) * [-4413.836] (-4420.997) (-4419.998) (-4419.694) -- 0:03:30 263000 -- [-4414.586] (-4407.774) (-4412.100) (-4414.444) * (-4420.840) (-4419.483) (-4413.674) [-4422.742] -- 0:03:30 263500 -- (-4412.337) (-4411.649) [-4419.078] (-4417.619) * (-4409.767) [-4416.959] (-4416.422) (-4416.075) -- 0:03:32 264000 -- [-4411.118] (-4416.045) (-4413.030) (-4411.934) * (-4417.220) (-4417.698) (-4423.780) [-4415.904] -- 0:03:31 264500 -- [-4409.884] (-4416.776) (-4413.368) (-4412.515) * (-4415.432) (-4425.723) (-4424.236) [-4412.444] -- 0:03:31 265000 -- (-4413.375) (-4424.093) [-4414.264] (-4419.714) * [-4416.303] (-4419.910) (-4414.849) (-4408.862) -- 0:03:30 Average standard deviation of split frequencies: 0.000000 265500 -- (-4410.010) [-4415.837] (-4412.833) (-4414.869) * [-4417.037] (-4416.796) (-4414.964) (-4418.055) -- 0:03:30 266000 -- [-4416.931] (-4414.871) (-4414.433) (-4417.791) * (-4413.435) (-4414.814) (-4413.309) [-4416.333] -- 0:03:29 266500 -- (-4412.245) (-4409.719) [-4413.114] (-4412.507) * (-4412.990) (-4412.387) [-4416.399] (-4419.835) -- 0:03:29 267000 -- (-4416.858) [-4419.974] (-4416.106) (-4414.746) * (-4416.880) (-4417.738) [-4412.987] (-4419.808) -- 0:03:31 267500 -- [-4411.925] (-4415.500) (-4419.421) (-4413.160) * [-4413.828] (-4418.663) (-4418.808) (-4417.820) -- 0:03:30 268000 -- [-4418.940] (-4414.094) (-4412.349) (-4416.887) * (-4411.992) (-4413.349) [-4413.938] (-4418.443) -- 0:03:30 268500 -- [-4414.090] (-4413.514) (-4419.826) (-4413.696) * (-4413.100) (-4416.650) [-4414.451] (-4413.636) -- 0:03:29 269000 -- (-4420.920) (-4417.852) (-4417.339) [-4415.690] * [-4414.462] (-4419.651) (-4415.301) (-4416.343) -- 0:03:29 269500 -- (-4414.604) (-4416.962) (-4415.923) [-4409.798] * (-4412.947) (-4420.546) [-4419.521] (-4412.738) -- 0:03:28 270000 -- (-4415.224) (-4414.409) [-4413.814] (-4417.201) * (-4417.414) [-4415.577] (-4409.530) (-4413.778) -- 0:03:28 Average standard deviation of split frequencies: 0.000000 270500 -- [-4415.307] (-4418.576) (-4413.031) (-4413.942) * (-4417.705) [-4409.913] (-4411.217) (-4414.178) -- 0:03:30 271000 -- (-4420.102) [-4417.006] (-4415.609) (-4413.660) * [-4414.490] (-4416.352) (-4417.965) (-4418.652) -- 0:03:29 271500 -- (-4415.639) (-4411.348) (-4421.004) [-4414.277] * [-4411.883] (-4413.837) (-4408.635) (-4412.088) -- 0:03:29 272000 -- (-4416.323) (-4412.766) (-4414.667) [-4414.130] * (-4416.753) [-4409.581] (-4413.695) (-4413.988) -- 0:03:28 272500 -- (-4413.663) [-4408.022] (-4419.031) (-4416.313) * (-4416.767) (-4408.661) [-4421.127] (-4414.036) -- 0:03:28 273000 -- [-4412.433] (-4417.447) (-4410.261) (-4413.249) * (-4414.361) (-4411.877) (-4415.142) [-4415.023] -- 0:03:27 273500 -- (-4414.230) (-4415.569) [-4411.425] (-4414.431) * (-4412.637) (-4415.464) [-4412.021] (-4416.556) -- 0:03:27 274000 -- [-4414.731] (-4414.057) (-4412.432) (-4416.019) * (-4415.397) (-4419.045) [-4420.805] (-4413.524) -- 0:03:29 274500 -- (-4410.910) (-4413.843) [-4419.619] (-4415.656) * (-4418.002) (-4421.361) [-4413.805] (-4413.123) -- 0:03:28 275000 -- (-4413.531) [-4417.336] (-4417.070) (-4415.416) * (-4412.266) (-4416.809) [-4411.608] (-4416.314) -- 0:03:28 Average standard deviation of split frequencies: 0.000000 275500 -- (-4415.866) (-4418.471) [-4410.857] (-4411.921) * [-4413.690] (-4415.500) (-4416.514) (-4408.620) -- 0:03:27 276000 -- (-4422.938) (-4411.188) (-4411.245) [-4414.181] * [-4415.177] (-4414.875) (-4415.816) (-4414.144) -- 0:03:27 276500 -- (-4416.409) (-4414.380) (-4420.470) [-4409.274] * (-4413.744) [-4415.669] (-4415.832) (-4417.032) -- 0:03:26 277000 -- (-4416.805) (-4425.099) (-4414.753) [-4412.811] * [-4410.790] (-4410.930) (-4421.990) (-4411.887) -- 0:03:26 277500 -- (-4409.994) [-4412.279] (-4420.411) (-4411.057) * (-4411.572) [-4419.095] (-4416.915) (-4410.409) -- 0:03:28 278000 -- (-4411.282) [-4413.775] (-4422.676) (-4415.762) * (-4413.554) (-4415.253) [-4413.569] (-4412.781) -- 0:03:27 278500 -- (-4413.330) (-4410.495) (-4415.251) [-4414.571] * [-4415.489] (-4413.175) (-4415.752) (-4413.045) -- 0:03:27 279000 -- [-4420.413] (-4411.280) (-4415.757) (-4421.620) * (-4416.720) (-4414.105) (-4420.765) [-4412.372] -- 0:03:26 279500 -- (-4416.195) (-4413.584) [-4414.729] (-4415.541) * (-4423.325) (-4415.429) [-4417.143] (-4411.288) -- 0:03:26 280000 -- (-4416.626) [-4411.879] (-4419.762) (-4416.692) * (-4427.058) (-4416.536) [-4412.498] (-4413.238) -- 0:03:25 Average standard deviation of split frequencies: 0.000000 280500 -- [-4420.264] (-4416.967) (-4421.663) (-4416.194) * (-4423.688) [-4413.907] (-4415.509) (-4412.775) -- 0:03:25 281000 -- [-4417.233] (-4415.001) (-4417.716) (-4409.229) * (-4417.067) (-4419.824) [-4416.547] (-4414.211) -- 0:03:27 281500 -- (-4421.829) (-4412.837) [-4412.709] (-4415.661) * (-4414.302) [-4416.709] (-4420.004) (-4415.536) -- 0:03:26 282000 -- (-4413.720) (-4421.004) [-4411.497] (-4414.698) * (-4419.523) (-4412.530) [-4420.550] (-4416.679) -- 0:03:26 282500 -- (-4416.063) [-4411.266] (-4413.143) (-4420.679) * (-4414.999) [-4412.421] (-4420.570) (-4423.070) -- 0:03:25 283000 -- (-4414.742) (-4416.226) [-4412.774] (-4420.311) * (-4422.751) (-4414.263) (-4408.200) [-4413.549] -- 0:03:25 283500 -- (-4422.455) [-4410.400] (-4415.400) (-4417.418) * (-4418.147) [-4414.045] (-4414.065) (-4415.334) -- 0:03:24 284000 -- (-4413.112) (-4414.020) [-4414.332] (-4413.438) * [-4414.965] (-4423.247) (-4415.120) (-4417.131) -- 0:03:24 284500 -- (-4414.448) (-4418.146) (-4414.105) [-4413.024] * (-4417.467) (-4420.822) (-4415.760) [-4413.515] -- 0:03:26 285000 -- (-4412.882) (-4417.238) (-4412.914) [-4421.227] * [-4410.351] (-4418.641) (-4413.405) (-4414.257) -- 0:03:25 Average standard deviation of split frequencies: 0.000000 285500 -- (-4420.149) (-4423.942) (-4415.202) [-4415.072] * [-4411.624] (-4415.157) (-4412.900) (-4413.013) -- 0:03:25 286000 -- [-4415.271] (-4414.311) (-4411.235) (-4420.058) * (-4422.643) (-4411.731) (-4418.123) [-4411.745] -- 0:03:24 286500 -- (-4412.574) (-4410.059) (-4413.797) [-4412.960] * [-4411.764] (-4419.191) (-4418.336) (-4414.940) -- 0:03:24 287000 -- (-4412.803) [-4415.583] (-4414.905) (-4414.506) * (-4414.552) [-4412.116] (-4418.525) (-4415.579) -- 0:03:23 287500 -- [-4415.231] (-4419.405) (-4413.990) (-4413.842) * (-4415.607) [-4418.081] (-4423.720) (-4410.275) -- 0:03:23 288000 -- [-4410.722] (-4417.074) (-4418.099) (-4409.441) * (-4412.484) (-4418.405) (-4414.410) [-4414.644] -- 0:03:25 288500 -- (-4413.628) (-4414.220) [-4420.307] (-4410.468) * [-4414.369] (-4418.621) (-4414.617) (-4415.115) -- 0:03:24 289000 -- [-4410.626] (-4414.074) (-4417.428) (-4410.413) * (-4411.285) [-4417.419] (-4411.100) (-4412.284) -- 0:03:24 289500 -- [-4413.144] (-4419.297) (-4422.937) (-4410.604) * (-4411.019) [-4418.328] (-4413.774) (-4410.279) -- 0:03:23 290000 -- (-4410.932) (-4417.944) [-4415.765] (-4417.331) * [-4420.823] (-4415.811) (-4413.668) (-4412.280) -- 0:03:23 Average standard deviation of split frequencies: 0.000000 290500 -- (-4412.751) (-4413.896) (-4413.280) [-4415.824] * (-4416.176) [-4413.373] (-4414.805) (-4415.654) -- 0:03:22 291000 -- (-4414.535) [-4419.510] (-4410.053) (-4421.028) * (-4417.279) (-4418.000) (-4418.914) [-4414.455] -- 0:03:22 291500 -- (-4414.116) (-4426.139) [-4413.765] (-4422.397) * (-4415.577) [-4419.165] (-4422.985) (-4412.130) -- 0:03:21 292000 -- (-4413.229) [-4419.253] (-4415.327) (-4422.296) * (-4418.537) (-4414.495) (-4421.132) [-4418.832] -- 0:03:23 292500 -- (-4411.360) [-4417.105] (-4419.848) (-4414.026) * [-4415.090] (-4415.069) (-4417.176) (-4413.543) -- 0:03:23 293000 -- (-4412.715) (-4416.214) (-4420.448) [-4411.720] * [-4417.579] (-4409.419) (-4417.926) (-4418.104) -- 0:03:22 293500 -- (-4414.200) (-4417.987) [-4419.411] (-4415.314) * [-4418.433] (-4414.255) (-4418.254) (-4413.328) -- 0:03:22 294000 -- (-4418.923) [-4416.924] (-4420.729) (-4420.859) * (-4414.915) (-4417.229) [-4415.055] (-4420.088) -- 0:03:21 294500 -- [-4419.704] (-4416.053) (-4418.138) (-4415.540) * (-4415.582) (-4415.123) (-4418.393) [-4413.212] -- 0:03:21 295000 -- [-4416.163] (-4414.147) (-4412.401) (-4415.247) * (-4414.883) (-4413.797) (-4415.737) [-4409.861] -- 0:03:20 Average standard deviation of split frequencies: 0.000000 295500 -- (-4419.776) (-4417.299) [-4411.947] (-4416.355) * (-4412.863) [-4416.451] (-4412.059) (-4415.696) -- 0:03:22 296000 -- (-4413.112) (-4414.905) (-4414.721) [-4414.154] * [-4417.427] (-4409.697) (-4413.596) (-4416.897) -- 0:03:22 296500 -- (-4411.218) (-4414.047) [-4414.900] (-4417.450) * (-4412.381) (-4410.535) (-4409.298) [-4415.979] -- 0:03:21 297000 -- [-4413.715] (-4414.788) (-4420.274) (-4416.042) * [-4412.923] (-4415.950) (-4411.643) (-4419.136) -- 0:03:21 297500 -- [-4413.181] (-4421.480) (-4414.464) (-4416.427) * (-4410.905) (-4411.478) [-4411.060] (-4427.204) -- 0:03:20 298000 -- (-4420.582) (-4415.179) (-4420.769) [-4410.291] * [-4413.441] (-4410.698) (-4418.119) (-4420.176) -- 0:03:20 298500 -- (-4418.170) (-4423.295) [-4412.644] (-4410.869) * [-4410.902] (-4410.304) (-4412.142) (-4418.702) -- 0:03:19 299000 -- (-4419.178) (-4409.812) (-4414.006) [-4409.405] * (-4418.405) [-4414.455] (-4412.424) (-4414.067) -- 0:03:21 299500 -- (-4416.152) (-4415.446) [-4418.451] (-4417.701) * [-4412.383] (-4416.495) (-4416.441) (-4415.108) -- 0:03:21 300000 -- (-4416.642) (-4415.130) [-4410.911] (-4415.608) * (-4410.901) [-4413.135] (-4416.118) (-4412.438) -- 0:03:20 Average standard deviation of split frequencies: 0.000000 300500 -- [-4417.005] (-4415.494) (-4414.399) (-4416.116) * [-4413.173] (-4412.021) (-4410.785) (-4412.248) -- 0:03:20 301000 -- (-4414.510) [-4409.802] (-4413.614) (-4412.987) * (-4421.284) [-4415.162] (-4420.205) (-4412.678) -- 0:03:19 301500 -- [-4409.698] (-4417.148) (-4415.406) (-4412.950) * (-4412.720) (-4411.538) (-4413.160) [-4409.449] -- 0:03:19 302000 -- [-4411.363] (-4413.242) (-4418.445) (-4418.468) * (-4419.818) [-4409.785] (-4409.460) (-4414.206) -- 0:03:21 302500 -- [-4412.521] (-4415.359) (-4411.932) (-4414.644) * (-4413.386) (-4411.442) (-4413.559) [-4409.304] -- 0:03:20 303000 -- (-4415.486) [-4413.369] (-4418.733) (-4411.253) * (-4414.736) [-4416.090] (-4417.319) (-4416.717) -- 0:03:20 303500 -- [-4414.974] (-4419.517) (-4409.467) (-4412.963) * [-4411.482] (-4415.716) (-4414.625) (-4416.937) -- 0:03:19 304000 -- (-4410.388) (-4412.632) [-4412.107] (-4411.411) * (-4412.691) [-4410.528] (-4415.972) (-4412.358) -- 0:03:19 304500 -- [-4412.128] (-4413.429) (-4410.915) (-4417.370) * (-4415.057) [-4413.530] (-4411.267) (-4416.221) -- 0:03:18 305000 -- (-4412.931) (-4416.232) [-4409.895] (-4419.536) * (-4412.825) [-4413.479] (-4414.669) (-4411.398) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 305500 -- [-4417.744] (-4416.121) (-4412.920) (-4415.483) * (-4413.552) (-4419.029) (-4415.118) [-4414.317] -- 0:03:17 306000 -- (-4415.376) (-4418.993) (-4410.045) [-4409.255] * [-4409.205] (-4418.338) (-4410.817) (-4409.360) -- 0:03:19 306500 -- (-4420.514) [-4415.997] (-4421.755) (-4409.971) * [-4410.382] (-4415.872) (-4414.533) (-4416.092) -- 0:03:19 307000 -- (-4418.409) (-4412.037) (-4415.258) [-4410.149] * (-4415.201) [-4411.266] (-4417.829) (-4410.433) -- 0:03:18 307500 -- [-4419.707] (-4414.994) (-4411.759) (-4425.490) * [-4412.700] (-4413.731) (-4415.847) (-4412.750) -- 0:03:18 308000 -- (-4418.124) [-4417.659] (-4417.422) (-4414.932) * [-4412.780] (-4415.146) (-4410.057) (-4412.286) -- 0:03:17 308500 -- (-4425.783) [-4408.279] (-4417.414) (-4408.822) * (-4418.724) (-4411.545) [-4412.102] (-4416.247) -- 0:03:17 309000 -- (-4414.464) (-4411.384) [-4413.139] (-4419.693) * (-4417.982) (-4413.571) [-4410.818] (-4419.063) -- 0:03:16 309500 -- [-4411.700] (-4411.377) (-4415.005) (-4418.829) * (-4413.538) (-4418.646) (-4413.660) [-4421.607] -- 0:03:18 310000 -- (-4409.572) (-4411.161) [-4413.488] (-4419.638) * (-4417.553) [-4415.052] (-4417.369) (-4416.054) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 310500 -- (-4413.356) (-4410.513) [-4418.450] (-4418.547) * (-4418.525) (-4410.781) (-4422.481) [-4414.039] -- 0:03:17 311000 -- (-4418.186) (-4415.456) [-4413.234] (-4415.626) * (-4414.582) [-4412.347] (-4419.206) (-4417.076) -- 0:03:17 311500 -- [-4415.255] (-4414.421) (-4417.157) (-4414.520) * (-4420.112) (-4415.559) [-4413.862] (-4419.091) -- 0:03:16 312000 -- [-4415.726] (-4413.809) (-4418.078) (-4411.352) * (-4410.053) [-4418.438] (-4416.180) (-4413.486) -- 0:03:16 312500 -- (-4421.670) [-4415.819] (-4417.055) (-4414.202) * (-4412.350) (-4412.822) (-4415.051) [-4413.080] -- 0:03:15 313000 -- (-4412.220) [-4410.967] (-4417.859) (-4411.618) * (-4417.018) [-4413.574] (-4421.129) (-4418.461) -- 0:03:17 313500 -- (-4411.567) [-4416.800] (-4416.173) (-4414.996) * (-4411.213) (-4414.592) [-4414.425] (-4415.748) -- 0:03:17 314000 -- [-4413.807] (-4417.268) (-4412.048) (-4421.081) * [-4412.843] (-4410.959) (-4415.301) (-4418.484) -- 0:03:16 314500 -- (-4417.982) (-4419.689) (-4414.987) [-4410.333] * (-4417.578) [-4415.135] (-4418.095) (-4423.207) -- 0:03:16 315000 -- [-4411.608] (-4414.583) (-4414.391) (-4411.776) * (-4417.130) [-4415.265] (-4416.825) (-4421.783) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 315500 -- (-4414.087) (-4415.446) (-4424.002) [-4411.435] * [-4416.252] (-4417.020) (-4416.340) (-4408.100) -- 0:03:15 316000 -- (-4410.810) [-4412.187] (-4412.296) (-4417.819) * (-4420.986) [-4411.637] (-4418.766) (-4408.791) -- 0:03:14 316500 -- [-4409.923] (-4416.945) (-4416.791) (-4416.743) * (-4412.281) (-4416.611) [-4411.969] (-4409.423) -- 0:03:16 317000 -- [-4418.891] (-4408.690) (-4414.567) (-4414.998) * [-4417.656] (-4408.662) (-4411.415) (-4416.284) -- 0:03:16 317500 -- (-4413.692) (-4416.445) [-4410.628] (-4411.891) * (-4417.486) (-4416.760) [-4414.988] (-4414.950) -- 0:03:15 318000 -- (-4423.764) (-4413.356) [-4418.880] (-4419.040) * [-4415.172] (-4415.606) (-4412.829) (-4412.659) -- 0:03:15 318500 -- (-4420.236) [-4410.589] (-4413.412) (-4414.411) * (-4415.226) (-4411.055) [-4415.103] (-4414.595) -- 0:03:14 319000 -- (-4422.335) [-4412.855] (-4422.618) (-4413.209) * (-4414.983) (-4413.502) [-4412.569] (-4418.145) -- 0:03:14 319500 -- [-4418.637] (-4415.209) (-4414.897) (-4414.029) * (-4416.786) (-4409.707) (-4410.933) [-4409.635] -- 0:03:13 320000 -- (-4416.216) (-4413.831) (-4422.997) [-4413.717] * (-4412.446) [-4420.149] (-4410.671) (-4414.553) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 320500 -- [-4414.937] (-4420.123) (-4415.419) (-4411.221) * (-4413.349) [-4420.739] (-4412.450) (-4416.305) -- 0:03:15 321000 -- [-4413.197] (-4414.702) (-4413.280) (-4414.244) * (-4423.972) (-4416.008) (-4417.327) [-4411.470] -- 0:03:14 321500 -- (-4415.173) [-4414.287] (-4411.235) (-4417.565) * [-4414.827] (-4408.833) (-4418.944) (-4412.286) -- 0:03:14 322000 -- [-4411.956] (-4424.210) (-4416.950) (-4410.605) * [-4413.841] (-4411.525) (-4419.683) (-4414.203) -- 0:03:13 322500 -- (-4414.743) (-4415.700) (-4415.221) [-4410.341] * (-4414.791) (-4411.515) (-4412.856) [-4413.973] -- 0:03:13 323000 -- (-4415.139) [-4422.027] (-4417.691) (-4413.676) * (-4422.364) (-4413.537) [-4410.111] (-4421.742) -- 0:03:12 323500 -- (-4417.752) [-4414.914] (-4411.378) (-4413.281) * (-4415.256) [-4414.414] (-4414.994) (-4409.687) -- 0:03:14 324000 -- (-4413.919) (-4418.741) (-4417.061) [-4417.807] * (-4413.872) [-4411.549] (-4419.791) (-4416.787) -- 0:03:14 324500 -- (-4416.700) (-4418.643) (-4415.085) [-4415.053] * (-4413.406) (-4408.583) (-4410.889) [-4412.696] -- 0:03:13 325000 -- (-4417.179) (-4417.058) [-4414.116] (-4419.820) * (-4414.544) (-4411.207) (-4410.050) [-4412.779] -- 0:03:13 Average standard deviation of split frequencies: 0.000000 325500 -- (-4412.510) [-4408.796] (-4415.024) (-4420.149) * (-4411.239) [-4411.300] (-4418.765) (-4412.992) -- 0:03:12 326000 -- (-4407.607) [-4417.890] (-4414.713) (-4419.126) * (-4413.564) (-4420.343) (-4412.495) [-4419.846] -- 0:03:12 326500 -- (-4416.137) (-4410.670) (-4417.155) [-4420.309] * [-4410.577] (-4411.949) (-4412.509) (-4416.595) -- 0:03:11 327000 -- (-4420.986) [-4409.923] (-4412.157) (-4415.320) * (-4412.298) (-4417.073) [-4413.631] (-4413.668) -- 0:03:13 327500 -- (-4413.019) [-4409.786] (-4411.735) (-4415.097) * [-4413.496] (-4413.887) (-4416.982) (-4419.010) -- 0:03:13 328000 -- (-4414.238) [-4414.884] (-4412.828) (-4414.489) * (-4413.822) [-4413.609] (-4423.870) (-4417.095) -- 0:03:12 328500 -- (-4415.704) [-4416.372] (-4413.895) (-4410.806) * (-4410.370) (-4416.385) (-4412.045) [-4412.182] -- 0:03:12 329000 -- (-4415.431) (-4414.807) (-4411.039) [-4409.721] * [-4414.640] (-4413.544) (-4418.630) (-4420.090) -- 0:03:11 329500 -- (-4412.153) (-4408.745) (-4418.849) [-4411.539] * (-4420.734) (-4414.630) (-4415.799) [-4409.815] -- 0:03:11 330000 -- (-4409.368) (-4409.628) [-4415.339] (-4418.012) * (-4417.422) (-4411.208) [-4409.917] (-4415.528) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 330500 -- (-4415.252) (-4414.208) (-4415.939) [-4412.157] * [-4419.780] (-4414.088) (-4410.353) (-4412.190) -- 0:03:10 331000 -- (-4417.710) (-4415.772) (-4412.237) [-4416.404] * (-4423.017) [-4412.775] (-4418.848) (-4411.190) -- 0:03:12 331500 -- (-4410.348) [-4411.401] (-4413.563) (-4411.556) * (-4416.148) (-4414.522) (-4414.735) [-4411.321] -- 0:03:11 332000 -- [-4411.833] (-4408.902) (-4411.617) (-4415.040) * (-4415.594) [-4421.823] (-4411.175) (-4413.787) -- 0:03:11 332500 -- (-4409.757) [-4416.138] (-4414.526) (-4412.325) * (-4412.034) (-4415.129) [-4410.060] (-4412.208) -- 0:03:10 333000 -- (-4412.728) (-4412.773) [-4410.014] (-4419.246) * (-4413.670) (-4413.529) [-4408.953] (-4413.694) -- 0:03:10 333500 -- [-4410.978] (-4421.112) (-4412.155) (-4410.349) * [-4412.430] (-4409.370) (-4419.400) (-4416.327) -- 0:03:09 334000 -- (-4415.439) [-4409.436] (-4417.789) (-4413.127) * (-4409.045) (-4412.113) [-4412.879] (-4413.940) -- 0:03:09 334500 -- (-4415.576) (-4415.186) (-4414.944) [-4410.700] * [-4413.198] (-4416.744) (-4418.590) (-4412.465) -- 0:03:10 335000 -- (-4410.285) (-4415.387) (-4412.707) [-4415.164] * [-4411.211] (-4418.452) (-4417.599) (-4414.040) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 335500 -- (-4412.936) (-4414.602) [-4416.800] (-4420.145) * (-4414.519) (-4421.553) [-4411.731] (-4410.051) -- 0:03:10 336000 -- [-4411.605] (-4411.275) (-4411.603) (-4417.108) * (-4412.874) (-4411.809) [-4414.917] (-4412.061) -- 0:03:09 336500 -- (-4411.738) [-4417.025] (-4415.492) (-4414.590) * (-4415.535) [-4412.112] (-4411.893) (-4410.709) -- 0:03:09 337000 -- (-4411.600) (-4421.769) [-4415.409] (-4417.687) * (-4410.909) (-4412.147) [-4411.864] (-4413.605) -- 0:03:08 337500 -- (-4411.126) (-4417.360) [-4414.830] (-4417.173) * (-4411.517) (-4411.419) [-4414.191] (-4413.675) -- 0:03:08 338000 -- [-4417.526] (-4416.928) (-4417.419) (-4422.981) * (-4421.171) [-4412.897] (-4418.638) (-4415.257) -- 0:03:09 338500 -- [-4414.653] (-4425.389) (-4413.235) (-4416.604) * (-4419.765) [-4419.575] (-4416.741) (-4413.373) -- 0:03:09 339000 -- (-4417.098) (-4421.206) [-4422.325] (-4415.847) * (-4413.265) (-4414.309) (-4418.181) [-4409.881] -- 0:03:09 339500 -- [-4411.978] (-4411.860) (-4411.754) (-4416.547) * (-4415.080) [-4416.440] (-4415.021) (-4419.939) -- 0:03:08 340000 -- [-4412.790] (-4414.000) (-4412.448) (-4411.576) * (-4414.322) (-4415.466) (-4415.933) [-4414.171] -- 0:03:08 Average standard deviation of split frequencies: 0.000000 340500 -- (-4413.681) [-4416.900] (-4415.334) (-4411.059) * (-4414.070) (-4410.527) (-4411.840) [-4411.092] -- 0:03:07 341000 -- (-4413.820) [-4410.492] (-4421.345) (-4411.920) * (-4413.835) (-4419.300) [-4416.530] (-4417.161) -- 0:03:07 341500 -- (-4410.557) (-4420.557) (-4424.359) [-4412.674] * (-4412.397) (-4412.359) (-4411.134) [-4410.694] -- 0:03:08 342000 -- (-4415.602) (-4417.648) [-4414.290] (-4419.783) * [-4412.569] (-4413.214) (-4415.058) (-4415.902) -- 0:03:08 342500 -- [-4414.697] (-4421.184) (-4413.387) (-4411.858) * (-4416.174) [-4411.819] (-4414.660) (-4414.759) -- 0:03:08 343000 -- (-4419.084) [-4413.955] (-4418.244) (-4416.904) * (-4414.878) (-4410.083) (-4418.068) [-4407.801] -- 0:03:07 343500 -- (-4412.686) [-4415.081] (-4417.415) (-4410.560) * (-4417.216) [-4416.956] (-4417.511) (-4415.166) -- 0:03:07 344000 -- (-4418.766) [-4414.013] (-4411.795) (-4417.152) * (-4416.144) [-4412.191] (-4413.655) (-4411.076) -- 0:03:06 344500 -- (-4418.066) (-4413.207) (-4410.831) [-4410.089] * [-4416.742] (-4410.932) (-4419.097) (-4412.257) -- 0:03:06 345000 -- (-4411.516) (-4413.067) (-4416.062) [-4412.625] * (-4412.842) (-4413.470) (-4417.143) [-4410.942] -- 0:03:07 Average standard deviation of split frequencies: 0.000000 345500 -- [-4419.558] (-4415.078) (-4416.478) (-4413.570) * [-4408.219] (-4417.304) (-4413.367) (-4418.512) -- 0:03:07 346000 -- (-4412.704) (-4413.045) (-4414.117) [-4415.304] * (-4407.565) (-4413.109) [-4413.569] (-4415.995) -- 0:03:07 346500 -- (-4416.273) (-4420.804) [-4410.390] (-4420.666) * (-4411.804) (-4416.985) (-4413.731) [-4416.074] -- 0:03:06 347000 -- (-4416.813) (-4412.495) (-4413.474) [-4413.251] * (-4413.869) (-4417.215) [-4412.698] (-4416.878) -- 0:03:06 347500 -- (-4413.105) (-4414.012) [-4411.922] (-4412.050) * (-4414.875) [-4417.027] (-4414.386) (-4410.680) -- 0:03:05 348000 -- (-4416.498) (-4415.159) (-4418.221) [-4410.679] * (-4412.018) (-4417.025) [-4414.528] (-4411.343) -- 0:03:05 348500 -- [-4413.645] (-4412.767) (-4409.653) (-4410.703) * [-4411.401] (-4410.954) (-4412.409) (-4413.815) -- 0:03:06 349000 -- (-4412.751) (-4412.170) (-4417.816) [-4415.254] * (-4409.446) (-4410.295) (-4414.715) [-4415.423] -- 0:03:06 349500 -- (-4411.255) (-4409.518) (-4420.206) [-4415.053] * (-4416.264) (-4419.833) [-4409.846] (-4416.362) -- 0:03:06 350000 -- (-4414.164) [-4409.897] (-4413.840) (-4415.098) * (-4413.794) (-4419.851) (-4416.513) [-4416.833] -- 0:03:05 Average standard deviation of split frequencies: 0.000000 350500 -- [-4413.268] (-4412.906) (-4415.778) (-4409.752) * (-4411.559) (-4418.883) (-4411.466) [-4417.719] -- 0:03:05 351000 -- (-4411.808) (-4418.166) (-4414.465) [-4417.046] * (-4411.696) [-4417.332] (-4414.998) (-4415.845) -- 0:03:04 351500 -- (-4418.613) (-4413.447) (-4411.001) [-4415.989] * (-4412.212) [-4410.862] (-4412.356) (-4411.484) -- 0:03:04 352000 -- (-4416.169) (-4413.530) [-4413.608] (-4414.814) * [-4411.621] (-4415.625) (-4417.225) (-4408.395) -- 0:03:05 352500 -- [-4410.384] (-4416.536) (-4411.506) (-4421.671) * (-4413.544) (-4413.459) [-4415.374] (-4410.690) -- 0:03:05 353000 -- [-4409.492] (-4416.105) (-4411.776) (-4416.430) * [-4410.630] (-4415.835) (-4412.660) (-4412.127) -- 0:03:05 353500 -- (-4418.243) (-4411.362) [-4415.151] (-4416.762) * [-4415.716] (-4412.550) (-4414.843) (-4409.567) -- 0:03:04 354000 -- (-4412.931) [-4416.614] (-4419.230) (-4416.001) * (-4412.627) [-4412.637] (-4415.511) (-4415.205) -- 0:03:04 354500 -- [-4411.183] (-4416.611) (-4415.748) (-4414.362) * [-4413.062] (-4413.778) (-4417.983) (-4410.395) -- 0:03:03 355000 -- (-4411.283) [-4410.517] (-4421.489) (-4411.946) * (-4420.419) (-4412.817) [-4412.388] (-4419.179) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 355500 -- [-4412.518] (-4412.734) (-4416.794) (-4409.818) * (-4414.990) (-4416.381) (-4420.684) [-4413.691] -- 0:03:04 356000 -- (-4417.267) (-4416.370) [-4414.719] (-4411.890) * [-4415.060] (-4418.183) (-4411.510) (-4412.946) -- 0:03:04 356500 -- (-4415.337) (-4410.054) (-4417.549) [-4410.486] * [-4417.076] (-4410.253) (-4420.050) (-4418.548) -- 0:03:04 357000 -- (-4418.262) (-4414.156) (-4407.777) [-4410.734] * (-4414.850) [-4415.706] (-4410.818) (-4412.185) -- 0:03:03 357500 -- (-4413.700) [-4415.739] (-4416.485) (-4423.311) * (-4420.812) (-4410.218) (-4420.602) [-4412.243] -- 0:03:03 358000 -- (-4410.961) [-4411.871] (-4420.558) (-4415.143) * (-4408.985) (-4420.369) (-4415.222) [-4410.192] -- 0:03:02 358500 -- [-4413.565] (-4415.057) (-4419.801) (-4412.290) * (-4412.261) (-4414.720) [-4418.690] (-4410.410) -- 0:03:02 359000 -- (-4416.534) [-4412.781] (-4417.990) (-4412.031) * [-4417.229] (-4411.374) (-4409.810) (-4412.285) -- 0:03:03 359500 -- (-4415.666) (-4412.423) (-4421.663) [-4409.861] * (-4412.547) (-4413.108) [-4411.290] (-4423.691) -- 0:03:03 360000 -- (-4417.852) (-4409.412) (-4418.374) [-4414.476] * (-4419.973) [-4412.557] (-4409.745) (-4417.450) -- 0:03:03 Average standard deviation of split frequencies: 0.000000 360500 -- [-4415.345] (-4413.112) (-4422.359) (-4412.418) * (-4416.817) (-4414.344) (-4411.992) [-4423.631] -- 0:03:02 361000 -- (-4415.403) [-4416.930] (-4415.721) (-4416.415) * (-4411.824) (-4410.980) (-4414.770) [-4415.412] -- 0:03:02 361500 -- [-4409.068] (-4414.890) (-4412.939) (-4414.168) * [-4413.334] (-4409.113) (-4419.938) (-4421.250) -- 0:03:01 362000 -- (-4416.528) (-4413.987) [-4413.617] (-4415.314) * (-4414.361) [-4411.830] (-4418.170) (-4410.319) -- 0:03:01 362500 -- [-4410.552] (-4420.549) (-4413.675) (-4411.779) * (-4417.371) [-4413.464] (-4418.506) (-4413.957) -- 0:03:02 363000 -- [-4410.556] (-4416.229) (-4417.109) (-4418.685) * (-4426.269) (-4411.847) (-4417.442) [-4411.230] -- 0:03:02 363500 -- (-4412.814) (-4419.058) [-4412.831] (-4411.620) * (-4416.901) (-4418.699) (-4413.921) [-4415.283] -- 0:03:02 364000 -- (-4412.023) (-4419.111) [-4412.984] (-4409.830) * (-4416.543) (-4419.802) [-4414.352] (-4427.991) -- 0:03:01 364500 -- (-4418.025) (-4411.506) [-4414.962] (-4418.461) * (-4414.829) (-4411.483) (-4414.720) [-4415.562] -- 0:03:01 365000 -- (-4411.052) (-4412.043) [-4410.568] (-4413.835) * [-4412.387] (-4417.383) (-4416.947) (-4410.667) -- 0:03:00 Average standard deviation of split frequencies: 0.000000 365500 -- (-4414.445) [-4410.274] (-4414.063) (-4417.921) * (-4417.540) (-4410.213) [-4412.689] (-4417.769) -- 0:03:00 366000 -- (-4415.922) [-4415.979] (-4412.869) (-4419.115) * (-4417.378) (-4418.132) [-4411.608] (-4412.992) -- 0:03:01 366500 -- [-4411.222] (-4413.827) (-4410.956) (-4412.672) * (-4417.032) (-4416.986) [-4415.605] (-4421.054) -- 0:03:01 367000 -- (-4411.232) [-4414.030] (-4413.666) (-4413.175) * (-4422.433) (-4415.831) (-4409.692) [-4412.782] -- 0:03:01 367500 -- (-4410.162) (-4412.805) [-4413.387] (-4419.231) * (-4415.659) (-4414.544) [-4412.788] (-4412.512) -- 0:03:00 368000 -- [-4414.699] (-4410.927) (-4412.225) (-4416.312) * (-4412.613) (-4415.194) (-4413.713) [-4412.523] -- 0:03:00 368500 -- [-4414.997] (-4409.702) (-4414.213) (-4421.524) * (-4410.170) (-4413.783) [-4410.180] (-4428.395) -- 0:02:59 369000 -- (-4411.634) (-4411.383) [-4410.633] (-4411.514) * (-4418.740) (-4411.660) (-4409.664) [-4416.342] -- 0:02:59 369500 -- (-4416.589) [-4410.244] (-4410.899) (-4412.927) * (-4412.097) [-4412.105] (-4411.522) (-4420.990) -- 0:03:00 370000 -- (-4415.813) (-4416.636) (-4420.001) [-4412.178] * (-4414.427) (-4421.439) [-4410.462] (-4412.569) -- 0:03:00 Average standard deviation of split frequencies: 0.000000 370500 -- (-4412.803) (-4418.149) (-4412.739) [-4412.800] * (-4414.264) [-4407.555] (-4409.130) (-4413.226) -- 0:03:00 371000 -- (-4419.575) (-4415.308) (-4415.324) [-4412.600] * (-4414.810) [-4415.509] (-4414.924) (-4415.170) -- 0:02:59 371500 -- (-4419.822) (-4412.848) [-4415.358] (-4414.905) * (-4420.882) [-4415.257] (-4419.174) (-4416.348) -- 0:02:59 372000 -- (-4411.604) (-4414.038) (-4418.578) [-4417.853] * [-4409.653] (-4421.482) (-4413.675) (-4418.930) -- 0:02:58 372500 -- (-4415.206) (-4412.987) [-4412.774] (-4413.646) * [-4413.810] (-4420.930) (-4414.518) (-4416.089) -- 0:02:58 373000 -- (-4416.785) [-4410.092] (-4417.468) (-4422.117) * (-4413.260) (-4423.272) (-4412.732) [-4411.855] -- 0:02:59 373500 -- (-4409.224) [-4416.977] (-4419.264) (-4415.140) * (-4415.879) (-4425.665) (-4416.553) [-4410.156] -- 0:02:59 374000 -- [-4414.046] (-4412.700) (-4419.544) (-4419.741) * [-4414.946] (-4420.417) (-4407.507) (-4414.371) -- 0:02:59 374500 -- [-4416.067] (-4413.956) (-4411.806) (-4415.364) * [-4411.114] (-4419.230) (-4413.248) (-4416.487) -- 0:02:58 375000 -- (-4412.790) (-4411.574) [-4410.890] (-4414.185) * (-4415.279) (-4414.161) (-4413.411) [-4412.264] -- 0:02:58 Average standard deviation of split frequencies: 0.000000 375500 -- (-4410.782) (-4410.692) [-4415.559] (-4416.118) * (-4419.211) (-4410.768) [-4413.215] (-4417.208) -- 0:02:57 376000 -- [-4412.243] (-4413.886) (-4416.143) (-4414.340) * (-4417.256) (-4415.571) (-4413.392) [-4412.643] -- 0:02:59 376500 -- (-4411.372) (-4415.115) (-4413.056) [-4412.312] * (-4410.213) [-4412.174] (-4413.072) (-4414.646) -- 0:02:58 377000 -- (-4416.484) (-4412.070) [-4412.076] (-4417.088) * (-4415.828) (-4416.537) (-4412.306) [-4415.529] -- 0:02:58 377500 -- [-4413.562] (-4425.849) (-4411.841) (-4419.245) * (-4414.625) (-4423.792) [-4414.716] (-4417.679) -- 0:02:58 378000 -- (-4413.982) (-4424.847) [-4408.713] (-4417.170) * [-4416.031] (-4419.484) (-4412.849) (-4418.615) -- 0:02:57 378500 -- (-4416.655) (-4423.465) [-4412.722] (-4417.423) * (-4422.225) (-4413.603) [-4413.039] (-4419.835) -- 0:02:57 379000 -- [-4413.470] (-4420.364) (-4414.994) (-4416.060) * (-4415.694) (-4411.334) (-4411.472) [-4413.222] -- 0:02:56 379500 -- (-4413.876) [-4417.522] (-4413.896) (-4412.232) * (-4419.455) [-4411.888] (-4411.871) (-4420.857) -- 0:02:56 380000 -- (-4421.522) (-4412.135) [-4412.006] (-4413.053) * (-4417.801) [-4412.295] (-4413.191) (-4417.952) -- 0:02:57 Average standard deviation of split frequencies: 0.000000 380500 -- [-4418.995] (-4416.188) (-4423.300) (-4412.460) * (-4415.631) (-4408.505) (-4416.212) [-4423.434] -- 0:02:57 381000 -- (-4417.410) (-4415.290) [-4408.466] (-4415.172) * (-4416.901) (-4421.492) [-4417.782] (-4414.232) -- 0:02:57 381500 -- [-4412.869] (-4412.139) (-4411.141) (-4412.644) * (-4417.053) [-4414.047] (-4415.237) (-4416.313) -- 0:02:56 382000 -- (-4413.776) (-4418.691) (-4422.310) [-4418.303] * [-4416.020] (-4411.077) (-4410.063) (-4416.205) -- 0:02:56 382500 -- (-4415.267) [-4413.352] (-4419.704) (-4413.415) * (-4414.605) (-4412.709) [-4419.700] (-4417.193) -- 0:02:55 383000 -- (-4421.216) (-4415.263) (-4417.946) [-4420.000] * [-4415.199] (-4412.552) (-4411.257) (-4421.963) -- 0:02:57 383500 -- (-4416.717) (-4422.133) [-4415.015] (-4420.095) * (-4410.001) (-4420.754) [-4412.178] (-4417.539) -- 0:02:56 384000 -- (-4412.915) [-4417.139] (-4412.312) (-4416.283) * (-4416.599) (-4413.708) [-4415.603] (-4415.108) -- 0:02:56 384500 -- (-4418.657) [-4410.473] (-4420.483) (-4410.608) * [-4414.431] (-4418.246) (-4410.328) (-4415.746) -- 0:02:56 385000 -- (-4419.134) [-4416.296] (-4414.943) (-4417.290) * (-4416.688) (-4416.233) [-4412.741] (-4413.964) -- 0:02:55 Average standard deviation of split frequencies: 0.000000 385500 -- [-4414.322] (-4420.031) (-4415.477) (-4413.880) * [-4411.316] (-4413.352) (-4417.308) (-4418.626) -- 0:02:55 386000 -- (-4417.209) [-4414.771] (-4413.239) (-4419.352) * (-4415.294) [-4412.308] (-4415.970) (-4414.888) -- 0:02:54 386500 -- (-4415.063) (-4414.058) (-4413.264) [-4415.233] * [-4408.932] (-4410.722) (-4415.177) (-4414.076) -- 0:02:56 387000 -- (-4416.787) (-4412.676) (-4414.082) [-4420.727] * (-4418.995) (-4418.179) (-4411.896) [-4409.593] -- 0:02:55 387500 -- (-4411.688) [-4412.453] (-4414.628) (-4413.300) * [-4418.701] (-4417.372) (-4412.930) (-4417.523) -- 0:02:55 388000 -- (-4410.408) (-4417.658) (-4415.523) [-4415.362] * (-4413.729) (-4417.661) [-4415.721] (-4409.958) -- 0:02:55 388500 -- (-4414.683) [-4414.316] (-4418.413) (-4413.457) * (-4419.175) (-4411.000) [-4415.949] (-4412.155) -- 0:02:54 389000 -- (-4414.704) [-4413.862] (-4413.019) (-4417.280) * (-4418.303) (-4412.932) (-4411.019) [-4414.476] -- 0:02:54 389500 -- (-4414.213) (-4412.189) [-4415.172] (-4411.531) * (-4412.501) (-4412.449) (-4412.815) [-4415.180] -- 0:02:53 390000 -- (-4414.232) (-4416.326) (-4418.313) [-4414.539] * [-4417.174] (-4412.634) (-4417.319) (-4410.143) -- 0:02:55 Average standard deviation of split frequencies: 0.000000 390500 -- (-4414.418) (-4417.185) (-4418.445) [-4411.802] * (-4412.739) (-4418.052) (-4417.148) [-4411.005] -- 0:02:54 391000 -- [-4416.212] (-4416.410) (-4418.898) (-4413.885) * (-4415.621) (-4410.038) (-4419.554) [-4413.142] -- 0:02:54 391500 -- (-4412.065) [-4412.358] (-4415.953) (-4414.618) * (-4413.449) (-4416.681) (-4415.962) [-4414.102] -- 0:02:54 392000 -- [-4410.572] (-4421.631) (-4414.619) (-4413.807) * (-4411.606) [-4414.808] (-4415.770) (-4412.532) -- 0:02:53 392500 -- (-4416.165) [-4412.045] (-4411.585) (-4410.998) * (-4412.062) (-4409.091) [-4407.507] (-4415.603) -- 0:02:53 393000 -- [-4419.060] (-4416.120) (-4419.734) (-4413.746) * (-4412.175) [-4413.225] (-4414.580) (-4419.077) -- 0:02:52 393500 -- [-4420.056] (-4417.975) (-4418.532) (-4412.972) * (-4410.349) [-4413.158] (-4415.851) (-4417.045) -- 0:02:54 394000 -- (-4414.757) [-4418.059] (-4418.763) (-4411.980) * [-4413.772] (-4413.801) (-4427.383) (-4419.763) -- 0:02:53 394500 -- (-4416.652) [-4418.331] (-4422.937) (-4414.308) * (-4416.691) (-4421.051) (-4413.189) [-4411.723] -- 0:02:53 395000 -- (-4412.132) (-4424.264) (-4415.136) [-4416.905] * [-4416.320] (-4411.287) (-4413.855) (-4412.873) -- 0:02:53 Average standard deviation of split frequencies: 0.000000 395500 -- (-4413.584) (-4416.069) (-4417.558) [-4417.373] * [-4417.267] (-4414.817) (-4411.350) (-4416.906) -- 0:02:52 396000 -- (-4417.773) [-4413.978] (-4413.925) (-4416.464) * (-4422.004) [-4412.901] (-4414.797) (-4416.582) -- 0:02:52 396500 -- [-4414.651] (-4416.071) (-4410.675) (-4416.919) * [-4413.186] (-4410.715) (-4414.949) (-4419.562) -- 0:02:51 397000 -- (-4413.663) (-4413.606) [-4413.004] (-4415.963) * (-4423.882) [-4411.369] (-4413.236) (-4422.168) -- 0:02:53 397500 -- (-4418.519) (-4409.500) [-4412.582] (-4411.892) * [-4411.652] (-4410.434) (-4412.770) (-4415.400) -- 0:02:52 398000 -- (-4415.519) [-4410.992] (-4412.983) (-4413.917) * (-4416.857) (-4410.102) (-4415.934) [-4411.943] -- 0:02:52 398500 -- (-4419.405) [-4414.497] (-4423.244) (-4414.612) * [-4414.375] (-4413.738) (-4411.551) (-4411.227) -- 0:02:52 399000 -- (-4417.551) [-4412.081] (-4411.947) (-4415.438) * [-4411.697] (-4418.851) (-4415.816) (-4415.868) -- 0:02:51 399500 -- (-4411.474) (-4410.960) [-4409.808] (-4414.802) * [-4408.366] (-4415.252) (-4425.635) (-4415.800) -- 0:02:51 400000 -- (-4412.164) (-4411.920) [-4414.793] (-4416.642) * (-4413.214) [-4414.772] (-4418.597) (-4413.609) -- 0:02:51 Average standard deviation of split frequencies: 0.000000 400500 -- (-4411.454) (-4414.475) (-4427.447) [-4413.759] * (-4419.647) [-4410.596] (-4420.207) (-4415.913) -- 0:02:52 401000 -- (-4415.882) [-4412.540] (-4416.931) (-4415.270) * (-4412.479) (-4409.513) [-4415.801] (-4413.040) -- 0:02:51 401500 -- (-4411.214) [-4416.730] (-4412.994) (-4410.211) * (-4414.290) (-4411.581) [-4411.767] (-4413.930) -- 0:02:51 402000 -- (-4422.466) [-4414.128] (-4418.078) (-4410.121) * (-4413.611) (-4417.054) (-4417.222) [-4415.218] -- 0:02:51 402500 -- (-4416.284) (-4419.587) (-4413.842) [-4410.219] * (-4413.171) [-4411.374] (-4415.549) (-4411.568) -- 0:02:50 403000 -- [-4416.316] (-4415.694) (-4414.893) (-4410.838) * (-4421.165) [-4410.462] (-4408.803) (-4412.907) -- 0:02:50 403500 -- (-4414.332) (-4413.800) (-4415.105) [-4411.918] * [-4409.825] (-4418.958) (-4409.937) (-4416.429) -- 0:02:50 404000 -- (-4415.541) (-4415.969) (-4414.488) [-4416.684] * (-4411.752) (-4422.305) (-4415.817) [-4415.196] -- 0:02:51 404500 -- [-4413.754] (-4414.860) (-4417.027) (-4414.961) * (-4413.901) (-4414.309) [-4412.348] (-4410.986) -- 0:02:50 405000 -- (-4407.508) [-4409.908] (-4421.222) (-4417.563) * (-4412.582) (-4413.031) (-4414.713) [-4412.124] -- 0:02:50 Average standard deviation of split frequencies: 0.000000 405500 -- (-4409.748) (-4413.709) [-4413.436] (-4413.335) * (-4421.279) (-4412.893) (-4418.163) [-4415.999] -- 0:02:50 406000 -- (-4414.937) (-4413.678) (-4412.104) [-4413.627] * (-4414.392) [-4413.457] (-4417.459) (-4420.289) -- 0:02:49 406500 -- (-4414.525) (-4416.639) [-4414.001] (-4417.190) * [-4409.924] (-4411.362) (-4414.256) (-4429.464) -- 0:02:49 407000 -- [-4414.163] (-4419.057) (-4419.211) (-4426.320) * (-4414.434) [-4414.290] (-4411.688) (-4428.376) -- 0:02:49 407500 -- [-4411.910] (-4411.385) (-4424.013) (-4421.650) * [-4413.751] (-4415.168) (-4412.025) (-4418.372) -- 0:02:50 408000 -- [-4417.768] (-4419.309) (-4420.230) (-4416.939) * [-4412.844] (-4423.607) (-4413.332) (-4418.724) -- 0:02:49 408500 -- (-4413.143) (-4417.545) (-4421.095) [-4419.507] * (-4412.748) (-4414.814) (-4410.946) [-4412.112] -- 0:02:49 409000 -- [-4412.860] (-4414.461) (-4412.050) (-4423.345) * (-4413.448) (-4423.216) [-4413.783] (-4414.007) -- 0:02:49 409500 -- (-4412.805) (-4417.018) [-4414.760] (-4414.501) * (-4413.762) (-4416.684) [-4412.580] (-4413.056) -- 0:02:48 410000 -- (-4414.859) (-4420.263) [-4411.318] (-4414.825) * (-4412.948) (-4425.092) [-4414.241] (-4419.950) -- 0:02:48 Average standard deviation of split frequencies: 0.000000 410500 -- (-4410.348) (-4419.001) [-4418.637] (-4415.279) * (-4410.615) [-4420.846] (-4414.005) (-4413.350) -- 0:02:48 411000 -- (-4414.635) (-4420.132) [-4407.741] (-4417.950) * (-4412.080) (-4425.316) (-4412.152) [-4409.932] -- 0:02:49 411500 -- [-4409.290] (-4414.244) (-4423.203) (-4417.137) * (-4412.343) [-4414.686] (-4415.392) (-4411.757) -- 0:02:48 412000 -- [-4410.558] (-4417.598) (-4416.887) (-4414.656) * (-4415.218) [-4408.682] (-4417.537) (-4410.075) -- 0:02:48 412500 -- (-4413.452) [-4414.485] (-4412.680) (-4413.898) * [-4415.783] (-4416.494) (-4416.219) (-4411.604) -- 0:02:48 413000 -- [-4416.084] (-4419.970) (-4416.594) (-4421.847) * [-4416.632] (-4412.642) (-4410.599) (-4417.197) -- 0:02:47 413500 -- (-4413.192) (-4416.085) [-4415.508] (-4420.241) * (-4413.105) (-4410.071) (-4415.888) [-4414.172] -- 0:02:47 414000 -- [-4413.960] (-4411.983) (-4414.071) (-4413.875) * (-4415.244) [-4410.518] (-4411.112) (-4412.198) -- 0:02:47 414500 -- (-4416.058) [-4410.586] (-4424.864) (-4410.154) * (-4410.697) (-4411.557) (-4409.659) [-4410.660] -- 0:02:48 415000 -- (-4416.228) [-4410.101] (-4418.733) (-4413.349) * (-4410.762) (-4416.716) [-4414.877] (-4411.477) -- 0:02:47 Average standard deviation of split frequencies: 0.000000 415500 -- (-4419.161) [-4415.338] (-4412.862) (-4414.183) * (-4417.683) (-4416.003) [-4414.022] (-4414.773) -- 0:02:47 416000 -- (-4418.238) (-4414.704) [-4415.173] (-4417.861) * [-4414.760] (-4412.079) (-4416.923) (-4410.344) -- 0:02:47 416500 -- [-4411.020] (-4410.778) (-4411.656) (-4414.263) * [-4414.633] (-4415.728) (-4412.014) (-4416.201) -- 0:02:46 417000 -- [-4416.759] (-4414.616) (-4417.999) (-4412.424) * (-4419.109) (-4413.357) (-4414.173) [-4412.121] -- 0:02:46 417500 -- (-4411.424) [-4413.068] (-4408.576) (-4417.880) * (-4417.189) (-4411.045) (-4412.626) [-4411.001] -- 0:02:46 418000 -- [-4414.393] (-4410.121) (-4417.042) (-4419.652) * (-4423.971) [-4416.643] (-4415.145) (-4412.021) -- 0:02:47 418500 -- (-4415.750) (-4415.291) [-4415.612] (-4412.331) * [-4416.842] (-4413.653) (-4415.466) (-4415.132) -- 0:02:46 419000 -- [-4414.127] (-4414.409) (-4421.030) (-4412.971) * (-4414.602) [-4408.347] (-4411.326) (-4418.690) -- 0:02:46 419500 -- (-4415.220) [-4418.716] (-4420.058) (-4416.810) * [-4408.737] (-4416.961) (-4410.129) (-4418.673) -- 0:02:46 420000 -- [-4415.186] (-4422.844) (-4412.600) (-4418.603) * (-4413.566) (-4412.061) [-4413.216] (-4415.205) -- 0:02:45 Average standard deviation of split frequencies: 0.000000 420500 -- (-4423.130) (-4415.478) (-4415.081) [-4412.951] * (-4413.110) (-4412.723) [-4410.983] (-4411.365) -- 0:02:45 421000 -- (-4411.706) (-4412.976) [-4415.615] (-4408.237) * (-4417.099) (-4413.229) [-4409.922] (-4421.334) -- 0:02:45 421500 -- (-4421.665) (-4421.951) (-4419.305) [-4409.506] * (-4420.481) (-4417.078) (-4410.296) [-4415.949] -- 0:02:46 422000 -- (-4413.476) [-4409.658] (-4413.454) (-4409.350) * [-4417.382] (-4412.138) (-4411.475) (-4416.816) -- 0:02:45 422500 -- [-4410.390] (-4417.253) (-4411.910) (-4414.254) * (-4416.839) (-4418.022) (-4410.093) [-4414.956] -- 0:02:45 423000 -- [-4408.236] (-4415.024) (-4412.946) (-4414.184) * (-4424.498) (-4416.691) (-4413.634) [-4421.910] -- 0:02:45 423500 -- [-4409.673] (-4415.167) (-4410.863) (-4412.855) * (-4412.916) (-4415.212) [-4410.286] (-4409.815) -- 0:02:44 424000 -- (-4414.237) (-4414.085) [-4412.588] (-4420.419) * (-4416.388) [-4413.412] (-4415.429) (-4413.533) -- 0:02:44 424500 -- (-4418.657) (-4409.851) (-4415.954) [-4419.372] * [-4414.053] (-4414.447) (-4421.979) (-4410.155) -- 0:02:45 425000 -- (-4415.616) (-4413.083) (-4411.674) [-4411.496] * (-4421.057) (-4410.497) (-4411.514) [-4413.944] -- 0:02:45 Average standard deviation of split frequencies: 0.000000 425500 -- (-4415.993) (-4409.819) [-4413.994] (-4417.961) * [-4408.449] (-4414.279) (-4421.015) (-4413.190) -- 0:02:44 426000 -- (-4414.412) (-4418.863) (-4416.225) [-4413.644] * [-4409.648] (-4411.121) (-4414.145) (-4411.957) -- 0:02:44 426500 -- (-4418.266) (-4412.292) [-4417.316] (-4415.553) * (-4413.525) (-4412.387) [-4415.139] (-4413.845) -- 0:02:44 427000 -- [-4417.941] (-4416.410) (-4412.817) (-4414.053) * (-4414.063) (-4418.191) [-4419.214] (-4424.955) -- 0:02:43 427500 -- [-4416.176] (-4421.872) (-4412.533) (-4409.870) * (-4414.459) (-4413.591) (-4414.507) [-4414.950] -- 0:02:43 428000 -- (-4419.873) [-4414.031] (-4416.696) (-4413.458) * (-4415.630) [-4409.449] (-4420.385) (-4413.610) -- 0:02:43 428500 -- (-4414.306) (-4414.602) (-4417.935) [-4412.853] * (-4413.446) [-4411.294] (-4418.861) (-4411.282) -- 0:02:44 429000 -- [-4416.652] (-4413.365) (-4419.559) (-4412.177) * [-4414.121] (-4414.133) (-4413.738) (-4416.777) -- 0:02:43 429500 -- (-4415.416) (-4409.760) [-4418.698] (-4415.862) * (-4415.333) [-4415.917] (-4416.039) (-4419.374) -- 0:02:43 430000 -- (-4418.521) [-4411.750] (-4413.495) (-4411.156) * (-4415.289) (-4418.152) (-4418.399) [-4424.478] -- 0:02:43 Average standard deviation of split frequencies: 0.000000 430500 -- (-4419.575) (-4414.125) (-4416.022) [-4414.168] * (-4421.685) (-4410.884) [-4414.662] (-4425.151) -- 0:02:42 431000 -- (-4411.547) (-4414.097) (-4417.754) [-4410.754] * (-4419.824) (-4413.268) [-4412.030] (-4429.828) -- 0:02:42 431500 -- (-4410.414) [-4420.110] (-4420.171) (-4415.811) * (-4422.508) (-4419.519) [-4412.773] (-4416.921) -- 0:02:42 432000 -- [-4416.290] (-4418.996) (-4415.089) (-4413.629) * [-4413.126] (-4417.731) (-4417.286) (-4415.413) -- 0:02:43 432500 -- (-4413.270) [-4412.445] (-4417.477) (-4415.542) * (-4413.040) [-4411.341] (-4416.249) (-4412.907) -- 0:02:42 433000 -- (-4416.193) (-4413.544) (-4414.355) [-4413.728] * (-4411.927) (-4413.586) (-4422.028) [-4411.791] -- 0:02:42 433500 -- (-4411.962) (-4415.332) (-4411.962) [-4413.820] * (-4414.673) (-4414.555) (-4415.540) [-4414.678] -- 0:02:42 434000 -- (-4415.667) [-4413.269] (-4407.859) (-4409.147) * [-4413.549] (-4421.532) (-4419.071) (-4414.219) -- 0:02:41 434500 -- [-4414.198] (-4411.902) (-4410.527) (-4409.705) * [-4410.573] (-4414.525) (-4411.862) (-4421.120) -- 0:02:41 435000 -- (-4412.990) (-4413.058) (-4416.989) [-4414.651] * [-4419.522] (-4410.917) (-4417.549) (-4414.397) -- 0:02:41 Average standard deviation of split frequencies: 0.000000 435500 -- [-4409.671] (-4416.200) (-4417.599) (-4413.127) * (-4415.738) (-4409.598) [-4414.494] (-4415.033) -- 0:02:42 436000 -- (-4416.433) [-4411.085] (-4412.290) (-4413.355) * [-4412.739] (-4416.725) (-4412.933) (-4413.276) -- 0:02:41 436500 -- (-4417.209) [-4413.141] (-4411.405) (-4411.794) * (-4420.632) (-4421.878) (-4418.513) [-4412.151] -- 0:02:41 437000 -- (-4422.179) (-4413.332) [-4423.107] (-4412.548) * (-4420.361) [-4408.520] (-4421.545) (-4416.286) -- 0:02:41 437500 -- [-4415.610] (-4418.491) (-4417.114) (-4412.840) * (-4419.520) [-4411.940] (-4419.037) (-4416.359) -- 0:02:40 438000 -- [-4411.874] (-4409.981) (-4416.208) (-4415.037) * [-4409.118] (-4412.216) (-4430.314) (-4412.364) -- 0:02:40 438500 -- (-4413.128) (-4414.216) [-4410.553] (-4420.180) * (-4412.336) (-4412.947) (-4424.618) [-4416.330] -- 0:02:40 439000 -- [-4410.542] (-4415.070) (-4417.681) (-4418.796) * (-4416.465) [-4410.133] (-4421.973) (-4419.173) -- 0:02:41 439500 -- [-4411.478] (-4423.808) (-4411.968) (-4416.594) * (-4417.232) [-4411.205] (-4412.736) (-4416.221) -- 0:02:40 440000 -- (-4413.254) (-4413.795) (-4412.860) [-4414.283] * [-4421.608] (-4417.302) (-4413.067) (-4409.861) -- 0:02:40 Average standard deviation of split frequencies: 0.000000 440500 -- (-4412.852) (-4421.924) (-4416.654) [-4410.355] * (-4412.980) [-4415.463] (-4425.616) (-4411.182) -- 0:02:40 441000 -- [-4416.531] (-4418.535) (-4414.419) (-4412.538) * (-4413.761) (-4413.903) [-4411.527] (-4413.150) -- 0:02:39 441500 -- [-4416.759] (-4414.456) (-4414.760) (-4408.739) * [-4413.962] (-4415.933) (-4410.606) (-4416.468) -- 0:02:39 442000 -- (-4409.904) (-4412.762) [-4410.676] (-4410.264) * (-4414.115) (-4412.409) [-4410.862] (-4416.431) -- 0:02:39 442500 -- (-4421.650) (-4412.391) (-4410.424) [-4413.137] * (-4415.754) (-4411.388) [-4414.500] (-4418.096) -- 0:02:40 443000 -- (-4414.829) (-4418.767) (-4413.355) [-4417.411] * (-4415.233) (-4412.347) [-4414.896] (-4413.626) -- 0:02:39 443500 -- [-4410.921] (-4420.621) (-4408.539) (-4410.387) * (-4409.677) [-4413.160] (-4422.251) (-4418.450) -- 0:02:39 444000 -- (-4412.105) (-4415.935) (-4412.011) [-4413.834] * [-4416.268] (-4418.211) (-4412.964) (-4411.681) -- 0:02:39 444500 -- [-4415.364] (-4410.294) (-4416.334) (-4417.583) * (-4412.329) [-4413.531] (-4417.673) (-4420.424) -- 0:02:38 445000 -- (-4419.767) [-4410.203] (-4424.149) (-4412.695) * (-4411.213) (-4415.087) [-4410.782] (-4413.586) -- 0:02:38 Average standard deviation of split frequencies: 0.000000 445500 -- (-4416.559) (-4420.789) (-4413.773) [-4409.764] * (-4413.816) (-4411.327) (-4419.900) [-4418.536] -- 0:02:38 446000 -- (-4412.567) (-4419.590) [-4415.054] (-4418.248) * (-4413.765) (-4414.381) (-4416.252) [-4420.343] -- 0:02:38 446500 -- (-4419.584) (-4415.740) [-4414.149] (-4415.436) * [-4409.825] (-4414.775) (-4416.197) (-4414.029) -- 0:02:38 447000 -- (-4418.533) (-4417.572) [-4411.195] (-4413.867) * [-4409.673] (-4413.869) (-4416.792) (-4415.872) -- 0:02:38 447500 -- (-4420.291) [-4415.507] (-4421.500) (-4426.987) * [-4414.230] (-4414.563) (-4411.866) (-4413.108) -- 0:02:38 448000 -- (-4415.113) [-4415.378] (-4409.909) (-4410.825) * (-4410.168) (-4413.271) [-4413.660] (-4411.634) -- 0:02:37 448500 -- (-4413.921) (-4419.731) (-4410.556) [-4413.417] * (-4415.968) [-4415.997] (-4411.509) (-4415.991) -- 0:02:37 449000 -- (-4412.069) [-4415.910] (-4411.211) (-4414.772) * [-4412.058] (-4414.422) (-4416.650) (-4412.629) -- 0:02:37 449500 -- (-4415.021) [-4410.519] (-4409.291) (-4415.093) * (-4414.103) [-4413.752] (-4417.675) (-4413.850) -- 0:02:37 450000 -- (-4416.140) (-4410.730) [-4417.255] (-4413.415) * (-4416.308) [-4410.654] (-4410.454) (-4413.574) -- 0:02:37 Average standard deviation of split frequencies: 0.000000 450500 -- (-4411.897) [-4412.213] (-4412.978) (-4416.530) * [-4412.830] (-4415.464) (-4414.079) (-4414.993) -- 0:02:37 451000 -- (-4418.785) [-4413.869] (-4421.139) (-4419.443) * [-4414.103] (-4415.157) (-4410.616) (-4416.207) -- 0:02:37 451500 -- (-4411.713) [-4412.116] (-4417.521) (-4412.183) * (-4419.484) [-4412.157] (-4411.588) (-4412.042) -- 0:02:36 452000 -- (-4412.507) (-4414.396) (-4424.612) [-4413.685] * (-4411.423) [-4413.632] (-4412.703) (-4414.169) -- 0:02:36 452500 -- (-4414.314) [-4413.604] (-4417.277) (-4427.207) * (-4414.604) [-4419.668] (-4411.933) (-4419.290) -- 0:02:36 453000 -- [-4413.776] (-4416.332) (-4420.766) (-4415.999) * (-4414.071) (-4412.920) [-4410.872] (-4418.221) -- 0:02:36 453500 -- (-4412.202) [-4411.433] (-4415.014) (-4421.826) * (-4418.299) (-4412.139) [-4411.169] (-4413.979) -- 0:02:36 454000 -- (-4414.511) [-4412.635] (-4411.357) (-4423.097) * (-4412.250) (-4419.369) [-4411.328] (-4414.847) -- 0:02:36 454500 -- (-4415.648) (-4421.520) (-4413.044) [-4421.364] * [-4412.929] (-4418.671) (-4413.470) (-4418.238) -- 0:02:36 455000 -- (-4411.933) (-4412.689) [-4416.391] (-4416.172) * (-4423.105) (-4410.692) [-4414.788] (-4412.882) -- 0:02:35 Average standard deviation of split frequencies: 0.000000 455500 -- (-4419.714) [-4411.945] (-4411.411) (-4415.918) * (-4412.861) (-4413.698) [-4414.712] (-4413.554) -- 0:02:35 456000 -- [-4416.863] (-4415.284) (-4417.179) (-4413.566) * (-4418.525) [-4412.553] (-4413.913) (-4412.118) -- 0:02:35 456500 -- (-4413.540) [-4413.152] (-4421.275) (-4419.906) * (-4409.535) (-4412.132) (-4416.864) [-4414.734] -- 0:02:35 457000 -- (-4422.401) [-4412.735] (-4418.313) (-4417.972) * (-4412.929) [-4415.029] (-4412.972) (-4414.162) -- 0:02:35 457500 -- (-4411.966) (-4414.730) [-4412.198] (-4414.773) * (-4416.166) (-4414.157) [-4411.822] (-4412.543) -- 0:02:35 458000 -- [-4411.249] (-4414.355) (-4412.417) (-4414.150) * (-4412.135) (-4411.609) [-4414.302] (-4412.750) -- 0:02:35 458500 -- [-4411.347] (-4417.416) (-4415.111) (-4413.409) * [-4409.166] (-4416.085) (-4410.821) (-4407.916) -- 0:02:34 459000 -- [-4411.384] (-4411.256) (-4414.190) (-4412.637) * (-4410.087) [-4410.698] (-4412.134) (-4414.034) -- 0:02:34 459500 -- [-4410.477] (-4413.512) (-4419.073) (-4412.829) * (-4411.343) [-4410.022] (-4421.142) (-4417.781) -- 0:02:34 460000 -- (-4417.643) [-4413.156] (-4416.327) (-4416.323) * (-4413.157) (-4415.433) [-4413.898] (-4417.735) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 460500 -- (-4410.585) [-4410.001] (-4412.384) (-4413.523) * [-4412.153] (-4415.892) (-4414.549) (-4413.817) -- 0:02:34 461000 -- (-4411.561) [-4410.392] (-4414.919) (-4412.456) * (-4411.770) (-4412.799) (-4412.794) [-4412.569] -- 0:02:34 461500 -- [-4413.890] (-4413.235) (-4418.848) (-4412.332) * (-4415.280) [-4410.973] (-4413.438) (-4414.680) -- 0:02:34 462000 -- (-4415.200) (-4415.763) [-4415.254] (-4414.533) * (-4409.120) (-4416.689) [-4415.412] (-4412.563) -- 0:02:33 462500 -- (-4410.497) (-4416.198) (-4410.805) [-4409.764] * [-4412.186] (-4421.081) (-4415.396) (-4412.428) -- 0:02:33 463000 -- (-4422.935) (-4410.400) (-4411.034) [-4415.943] * (-4420.178) (-4420.819) (-4408.626) [-4410.547] -- 0:02:33 463500 -- [-4423.800] (-4414.384) (-4417.286) (-4412.526) * (-4420.333) (-4414.451) (-4421.342) [-4413.392] -- 0:02:32 464000 -- (-4424.655) (-4415.363) [-4419.014] (-4416.468) * [-4417.134] (-4414.577) (-4415.887) (-4422.645) -- 0:02:33 464500 -- (-4415.104) (-4415.748) (-4412.608) [-4416.010] * [-4412.686] (-4414.852) (-4415.430) (-4418.524) -- 0:02:33 465000 -- (-4417.611) (-4409.123) [-4409.658] (-4413.035) * (-4414.658) (-4410.429) [-4417.278] (-4412.673) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 465500 -- (-4410.867) (-4409.814) (-4413.521) [-4410.630] * (-4410.894) (-4411.585) [-4419.336] (-4418.692) -- 0:02:32 466000 -- (-4421.241) (-4413.044) (-4414.573) [-4409.762] * [-4412.538] (-4423.719) (-4419.267) (-4413.504) -- 0:02:32 466500 -- (-4411.879) (-4413.679) (-4413.756) [-4411.911] * [-4411.906] (-4412.146) (-4417.865) (-4418.740) -- 0:02:32 467000 -- (-4413.267) [-4417.444] (-4414.969) (-4415.053) * (-4410.957) [-4414.881] (-4412.750) (-4417.025) -- 0:02:31 467500 -- [-4411.195] (-4413.447) (-4417.673) (-4411.859) * [-4418.604] (-4412.668) (-4414.412) (-4418.848) -- 0:02:32 468000 -- (-4416.765) [-4414.250] (-4410.710) (-4414.462) * (-4413.277) [-4409.559] (-4412.766) (-4413.047) -- 0:02:32 468500 -- [-4418.288] (-4414.756) (-4412.788) (-4418.645) * (-4420.076) (-4413.640) [-4411.413] (-4409.914) -- 0:02:32 469000 -- (-4411.458) (-4416.521) [-4417.068] (-4411.244) * (-4421.760) (-4415.187) (-4415.968) [-4416.272] -- 0:02:31 469500 -- (-4423.067) [-4421.899] (-4413.874) (-4409.473) * [-4411.685] (-4414.291) (-4413.529) (-4413.848) -- 0:02:31 470000 -- (-4419.900) (-4415.630) [-4413.843] (-4411.613) * (-4412.134) [-4413.054] (-4414.753) (-4410.671) -- 0:02:31 Average standard deviation of split frequencies: 0.000000 470500 -- [-4410.762] (-4418.556) (-4412.736) (-4417.386) * (-4414.460) (-4415.364) (-4411.054) [-4417.484] -- 0:02:30 471000 -- (-4417.350) (-4420.502) (-4414.021) [-4413.367] * (-4416.305) [-4416.618] (-4417.509) (-4413.553) -- 0:02:31 471500 -- (-4415.212) (-4410.178) [-4414.778] (-4414.255) * (-4413.301) (-4413.379) (-4411.379) [-4414.740] -- 0:02:31 472000 -- (-4415.683) (-4413.851) (-4424.292) [-4415.429] * (-4417.185) [-4411.026] (-4417.254) (-4414.336) -- 0:02:31 472500 -- (-4415.823) (-4420.833) [-4418.411] (-4418.866) * (-4415.164) (-4410.823) [-4411.742] (-4414.419) -- 0:02:30 473000 -- (-4416.098) [-4411.205] (-4413.731) (-4412.236) * [-4411.969] (-4410.618) (-4412.849) (-4409.880) -- 0:02:30 473500 -- (-4412.974) [-4415.565] (-4420.364) (-4415.952) * (-4411.158) (-4410.847) (-4420.702) [-4415.716] -- 0:02:30 474000 -- (-4417.105) [-4412.622] (-4418.235) (-4410.662) * [-4411.308] (-4410.776) (-4415.928) (-4416.409) -- 0:02:29 474500 -- [-4419.644] (-4417.474) (-4416.973) (-4415.773) * (-4413.555) [-4411.389] (-4416.041) (-4413.169) -- 0:02:30 475000 -- [-4410.698] (-4413.100) (-4415.422) (-4413.397) * (-4411.441) (-4417.953) (-4411.457) [-4414.497] -- 0:02:30 Average standard deviation of split frequencies: 0.000000 475500 -- (-4409.122) (-4419.364) (-4417.457) [-4412.194] * (-4413.032) [-4411.267] (-4412.500) (-4423.452) -- 0:02:30 476000 -- (-4410.026) [-4415.936] (-4417.837) (-4415.681) * (-4417.515) (-4416.524) (-4414.634) [-4416.410] -- 0:02:29 476500 -- (-4413.317) (-4411.854) (-4412.862) [-4415.537] * (-4419.449) (-4410.240) (-4419.738) [-4413.305] -- 0:02:29 477000 -- (-4418.595) (-4419.779) (-4423.791) [-4418.157] * (-4415.559) (-4408.748) (-4415.897) [-4412.755] -- 0:02:29 477500 -- (-4411.608) (-4413.473) [-4423.750] (-4409.491) * [-4412.796] (-4409.298) (-4418.432) (-4411.877) -- 0:02:28 478000 -- (-4412.682) (-4417.154) [-4414.866] (-4409.878) * (-4415.003) (-4410.892) [-4417.026] (-4414.109) -- 0:02:29 478500 -- (-4422.758) (-4411.339) [-4413.198] (-4411.738) * [-4414.918] (-4413.407) (-4412.925) (-4423.527) -- 0:02:29 479000 -- (-4414.981) [-4414.642] (-4411.055) (-4421.967) * (-4418.925) [-4410.523] (-4413.348) (-4416.939) -- 0:02:29 479500 -- (-4409.536) [-4417.225] (-4418.296) (-4422.376) * (-4423.615) (-4417.131) [-4411.862] (-4410.498) -- 0:02:28 480000 -- (-4421.661) [-4414.563] (-4415.633) (-4416.354) * [-4413.131] (-4418.510) (-4416.516) (-4421.565) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 480500 -- (-4420.514) (-4411.549) [-4414.007] (-4408.710) * (-4418.754) [-4410.410] (-4412.572) (-4415.466) -- 0:02:28 481000 -- (-4410.856) (-4420.057) (-4411.227) [-4413.931] * (-4424.482) (-4416.504) (-4420.342) [-4418.250] -- 0:02:27 481500 -- [-4409.377] (-4415.186) (-4413.264) (-4416.691) * [-4415.270] (-4410.494) (-4410.858) (-4413.988) -- 0:02:28 482000 -- (-4421.069) [-4415.338] (-4412.449) (-4418.796) * (-4413.334) [-4417.309] (-4413.409) (-4418.572) -- 0:02:28 482500 -- (-4413.725) [-4413.778] (-4411.517) (-4412.565) * (-4414.749) (-4422.418) [-4413.471] (-4418.858) -- 0:02:28 483000 -- (-4416.180) [-4415.927] (-4415.609) (-4421.441) * (-4422.662) (-4411.557) [-4417.373] (-4415.177) -- 0:02:27 483500 -- [-4412.364] (-4414.324) (-4412.994) (-4415.724) * (-4409.391) (-4410.232) (-4415.224) [-4413.853] -- 0:02:27 484000 -- (-4418.038) [-4416.627] (-4424.121) (-4409.842) * (-4410.989) (-4422.854) (-4412.642) [-4412.878] -- 0:02:27 484500 -- (-4417.592) (-4415.094) (-4419.550) [-4411.956] * (-4414.478) (-4420.075) (-4418.558) [-4416.015] -- 0:02:26 485000 -- [-4417.449] (-4419.795) (-4420.686) (-4414.372) * [-4414.553] (-4415.869) (-4413.135) (-4420.561) -- 0:02:27 Average standard deviation of split frequencies: 0.000000 485500 -- (-4417.837) (-4415.645) (-4427.014) [-4410.433] * [-4410.038] (-4415.034) (-4414.498) (-4415.578) -- 0:02:27 486000 -- (-4414.305) (-4423.611) (-4418.493) [-4415.380] * [-4413.407] (-4420.650) (-4411.660) (-4410.882) -- 0:02:27 486500 -- (-4414.652) (-4414.752) [-4414.054] (-4415.651) * [-4409.703] (-4415.726) (-4417.916) (-4412.328) -- 0:02:26 487000 -- [-4413.407] (-4422.458) (-4416.668) (-4411.278) * (-4410.523) (-4417.523) (-4414.511) [-4414.476] -- 0:02:26 487500 -- [-4413.096] (-4413.079) (-4416.544) (-4416.756) * [-4416.811] (-4422.039) (-4413.170) (-4416.957) -- 0:02:26 488000 -- (-4414.958) (-4417.746) [-4414.835] (-4416.404) * (-4411.107) (-4419.784) (-4415.705) [-4412.628] -- 0:02:25 488500 -- (-4411.589) (-4415.939) [-4411.993] (-4414.235) * [-4414.331] (-4414.881) (-4412.856) (-4418.909) -- 0:02:26 489000 -- (-4414.737) (-4409.857) (-4413.209) [-4409.710] * (-4414.971) (-4414.864) [-4412.198] (-4417.493) -- 0:02:26 489500 -- (-4419.742) (-4415.885) (-4415.414) [-4421.004] * (-4414.122) [-4411.875] (-4418.248) (-4410.731) -- 0:02:26 490000 -- [-4408.743] (-4416.463) (-4413.704) (-4412.579) * [-4417.693] (-4410.999) (-4414.667) (-4414.104) -- 0:02:25 Average standard deviation of split frequencies: 0.000000 490500 -- (-4418.532) [-4418.788] (-4413.981) (-4413.119) * [-4412.181] (-4413.197) (-4413.168) (-4418.387) -- 0:02:25 491000 -- (-4414.432) (-4412.039) (-4411.602) [-4412.022] * (-4416.389) (-4408.846) [-4417.229] (-4414.087) -- 0:02:25 491500 -- [-4411.819] (-4412.843) (-4414.984) (-4415.601) * (-4412.509) [-4412.576] (-4418.504) (-4413.284) -- 0:02:24 492000 -- (-4420.530) (-4414.891) [-4415.852] (-4417.039) * (-4411.009) (-4414.135) [-4415.348] (-4416.994) -- 0:02:24 492500 -- (-4411.044) [-4411.854] (-4414.243) (-4410.932) * [-4418.027] (-4420.643) (-4417.507) (-4414.529) -- 0:02:25 493000 -- [-4409.768] (-4410.672) (-4414.836) (-4415.309) * [-4411.751] (-4411.603) (-4414.761) (-4414.355) -- 0:02:25 493500 -- (-4414.210) [-4412.867] (-4413.964) (-4415.903) * [-4412.739] (-4416.117) (-4413.446) (-4413.349) -- 0:02:24 494000 -- [-4415.557] (-4423.956) (-4414.622) (-4413.463) * [-4409.755] (-4414.303) (-4415.795) (-4411.477) -- 0:02:24 494500 -- (-4413.433) (-4421.814) (-4416.848) [-4414.891] * (-4410.529) [-4412.904] (-4420.631) (-4418.947) -- 0:02:24 495000 -- (-4415.846) (-4413.168) [-4420.401] (-4410.872) * [-4415.435] (-4413.129) (-4418.756) (-4419.922) -- 0:02:23 Average standard deviation of split frequencies: 0.000000 495500 -- [-4417.978] (-4412.592) (-4418.050) (-4413.751) * (-4410.978) (-4418.050) (-4421.667) [-4414.084] -- 0:02:24 496000 -- (-4414.229) (-4410.287) (-4417.220) [-4416.668] * [-4417.874] (-4413.749) (-4415.306) (-4412.664) -- 0:02:24 496500 -- (-4419.323) (-4414.784) [-4415.632] (-4416.657) * (-4417.189) (-4413.112) (-4415.419) [-4413.880] -- 0:02:24 497000 -- (-4415.348) (-4409.105) [-4414.941] (-4419.420) * (-4422.087) (-4416.849) [-4411.982] (-4412.995) -- 0:02:23 497500 -- [-4412.096] (-4410.562) (-4414.372) (-4413.341) * [-4414.854] (-4411.747) (-4416.227) (-4417.137) -- 0:02:23 498000 -- (-4410.801) (-4410.822) (-4416.122) [-4417.101] * (-4417.384) (-4419.136) [-4416.248] (-4411.608) -- 0:02:23 498500 -- (-4413.484) (-4414.635) [-4412.521] (-4411.394) * (-4420.863) [-4411.125] (-4415.879) (-4414.037) -- 0:02:22 499000 -- [-4413.367] (-4416.351) (-4420.623) (-4417.774) * (-4420.427) (-4411.036) [-4411.310] (-4421.104) -- 0:02:22 499500 -- (-4411.714) (-4416.769) (-4412.445) [-4412.257] * (-4417.452) [-4412.762] (-4409.945) (-4414.193) -- 0:02:23 500000 -- (-4413.789) (-4415.076) (-4415.631) [-4415.043] * (-4417.170) (-4415.147) (-4412.381) [-4410.331] -- 0:02:23 Average standard deviation of split frequencies: 0.000000 500500 -- (-4411.353) (-4418.560) [-4419.112] (-4410.987) * (-4415.685) [-4410.361] (-4412.894) (-4410.665) -- 0:02:22 501000 -- (-4414.074) (-4410.295) (-4413.508) [-4416.436] * (-4418.419) (-4417.295) (-4416.664) [-4408.306] -- 0:02:22 501500 -- (-4414.781) (-4412.755) (-4411.052) [-4411.048] * [-4413.115] (-4410.401) (-4415.956) (-4421.895) -- 0:02:22 502000 -- [-4415.396] (-4417.576) (-4414.060) (-4419.411) * [-4409.945] (-4417.664) (-4414.238) (-4408.021) -- 0:02:21 502500 -- [-4419.961] (-4413.670) (-4419.505) (-4413.577) * [-4410.035] (-4415.379) (-4409.994) (-4420.100) -- 0:02:21 503000 -- (-4417.173) [-4411.518] (-4421.050) (-4412.782) * (-4408.713) (-4412.254) (-4418.950) [-4408.582] -- 0:02:22 503500 -- (-4413.112) (-4420.182) [-4418.920] (-4416.042) * (-4412.008) (-4412.696) (-4414.492) [-4410.659] -- 0:02:21 504000 -- [-4413.478] (-4413.426) (-4415.965) (-4418.673) * [-4408.723] (-4412.591) (-4419.838) (-4415.317) -- 0:02:21 504500 -- (-4412.896) (-4416.102) [-4414.649] (-4417.965) * [-4412.470] (-4415.410) (-4414.737) (-4418.402) -- 0:02:21 505000 -- (-4418.999) (-4411.731) [-4412.054] (-4416.549) * (-4416.110) (-4418.733) [-4414.020] (-4425.404) -- 0:02:21 Average standard deviation of split frequencies: 0.000000 505500 -- (-4418.170) [-4413.677] (-4414.189) (-4413.940) * [-4415.323] (-4414.926) (-4416.297) (-4416.664) -- 0:02:20 506000 -- (-4414.968) (-4417.619) (-4414.502) [-4415.362] * (-4418.833) [-4414.356] (-4416.216) (-4412.786) -- 0:02:21 506500 -- (-4417.163) (-4413.344) (-4417.287) [-4419.037] * [-4415.402] (-4415.443) (-4413.038) (-4411.791) -- 0:02:21 507000 -- (-4428.635) [-4413.256] (-4418.103) (-4420.478) * (-4413.381) (-4409.822) [-4416.347] (-4415.561) -- 0:02:20 507500 -- (-4411.804) (-4415.475) [-4417.062] (-4423.291) * (-4421.757) [-4417.419] (-4426.231) (-4413.601) -- 0:02:20 508000 -- (-4414.196) [-4417.883] (-4425.223) (-4414.196) * [-4413.930] (-4420.298) (-4417.343) (-4418.324) -- 0:02:20 508500 -- [-4415.160] (-4420.024) (-4414.815) (-4412.332) * (-4412.884) [-4410.345] (-4413.757) (-4415.329) -- 0:02:20 509000 -- (-4412.033) [-4412.481] (-4413.490) (-4414.379) * (-4409.908) [-4416.656] (-4414.774) (-4413.777) -- 0:02:19 509500 -- (-4411.149) (-4413.106) (-4409.901) [-4417.309] * (-4412.359) (-4421.003) [-4414.971] (-4417.212) -- 0:02:20 510000 -- (-4420.759) (-4413.119) [-4416.224] (-4415.396) * (-4416.455) (-4426.202) (-4412.535) [-4415.634] -- 0:02:20 Average standard deviation of split frequencies: 0.000000 510500 -- (-4410.895) [-4414.017] (-4413.138) (-4413.499) * (-4415.837) (-4422.596) [-4414.605] (-4417.742) -- 0:02:19 511000 -- (-4415.924) (-4413.719) (-4413.834) [-4409.819] * (-4414.562) (-4419.574) (-4420.460) [-4407.702] -- 0:02:19 511500 -- (-4415.534) [-4412.295] (-4412.984) (-4414.410) * (-4414.302) (-4413.552) (-4414.036) [-4410.463] -- 0:02:19 512000 -- (-4411.321) (-4413.895) (-4415.573) [-4414.628] * (-4414.363) (-4412.564) (-4410.766) [-4411.947] -- 0:02:19 512500 -- [-4415.730] (-4413.777) (-4411.271) (-4419.132) * (-4412.703) [-4414.823] (-4409.926) (-4417.639) -- 0:02:18 513000 -- [-4420.300] (-4412.400) (-4417.949) (-4414.274) * [-4414.975] (-4414.969) (-4410.809) (-4411.746) -- 0:02:19 513500 -- [-4417.613] (-4414.989) (-4415.252) (-4410.184) * (-4411.503) (-4410.702) [-4411.305] (-4410.853) -- 0:02:19 514000 -- (-4412.563) (-4410.479) [-4411.633] (-4412.296) * (-4418.718) (-4411.057) [-4411.457] (-4410.971) -- 0:02:18 514500 -- (-4412.647) (-4413.256) [-4408.586] (-4412.091) * [-4410.276] (-4413.429) (-4410.778) (-4415.100) -- 0:02:18 515000 -- (-4415.438) (-4418.604) (-4413.695) [-4410.019] * (-4414.214) (-4416.760) (-4415.113) [-4408.336] -- 0:02:18 Average standard deviation of split frequencies: 0.000000 515500 -- (-4418.231) (-4424.677) [-4414.258] (-4410.744) * (-4416.023) (-4420.292) [-4414.061] (-4411.366) -- 0:02:18 516000 -- (-4415.364) (-4419.229) [-4413.322] (-4419.371) * (-4417.706) (-4413.873) (-4415.098) [-4406.745] -- 0:02:17 516500 -- (-4409.858) (-4416.362) (-4415.581) [-4417.013] * (-4414.653) (-4414.334) (-4418.963) [-4413.249] -- 0:02:18 517000 -- (-4416.701) (-4410.292) (-4409.978) [-4415.266] * (-4416.118) [-4409.721] (-4417.315) (-4419.236) -- 0:02:18 517500 -- [-4415.625] (-4416.041) (-4414.442) (-4414.477) * [-4412.038] (-4411.796) (-4417.423) (-4412.018) -- 0:02:17 518000 -- [-4414.421] (-4414.904) (-4413.959) (-4411.213) * [-4412.660] (-4414.873) (-4414.145) (-4416.363) -- 0:02:17 518500 -- (-4414.789) [-4413.905] (-4414.683) (-4414.229) * (-4413.916) (-4409.220) [-4423.106] (-4412.881) -- 0:02:17 519000 -- (-4411.564) (-4414.583) (-4412.020) [-4413.304] * (-4416.955) (-4411.416) [-4415.703] (-4411.614) -- 0:02:17 519500 -- (-4416.110) (-4410.598) (-4415.215) [-4414.199] * (-4420.773) (-4410.799) [-4412.681] (-4409.780) -- 0:02:16 520000 -- (-4416.015) (-4413.507) (-4412.978) [-4415.428] * (-4413.872) [-4415.914] (-4416.928) (-4413.824) -- 0:02:17 Average standard deviation of split frequencies: 0.000000 520500 -- (-4417.214) [-4417.897] (-4420.514) (-4415.870) * (-4416.241) (-4413.877) (-4417.420) [-4411.074] -- 0:02:17 521000 -- (-4423.739) [-4414.223] (-4412.701) (-4413.481) * [-4413.616] (-4409.443) (-4417.300) (-4415.569) -- 0:02:16 521500 -- (-4414.484) (-4412.201) [-4423.002] (-4413.667) * (-4411.077) (-4414.205) (-4414.155) [-4421.028] -- 0:02:16 522000 -- [-4411.932] (-4416.647) (-4422.445) (-4408.901) * (-4413.519) (-4416.651) [-4420.565] (-4417.242) -- 0:02:16 522500 -- (-4420.493) (-4410.001) [-4411.040] (-4417.609) * (-4416.018) [-4414.739] (-4415.784) (-4415.940) -- 0:02:16 523000 -- (-4422.358) (-4414.957) (-4411.852) [-4413.549] * (-4411.890) (-4412.868) [-4415.698] (-4416.246) -- 0:02:15 523500 -- (-4419.807) [-4418.625] (-4413.209) (-4412.742) * (-4409.796) (-4413.612) (-4414.943) [-4415.128] -- 0:02:16 524000 -- (-4418.156) (-4417.137) [-4409.118] (-4412.457) * (-4415.693) (-4417.329) (-4413.013) [-4410.353] -- 0:02:16 524500 -- (-4411.384) (-4421.743) [-4409.470] (-4418.501) * (-4416.370) (-4412.942) (-4414.515) [-4414.119] -- 0:02:15 525000 -- (-4416.648) [-4417.719] (-4412.506) (-4409.882) * [-4413.090] (-4416.323) (-4411.259) (-4412.979) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 525500 -- (-4412.497) (-4409.538) [-4414.275] (-4414.354) * (-4416.683) [-4415.506] (-4415.336) (-4414.290) -- 0:02:15 526000 -- (-4409.921) [-4409.590] (-4411.825) (-4415.140) * [-4412.582] (-4416.531) (-4417.469) (-4416.202) -- 0:02:15 526500 -- (-4423.021) (-4414.416) (-4414.916) [-4410.966] * (-4413.632) (-4422.221) [-4411.562] (-4412.208) -- 0:02:14 527000 -- (-4419.236) (-4412.694) [-4418.238] (-4420.375) * (-4416.358) (-4418.761) (-4417.186) [-4418.675] -- 0:02:15 527500 -- (-4417.910) [-4410.606] (-4411.170) (-4411.466) * (-4412.719) [-4412.789] (-4419.377) (-4411.676) -- 0:02:15 528000 -- (-4413.343) [-4416.132] (-4414.534) (-4411.812) * (-4416.002) (-4411.050) (-4417.012) [-4421.726] -- 0:02:14 528500 -- (-4412.798) (-4413.279) [-4410.612] (-4412.347) * (-4417.279) (-4415.347) (-4412.663) [-4419.810] -- 0:02:14 529000 -- [-4410.604] (-4417.012) (-4408.894) (-4420.539) * (-4411.140) [-4413.881] (-4411.128) (-4415.411) -- 0:02:14 529500 -- (-4418.772) [-4412.625] (-4411.846) (-4416.272) * (-4418.478) [-4419.347] (-4415.810) (-4418.655) -- 0:02:14 530000 -- (-4414.735) (-4412.912) (-4412.045) [-4412.932] * (-4415.307) (-4409.244) [-4410.921] (-4416.969) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 530500 -- (-4411.425) [-4413.300] (-4415.986) (-4412.707) * (-4416.374) (-4417.021) (-4417.123) [-4412.069] -- 0:02:14 531000 -- [-4410.200] (-4418.259) (-4421.180) (-4416.680) * [-4413.101] (-4410.626) (-4413.920) (-4411.903) -- 0:02:14 531500 -- [-4410.615] (-4421.478) (-4419.807) (-4415.150) * (-4412.417) (-4414.099) (-4415.630) [-4411.616] -- 0:02:13 532000 -- (-4411.940) (-4413.469) (-4413.907) [-4416.876] * (-4417.452) (-4412.895) [-4412.344] (-4411.951) -- 0:02:13 532500 -- (-4416.003) [-4408.815] (-4420.693) (-4412.786) * (-4413.020) (-4410.665) (-4413.047) [-4414.954] -- 0:02:13 533000 -- (-4412.031) [-4414.028] (-4414.594) (-4416.979) * (-4411.236) (-4411.161) [-4410.416] (-4431.049) -- 0:02:13 533500 -- (-4414.544) (-4411.532) (-4413.468) [-4418.518] * (-4415.158) (-4415.234) [-4411.631] (-4416.643) -- 0:02:12 534000 -- (-4417.821) [-4411.272] (-4418.593) (-4414.944) * [-4414.084] (-4415.743) (-4411.658) (-4415.336) -- 0:02:13 534500 -- (-4415.413) (-4412.600) [-4415.481] (-4412.965) * [-4411.291] (-4412.404) (-4411.634) (-4420.936) -- 0:02:13 535000 -- (-4417.328) (-4419.924) (-4411.860) [-4416.338] * [-4413.012] (-4414.869) (-4411.725) (-4414.572) -- 0:02:12 Average standard deviation of split frequencies: 0.000000 535500 -- (-4416.065) (-4415.857) [-4412.438] (-4416.492) * [-4416.094] (-4408.635) (-4418.554) (-4417.068) -- 0:02:12 536000 -- (-4411.564) (-4416.492) [-4413.391] (-4420.684) * (-4410.330) [-4413.005] (-4420.215) (-4411.793) -- 0:02:12 536500 -- (-4415.419) (-4414.778) [-4414.714] (-4413.559) * [-4411.954] (-4410.507) (-4412.750) (-4415.869) -- 0:02:12 537000 -- [-4415.921] (-4417.988) (-4415.799) (-4415.572) * [-4408.284] (-4415.559) (-4416.132) (-4412.728) -- 0:02:11 537500 -- (-4418.822) (-4417.014) [-4413.405] (-4413.174) * [-4413.639] (-4415.113) (-4412.320) (-4410.950) -- 0:02:12 538000 -- (-4411.353) (-4419.065) (-4412.439) [-4411.835] * [-4416.609] (-4414.712) (-4408.964) (-4421.254) -- 0:02:12 538500 -- (-4416.032) (-4420.518) (-4414.021) [-4419.178] * (-4423.659) [-4417.299] (-4413.571) (-4419.443) -- 0:02:11 539000 -- (-4411.412) [-4412.769] (-4412.374) (-4421.679) * (-4414.478) [-4408.229] (-4418.596) (-4415.877) -- 0:02:11 539500 -- (-4414.871) (-4418.580) (-4409.748) [-4415.467] * (-4413.810) (-4414.586) (-4415.174) [-4416.261] -- 0:02:11 540000 -- [-4413.551] (-4419.267) (-4409.876) (-4416.258) * (-4420.932) (-4411.598) [-4415.811] (-4414.637) -- 0:02:11 Average standard deviation of split frequencies: 0.000000 540500 -- [-4411.752] (-4423.270) (-4418.971) (-4415.399) * (-4417.671) (-4411.554) [-4413.526] (-4412.920) -- 0:02:10 541000 -- (-4414.093) [-4414.835] (-4411.309) (-4421.994) * [-4417.593] (-4409.595) (-4413.210) (-4417.874) -- 0:02:11 541500 -- (-4419.430) (-4424.147) [-4413.711] (-4413.951) * (-4422.757) [-4415.949] (-4412.046) (-4415.376) -- 0:02:11 542000 -- (-4413.794) (-4414.797) [-4412.966] (-4416.950) * (-4422.600) (-4419.873) [-4416.640] (-4418.769) -- 0:02:10 542500 -- (-4415.665) (-4425.228) (-4417.150) [-4411.980] * (-4417.052) (-4415.602) [-4411.954] (-4414.339) -- 0:02:10 543000 -- (-4413.680) (-4416.670) [-4414.883] (-4421.222) * (-4424.575) (-4415.163) [-4411.219] (-4412.695) -- 0:02:10 543500 -- (-4415.753) (-4414.572) [-4413.967] (-4413.578) * (-4429.760) (-4412.293) [-4414.698] (-4410.751) -- 0:02:10 544000 -- (-4411.254) [-4412.812] (-4417.921) (-4415.015) * (-4414.339) (-4414.263) (-4415.703) [-4412.699] -- 0:02:09 544500 -- (-4416.412) (-4410.242) (-4415.480) [-4410.961] * (-4418.966) (-4411.695) (-4414.183) [-4414.378] -- 0:02:10 545000 -- (-4414.412) [-4412.498] (-4413.332) (-4416.269) * [-4415.857] (-4414.975) (-4414.254) (-4414.030) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 545500 -- (-4409.523) (-4423.226) [-4413.889] (-4411.349) * (-4413.690) [-4413.247] (-4415.730) (-4418.475) -- 0:02:09 546000 -- (-4416.583) (-4424.037) [-4409.403] (-4410.896) * (-4414.051) [-4413.104] (-4419.034) (-4417.693) -- 0:02:09 546500 -- (-4414.704) [-4415.461] (-4411.346) (-4414.784) * (-4422.393) (-4410.981) (-4415.636) [-4415.017] -- 0:02:09 547000 -- (-4419.396) [-4415.423] (-4419.191) (-4413.444) * (-4415.401) (-4419.604) [-4412.172] (-4409.158) -- 0:02:09 547500 -- (-4414.314) [-4412.847] (-4413.303) (-4415.485) * (-4417.564) (-4421.902) [-4415.814] (-4421.214) -- 0:02:08 548000 -- (-4418.409) (-4416.044) (-4412.505) [-4411.265] * (-4418.635) [-4412.994] (-4415.190) (-4416.230) -- 0:02:09 548500 -- (-4416.843) (-4422.633) [-4411.609] (-4415.365) * (-4417.456) [-4412.463] (-4423.250) (-4411.377) -- 0:02:09 549000 -- (-4421.678) [-4414.961] (-4413.770) (-4414.197) * (-4418.319) (-4412.670) (-4413.656) [-4417.296] -- 0:02:08 549500 -- (-4418.850) [-4413.501] (-4413.197) (-4424.460) * [-4413.396] (-4413.359) (-4414.851) (-4416.796) -- 0:02:08 550000 -- (-4412.791) (-4412.369) [-4411.456] (-4422.813) * (-4412.628) (-4420.253) [-4414.045] (-4416.045) -- 0:02:08 Average standard deviation of split frequencies: 0.000000 550500 -- (-4410.886) (-4412.281) (-4420.962) [-4417.425] * [-4413.179] (-4419.141) (-4412.292) (-4421.345) -- 0:02:08 551000 -- [-4415.207] (-4419.586) (-4417.280) (-4411.713) * [-4418.165] (-4421.949) (-4413.938) (-4411.541) -- 0:02:07 551500 -- (-4412.274) (-4412.607) [-4417.406] (-4415.133) * (-4411.439) [-4413.315] (-4413.438) (-4411.732) -- 0:02:08 552000 -- (-4413.383) (-4419.360) (-4420.783) [-4412.952] * (-4415.633) (-4416.295) (-4414.026) [-4414.940] -- 0:02:08 552500 -- (-4411.811) [-4417.548] (-4413.211) (-4409.036) * [-4416.198] (-4418.175) (-4412.747) (-4412.233) -- 0:02:07 553000 -- (-4411.864) [-4412.213] (-4411.721) (-4421.052) * (-4413.292) (-4413.314) [-4416.730] (-4414.672) -- 0:02:07 553500 -- (-4418.473) [-4414.747] (-4411.547) (-4424.573) * (-4408.617) (-4410.427) (-4413.498) [-4413.269] -- 0:02:07 554000 -- (-4416.677) (-4417.456) (-4409.443) [-4415.871] * (-4412.709) [-4413.956] (-4415.557) (-4411.848) -- 0:02:07 554500 -- (-4413.093) (-4421.472) (-4414.258) [-4418.689] * [-4408.133] (-4418.989) (-4411.462) (-4410.693) -- 0:02:06 555000 -- [-4413.759] (-4419.427) (-4416.714) (-4417.248) * (-4416.635) (-4415.034) (-4412.292) [-4411.779] -- 0:02:07 Average standard deviation of split frequencies: 0.000000 555500 -- (-4410.984) (-4413.591) (-4418.102) [-4411.881] * [-4417.024] (-4413.531) (-4423.480) (-4417.445) -- 0:02:07 556000 -- [-4410.876] (-4412.283) (-4409.738) (-4411.297) * (-4417.471) [-4412.311] (-4415.548) (-4415.498) -- 0:02:06 556500 -- (-4418.975) [-4415.418] (-4410.853) (-4410.684) * (-4420.874) [-4413.263] (-4410.445) (-4414.203) -- 0:02:06 557000 -- (-4414.689) (-4418.799) (-4414.032) [-4415.749] * (-4414.511) [-4412.716] (-4410.391) (-4419.697) -- 0:02:06 557500 -- (-4412.528) (-4416.122) [-4416.836] (-4417.209) * (-4413.801) (-4415.020) [-4408.030] (-4413.757) -- 0:02:06 558000 -- (-4408.616) [-4412.189] (-4412.032) (-4418.214) * (-4418.311) (-4412.740) (-4413.775) [-4413.334] -- 0:02:05 558500 -- [-4411.463] (-4411.741) (-4415.984) (-4417.568) * (-4422.161) [-4416.421] (-4415.912) (-4409.864) -- 0:02:06 559000 -- (-4411.416) (-4415.986) [-4418.233] (-4413.494) * [-4414.892] (-4411.136) (-4413.106) (-4411.879) -- 0:02:06 559500 -- (-4417.206) [-4411.640] (-4420.678) (-4415.913) * (-4413.737) [-4413.118] (-4412.062) (-4412.928) -- 0:02:05 560000 -- [-4415.222] (-4413.830) (-4413.805) (-4413.492) * (-4409.617) [-4414.361] (-4414.265) (-4413.216) -- 0:02:05 Average standard deviation of split frequencies: 0.000000 560500 -- [-4412.878] (-4415.795) (-4411.503) (-4414.237) * (-4417.565) (-4413.631) [-4410.443] (-4415.070) -- 0:02:05 561000 -- (-4416.792) (-4415.260) (-4419.658) [-4412.632] * (-4411.112) (-4415.233) [-4414.582] (-4410.138) -- 0:02:05 561500 -- (-4413.788) (-4418.481) [-4419.907] (-4410.186) * (-4411.463) (-4413.726) (-4415.920) [-4412.624] -- 0:02:04 562000 -- (-4415.212) [-4416.416] (-4419.069) (-4412.266) * (-4415.065) (-4412.238) (-4415.041) [-4412.393] -- 0:02:05 562500 -- (-4416.917) (-4416.685) (-4419.581) [-4412.294] * (-4416.734) (-4418.030) [-4413.112] (-4420.635) -- 0:02:05 563000 -- (-4412.413) [-4412.533] (-4415.429) (-4418.028) * (-4415.185) (-4422.019) [-4415.485] (-4415.083) -- 0:02:04 563500 -- (-4417.204) [-4415.012] (-4414.194) (-4413.246) * (-4411.721) (-4417.614) (-4422.640) [-4414.793] -- 0:02:04 564000 -- [-4411.532] (-4412.053) (-4412.188) (-4413.373) * (-4413.716) (-4414.853) (-4417.598) [-4415.115] -- 0:02:04 564500 -- [-4411.708] (-4425.238) (-4409.683) (-4413.660) * (-4417.759) (-4413.069) [-4411.097] (-4418.895) -- 0:02:04 565000 -- (-4410.824) [-4417.805] (-4411.528) (-4416.742) * (-4411.927) (-4413.722) (-4411.587) [-4414.892] -- 0:02:03 Average standard deviation of split frequencies: 0.000000 565500 -- (-4412.505) (-4418.726) (-4410.756) [-4416.517] * (-4412.128) [-4417.620] (-4416.390) (-4414.651) -- 0:02:04 566000 -- [-4416.391] (-4415.778) (-4408.855) (-4415.036) * (-4412.502) (-4411.684) [-4411.952] (-4420.574) -- 0:02:04 566500 -- (-4415.801) [-4413.618] (-4413.868) (-4411.443) * (-4415.545) (-4414.625) [-4411.563] (-4420.492) -- 0:02:03 567000 -- (-4414.023) [-4413.285] (-4414.073) (-4423.990) * (-4415.646) (-4415.925) [-4409.228] (-4412.338) -- 0:02:03 567500 -- [-4411.137] (-4415.048) (-4415.465) (-4416.410) * (-4417.832) (-4414.524) [-4411.499] (-4416.198) -- 0:02:03 568000 -- [-4412.014] (-4412.392) (-4417.496) (-4414.876) * (-4420.055) (-4417.191) [-4417.065] (-4413.971) -- 0:02:03 568500 -- (-4413.599) (-4414.964) (-4413.984) [-4411.147] * (-4411.939) (-4421.888) [-4410.498] (-4413.895) -- 0:02:02 569000 -- (-4414.095) [-4414.490] (-4425.171) (-4416.547) * (-4416.596) (-4426.492) (-4413.328) [-4406.648] -- 0:02:03 569500 -- (-4420.310) (-4414.039) (-4418.459) [-4412.711] * [-4414.966] (-4413.527) (-4417.464) (-4411.757) -- 0:02:03 570000 -- [-4413.364] (-4417.771) (-4418.386) (-4413.531) * [-4413.972] (-4419.373) (-4415.497) (-4415.104) -- 0:02:02 Average standard deviation of split frequencies: 0.000000 570500 -- [-4409.358] (-4415.403) (-4415.833) (-4413.987) * (-4409.375) (-4416.369) (-4423.968) [-4414.127] -- 0:02:02 571000 -- (-4412.832) [-4411.818] (-4413.438) (-4421.767) * (-4414.735) (-4417.711) [-4418.591] (-4414.185) -- 0:02:02 571500 -- (-4417.300) (-4411.015) (-4418.808) [-4416.199] * [-4411.535] (-4415.589) (-4413.483) (-4413.060) -- 0:02:02 572000 -- [-4413.941] (-4411.441) (-4422.525) (-4415.120) * (-4418.653) (-4418.695) [-4412.949] (-4415.368) -- 0:02:01 572500 -- (-4414.042) (-4415.052) [-4415.897] (-4421.967) * (-4421.922) [-4413.543] (-4418.093) (-4413.293) -- 0:02:02 573000 -- (-4419.712) (-4410.950) [-4413.383] (-4412.822) * (-4417.647) (-4409.954) [-4418.199] (-4419.104) -- 0:02:02 573500 -- (-4410.116) (-4416.423) (-4418.469) [-4411.952] * (-4424.548) (-4413.315) (-4416.649) [-4409.868] -- 0:02:01 574000 -- [-4416.139] (-4412.757) (-4412.237) (-4413.025) * (-4417.944) (-4414.483) (-4415.332) [-4416.712] -- 0:02:01 574500 -- (-4418.277) (-4415.325) (-4415.615) [-4409.672] * (-4420.284) (-4411.392) (-4417.968) [-4418.732] -- 0:02:01 575000 -- (-4418.717) (-4410.508) (-4412.772) [-4418.632] * (-4416.707) [-4412.954] (-4421.495) (-4417.601) -- 0:02:01 Average standard deviation of split frequencies: 0.000000 575500 -- (-4418.245) [-4413.103] (-4416.671) (-4411.269) * (-4416.439) (-4415.522) (-4423.762) [-4414.750] -- 0:02:00 576000 -- (-4417.109) (-4417.572) (-4419.469) [-4419.550] * (-4415.550) (-4415.745) (-4415.669) [-4410.488] -- 0:02:01 576500 -- (-4413.254) (-4410.707) [-4411.026] (-4414.614) * (-4415.828) (-4411.623) [-4411.278] (-4414.699) -- 0:02:01 577000 -- (-4415.886) (-4413.314) [-4412.456] (-4421.514) * (-4410.871) (-4415.979) [-4414.898] (-4419.434) -- 0:02:00 577500 -- (-4417.016) (-4411.003) [-4415.023] (-4420.498) * [-4414.147] (-4414.709) (-4416.686) (-4413.082) -- 0:02:00 578000 -- (-4413.534) [-4413.882] (-4410.177) (-4416.397) * (-4420.222) (-4415.911) (-4415.767) [-4414.539] -- 0:02:00 578500 -- (-4422.040) (-4422.778) [-4413.994] (-4415.234) * (-4419.826) (-4418.088) [-4414.751] (-4416.510) -- 0:02:00 579000 -- (-4417.119) (-4414.120) [-4411.609] (-4415.953) * (-4415.564) [-4413.067] (-4413.763) (-4416.488) -- 0:01:59 579500 -- (-4422.006) (-4414.945) (-4413.829) [-4414.072] * (-4412.066) [-4412.423] (-4423.121) (-4416.977) -- 0:02:00 580000 -- (-4416.253) [-4410.059] (-4420.201) (-4415.311) * (-4417.070) (-4410.182) [-4422.260] (-4414.828) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 580500 -- (-4415.851) (-4414.122) [-4410.865] (-4414.836) * (-4418.993) (-4419.688) [-4414.492] (-4417.891) -- 0:01:59 581000 -- (-4416.159) (-4426.342) (-4417.307) [-4410.827] * (-4414.138) (-4419.323) [-4420.788] (-4419.242) -- 0:01:59 581500 -- [-4414.370] (-4429.155) (-4415.622) (-4410.348) * [-4415.326] (-4413.819) (-4413.922) (-4416.445) -- 0:01:59 582000 -- (-4415.366) (-4422.981) [-4411.194] (-4410.300) * [-4410.931] (-4412.534) (-4410.914) (-4417.800) -- 0:01:59 582500 -- (-4420.453) [-4418.439] (-4415.525) (-4415.591) * (-4415.269) [-4420.364] (-4414.851) (-4414.900) -- 0:01:58 583000 -- (-4413.064) (-4413.470) [-4416.985] (-4412.794) * [-4409.318] (-4416.120) (-4418.296) (-4414.623) -- 0:01:59 583500 -- (-4416.325) (-4415.946) [-4412.393] (-4413.797) * (-4419.477) [-4414.783] (-4415.732) (-4413.662) -- 0:01:59 584000 -- (-4414.989) [-4411.134] (-4415.095) (-4416.312) * (-4415.922) (-4408.993) (-4413.171) [-4415.098] -- 0:01:58 584500 -- [-4421.002] (-4409.983) (-4416.318) (-4420.900) * (-4414.564) [-4413.347] (-4415.808) (-4410.938) -- 0:01:58 585000 -- [-4418.493] (-4418.228) (-4421.170) (-4417.231) * (-4417.004) (-4413.789) (-4414.722) [-4415.885] -- 0:01:58 Average standard deviation of split frequencies: 0.000000 585500 -- (-4414.652) (-4418.312) (-4419.611) [-4411.371] * [-4412.349] (-4416.334) (-4413.601) (-4414.726) -- 0:01:58 586000 -- (-4416.649) (-4422.254) (-4416.245) [-4415.089] * (-4414.170) (-4412.992) [-4418.083] (-4408.393) -- 0:01:57 586500 -- [-4419.661] (-4415.732) (-4413.473) (-4412.529) * [-4412.739] (-4413.507) (-4414.427) (-4414.456) -- 0:01:58 587000 -- (-4412.283) (-4409.599) [-4411.466] (-4415.334) * (-4410.885) (-4416.688) [-4414.704] (-4412.062) -- 0:01:58 587500 -- (-4415.220) [-4416.739] (-4413.800) (-4410.248) * (-4418.635) (-4413.628) [-4413.186] (-4414.530) -- 0:01:57 588000 -- [-4419.025] (-4411.286) (-4412.708) (-4409.672) * (-4416.092) (-4414.886) [-4410.221] (-4410.351) -- 0:01:57 588500 -- (-4415.045) [-4409.274] (-4409.519) (-4418.389) * [-4410.668] (-4413.878) (-4415.773) (-4416.123) -- 0:01:57 589000 -- (-4419.238) (-4411.864) (-4412.743) [-4415.669] * (-4420.571) (-4417.579) [-4413.224] (-4411.926) -- 0:01:57 589500 -- (-4418.561) (-4411.976) [-4410.398] (-4420.231) * (-4408.563) [-4416.091] (-4419.222) (-4418.132) -- 0:01:56 590000 -- (-4413.327) (-4412.837) [-4408.806] (-4419.768) * [-4412.397] (-4417.549) (-4414.457) (-4411.460) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 590500 -- (-4411.750) (-4414.421) [-4411.737] (-4420.003) * [-4415.161] (-4410.346) (-4413.909) (-4411.888) -- 0:01:57 591000 -- (-4417.904) (-4415.138) [-4420.995] (-4413.000) * (-4412.270) [-4414.123] (-4419.668) (-4417.265) -- 0:01:56 591500 -- [-4419.988] (-4413.274) (-4420.209) (-4414.903) * (-4410.237) (-4409.483) [-4412.221] (-4412.236) -- 0:01:56 592000 -- (-4416.789) (-4416.572) [-4411.990] (-4413.238) * [-4415.326] (-4414.093) (-4413.396) (-4411.356) -- 0:01:56 592500 -- (-4414.121) [-4413.972] (-4410.754) (-4417.262) * (-4411.802) (-4413.570) (-4414.680) [-4412.936] -- 0:01:56 593000 -- [-4409.749] (-4419.279) (-4414.122) (-4419.391) * (-4416.490) (-4417.566) [-4410.469] (-4415.137) -- 0:01:55 593500 -- (-4418.466) (-4421.184) [-4413.667] (-4416.210) * (-4412.376) [-4416.136] (-4410.875) (-4413.954) -- 0:01:56 594000 -- [-4418.637] (-4413.062) (-4415.243) (-4420.594) * (-4416.505) (-4413.415) (-4412.272) [-4412.808] -- 0:01:56 594500 -- (-4413.145) (-4414.207) (-4415.962) [-4413.817] * [-4416.643] (-4415.342) (-4414.642) (-4412.257) -- 0:01:55 595000 -- [-4411.705] (-4414.166) (-4419.572) (-4413.786) * (-4417.528) [-4412.834] (-4413.230) (-4412.092) -- 0:01:55 Average standard deviation of split frequencies: 0.000000 595500 -- [-4410.096] (-4416.506) (-4411.590) (-4418.029) * (-4422.328) [-4412.412] (-4414.431) (-4410.382) -- 0:01:55 596000 -- (-4415.968) (-4417.227) [-4414.088] (-4416.018) * (-4414.382) [-4410.941] (-4410.248) (-4412.586) -- 0:01:55 596500 -- (-4413.251) (-4422.659) (-4417.378) [-4416.080] * (-4420.078) (-4412.599) [-4408.977] (-4410.959) -- 0:01:54 597000 -- (-4420.093) [-4414.726] (-4416.233) (-4418.099) * (-4415.175) [-4409.901] (-4411.770) (-4417.289) -- 0:01:55 597500 -- (-4425.665) (-4411.202) [-4415.268] (-4424.246) * (-4411.930) (-4415.955) (-4421.581) [-4411.226] -- 0:01:55 598000 -- (-4423.431) (-4411.800) (-4414.320) [-4413.377] * [-4418.923] (-4416.531) (-4415.966) (-4416.844) -- 0:01:54 598500 -- (-4418.080) [-4413.198] (-4413.038) (-4415.958) * (-4420.993) (-4416.125) [-4411.665] (-4411.803) -- 0:01:54 599000 -- (-4417.382) (-4414.564) (-4416.260) [-4412.284] * [-4411.850] (-4417.663) (-4421.202) (-4412.076) -- 0:01:54 599500 -- (-4412.730) (-4414.748) (-4416.595) [-4413.237] * (-4417.655) (-4413.656) [-4415.124] (-4414.295) -- 0:01:54 600000 -- (-4411.334) [-4412.753] (-4415.117) (-4416.436) * (-4411.593) [-4414.144] (-4414.243) (-4413.978) -- 0:01:54 Average standard deviation of split frequencies: 0.000000 600500 -- (-4411.998) [-4414.202] (-4414.770) (-4416.371) * (-4412.472) [-4419.434] (-4422.372) (-4413.591) -- 0:01:54 601000 -- (-4414.948) [-4412.978] (-4418.230) (-4418.087) * (-4416.657) (-4412.341) [-4412.167] (-4417.581) -- 0:01:54 601500 -- (-4415.572) (-4411.918) [-4409.417] (-4413.226) * (-4411.870) [-4410.931] (-4412.333) (-4412.563) -- 0:01:53 602000 -- (-4417.653) [-4409.361] (-4411.750) (-4409.226) * (-4414.504) (-4416.256) (-4415.698) [-4412.512] -- 0:01:53 602500 -- (-4415.459) (-4411.785) [-4412.456] (-4413.102) * (-4415.083) (-4422.417) (-4421.597) [-4409.042] -- 0:01:53 603000 -- (-4414.663) (-4413.990) (-4421.947) [-4414.547] * (-4420.142) (-4413.187) (-4419.268) [-4412.299] -- 0:01:53 603500 -- (-4420.214) (-4412.128) (-4413.688) [-4409.461] * (-4417.247) [-4411.028] (-4413.401) (-4411.349) -- 0:01:53 604000 -- (-4417.697) [-4411.310] (-4414.869) (-4412.942) * (-4415.786) [-4415.518] (-4415.228) (-4415.133) -- 0:01:53 604500 -- (-4413.269) [-4412.435] (-4411.336) (-4414.430) * [-4416.153] (-4415.217) (-4412.276) (-4414.661) -- 0:01:53 605000 -- (-4412.446) (-4417.023) [-4411.257] (-4415.716) * (-4415.467) [-4412.894] (-4409.150) (-4409.372) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 605500 -- (-4414.927) [-4413.214] (-4414.194) (-4413.339) * (-4417.974) [-4409.421] (-4410.644) (-4411.889) -- 0:01:52 606000 -- (-4414.610) (-4413.664) [-4414.009] (-4421.915) * (-4415.939) (-4413.150) (-4416.599) [-4415.570] -- 0:01:52 606500 -- (-4414.926) (-4420.883) [-4412.313] (-4411.550) * (-4417.546) (-4413.928) [-4416.910] (-4422.566) -- 0:01:52 607000 -- (-4415.451) (-4416.086) [-4414.997] (-4417.108) * (-4413.486) (-4411.317) (-4412.730) [-4413.887] -- 0:01:52 607500 -- [-4413.903] (-4410.861) (-4415.418) (-4411.017) * (-4413.401) (-4413.390) (-4412.247) [-4412.114] -- 0:01:52 608000 -- (-4414.464) (-4411.967) (-4412.479) [-4415.426] * [-4411.504] (-4411.141) (-4414.029) (-4419.266) -- 0:01:52 608500 -- (-4412.086) (-4411.656) (-4411.092) [-4409.716] * (-4417.282) [-4416.715] (-4415.010) (-4415.541) -- 0:01:51 609000 -- (-4420.560) (-4409.279) (-4410.101) [-4410.744] * (-4417.033) (-4415.923) [-4414.584] (-4416.950) -- 0:01:51 609500 -- (-4411.749) (-4413.953) [-4414.783] (-4415.409) * (-4415.422) (-4417.463) (-4413.407) [-4413.529] -- 0:01:51 610000 -- [-4414.245] (-4416.086) (-4414.518) (-4415.677) * [-4414.470] (-4423.899) (-4412.096) (-4413.429) -- 0:01:51 Average standard deviation of split frequencies: 0.000000 610500 -- (-4413.848) (-4419.682) (-4413.924) [-4413.611] * (-4410.794) (-4415.136) [-4413.818] (-4410.904) -- 0:01:51 611000 -- (-4411.974) [-4415.453] (-4416.983) (-4410.689) * [-4411.712] (-4410.731) (-4410.502) (-4411.905) -- 0:01:51 611500 -- (-4411.842) [-4410.111] (-4415.528) (-4414.741) * (-4413.053) (-4418.143) [-4415.279] (-4410.165) -- 0:01:51 612000 -- [-4409.788] (-4413.059) (-4412.190) (-4419.525) * (-4415.405) (-4421.847) (-4414.393) [-4414.435] -- 0:01:50 612500 -- (-4410.614) [-4412.666] (-4412.841) (-4412.099) * [-4421.156] (-4420.452) (-4415.824) (-4411.333) -- 0:01:50 613000 -- (-4410.056) (-4418.655) [-4409.071] (-4415.288) * (-4418.142) (-4418.649) [-4416.947] (-4410.734) -- 0:01:50 613500 -- (-4413.241) (-4412.528) (-4419.388) [-4414.059] * (-4413.081) (-4410.584) [-4413.228] (-4416.474) -- 0:01:50 614000 -- (-4411.577) (-4410.535) (-4417.246) [-4414.730] * (-4418.185) [-4409.624] (-4413.441) (-4414.848) -- 0:01:50 614500 -- (-4410.889) [-4415.152] (-4411.322) (-4419.340) * (-4413.332) (-4414.739) (-4417.437) [-4417.434] -- 0:01:50 615000 -- (-4413.566) [-4419.553] (-4414.795) (-4419.353) * (-4414.450) (-4416.485) [-4411.585] (-4414.954) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 615500 -- (-4409.957) (-4416.095) [-4411.294] (-4414.549) * (-4412.048) (-4419.276) [-4412.575] (-4416.300) -- 0:01:49 616000 -- [-4414.606] (-4410.575) (-4414.973) (-4410.222) * (-4412.585) [-4415.840] (-4423.085) (-4415.281) -- 0:01:49 616500 -- [-4409.434] (-4409.168) (-4415.227) (-4413.478) * (-4412.172) (-4412.483) [-4416.671] (-4421.056) -- 0:01:49 617000 -- (-4414.322) (-4410.217) [-4410.864] (-4414.522) * (-4417.906) [-4414.185] (-4419.959) (-4416.101) -- 0:01:49 617500 -- (-4419.701) [-4411.665] (-4415.171) (-4413.416) * (-4416.280) (-4415.245) [-4418.508] (-4412.318) -- 0:01:49 618000 -- (-4410.124) (-4418.127) [-4422.411] (-4413.757) * [-4414.245] (-4420.462) (-4424.805) (-4412.515) -- 0:01:49 618500 -- (-4413.541) (-4411.829) (-4414.200) [-4416.050] * (-4417.181) (-4415.549) (-4418.902) [-4408.845] -- 0:01:49 619000 -- (-4414.052) (-4423.901) [-4409.100] (-4416.916) * (-4413.486) [-4407.509] (-4413.152) (-4415.230) -- 0:01:48 619500 -- [-4414.293] (-4413.924) (-4412.092) (-4412.736) * [-4412.807] (-4422.427) (-4412.997) (-4410.247) -- 0:01:48 620000 -- (-4414.646) (-4414.277) (-4415.103) [-4411.187] * (-4416.948) (-4413.159) [-4416.322] (-4423.728) -- 0:01:48 Average standard deviation of split frequencies: 0.000000 620500 -- (-4416.561) (-4415.842) (-4416.282) [-4413.200] * (-4415.419) (-4413.780) [-4412.511] (-4411.305) -- 0:01:48 621000 -- (-4420.903) (-4410.430) [-4415.363] (-4413.487) * (-4410.920) (-4411.064) [-4414.145] (-4412.044) -- 0:01:48 621500 -- (-4420.474) (-4420.246) (-4416.391) [-4408.840] * (-4419.704) (-4413.644) [-4409.790] (-4412.596) -- 0:01:48 622000 -- (-4420.383) [-4415.607] (-4414.085) (-4414.414) * (-4413.238) [-4412.990] (-4415.398) (-4412.809) -- 0:01:48 622500 -- (-4415.635) [-4414.527] (-4417.492) (-4418.111) * [-4411.043] (-4414.351) (-4410.690) (-4419.449) -- 0:01:47 623000 -- (-4412.519) (-4410.033) [-4409.316] (-4413.477) * (-4413.315) (-4410.528) (-4419