--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Sat Nov 12 08:36:38 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/2/ab-PE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/ab-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/ab-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/2/ab-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -7277.52         -7290.47
2      -7277.07         -7290.72
--------------------------------------
TOTAL    -7277.27         -7290.60
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/ab-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/ab-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/ab-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.532758    0.001181    0.463377    0.598750    0.532077   1196.53   1233.25    1.000
r(A<->C){all}   0.073228    0.000123    0.051165    0.094469    0.072893    968.77   1049.41    1.000
r(A<->G){all}   0.211914    0.000462    0.170692    0.254200    0.210971    746.19    979.55    1.000
r(A<->T){all}   0.118989    0.000506    0.076898    0.162405    0.118465    892.80    957.86    1.001
r(C<->G){all}   0.047481    0.000058    0.032320    0.061929    0.047159   1174.94   1187.66    1.000
r(C<->T){all}   0.476353    0.000916    0.419068    0.535887    0.476353    876.45    925.01    1.000
r(G<->T){all}   0.072035    0.000227    0.044975    0.102672    0.071493    932.33    950.14    1.000
pi(A){all}      0.248076    0.000056    0.233201    0.261979    0.247980    677.25    931.05    1.001
pi(C){all}      0.343816    0.000073    0.326095    0.359384    0.343842   1237.94   1244.08    1.000
pi(G){all}      0.275940    0.000064    0.259903    0.291284    0.275867    868.10    972.08    1.000
pi(T){all}      0.132168    0.000033    0.120368    0.142588    0.132100   1027.95   1042.19    1.001
alpha{1,2}      0.108350    0.000459    0.068150    0.147756    0.109393    937.32    990.08    1.000
alpha{3}        3.741045    0.963285    2.028080    5.655684    3.604526   1426.31   1463.65    1.000
pinvar{all}     0.340600    0.002040    0.252346    0.426739    0.343699    985.38   1112.29    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-6414.691035
Model 2: PositiveSelection	-6414.691035
Model 0: one-ratio	-6490.500329
Model 3: discrete	-6412.835836
Model 7: beta	-6413.194539
Model 8: beta&w>1	-6413.194585


Model 0 vs 1	151.61858800000118

Model 2 vs 1	0.0

Model 8 vs 7	9.200000022246968E-5
>C1
MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
ATGSALSPATPPPSLNLSHQQQQHQQHYALKWNDFQSSILSSFRHLRDEE
DFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCD
DVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKALS
AALSHNSSNNNNNNSSSNNSLSNNNNNNNNNAESSNHNKISSYLSPNQTS
AACNNSSNSNSNNHSSSHNNSSSNNISGSLNSSLNSPFSAPQIPPPVTAS
SAAAAAAAAASLTAAVAAAAAATAASAGSSSSAASGQTSGTPAIQELKAS
SAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFR
AQHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQ
ALENSNGQQANPKHELGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQR
SHSFPNAFLGLQGIPGLLPGPSGINSDFGTFLNAKSGIKQEVLEPETEED
AVQQQRPHEAHAADRRPAACKLAKLMQQQEQQQRQLFDQRRSHHQPHHHH
QPHHHRHHHHHQQRINNNNNNTKKNRSANSSPTPSARSWNDSEEDQDMDC
SSGNQQQHGQQQQQQHNSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQ
TLLMKQEQHQQQHQQQHQQQQHQQQQQQYLDELQQSHQQQLTANLFMART
IALSRSRDFPELFQNTIAAAAANATAASASPGNNASGPGQVVATGPGPGP
GSAAPVAVGSGSGASAGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSP
VCPVIECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKo
oooooooooooooooooooo
>C2
MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
ATGSALSPATPPPSLNLSHQQQQHQQHYALKWNDFQSSILSSFRHLRDEE
DFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCD
DVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKALS
AALSHNSSNNNNNNNSSSNSLSNNNNNNNNNAESSNHNKISSYLSPNQTS
AACNNSSNSNSNNHSSSHNNSSSNNISGSLNSSLNSPFSAPQIPPPVTAS
SAAAAAAAAASLTAAVAAAAAATAASAGSSSSASGQTSGTPAIQELKASS
AASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRA
QHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNMELRESLLGQA
LENSNGQQANPKHELGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRS
HSFPNAFLGLQGIPGLLPGPSGINSDFGTFLNAKSGIKQEVLEPETEEDA
VQQQRPHEAHAADRRPAACKLAKLMQQQEQQQRQLFDQRRSHHQPHHHHQ
PHHHRHHHHHQQRINNNNNNTKKNRSANSSPTPSARSWNDSEEDQDMDCS
SGNQQQHAQQQQQQHNSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQT
LLMKQEQHQQQHQQQHQQQHQQQQQQQQQYLDELQQSHQQQLTANLFMAR
TIALSRSRDFPELFQNTIAAAAANATAASASPGNNASGPGQVVATGPGPG
PGSAEPVAMGSGSGAAAGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDS
PVCPVIECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFK
oooooooooooooooooooo
>C3
MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
ATGSALSPATPPPSLNLSHQQQQHQQHYALKWNDFQSSILSSFRHLRDEE
DFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCD
DVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKALS
AALSHNSSSNNNNSNSNSLSNNNNNNNNNAESSNHNKISSYLSPNQTSAA
CNNSSNSNSNNHSSSHNNSSSNNISGSLNSSLNSPFSAPQIPPPVTASSA
AAAAAAAASLTAAVAAAAAATAASAGSSSSASGQTSGTPAIQELKASSAA
SPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQH
GISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNMELRESLLGQALE
NSNGQQANPKHELGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHS
FPNAFLGLQGIPGLLPGPSGINSDFGTFLNAKSGIKQEVLEPETEEDAVQ
QQRPHEDHDRRPVACKLAKLMQQQEQQQRQLFDQRRSHHQPHHHHQPHHH
RHHHHHQQRINNNNNNTKKNRSANSSPTPSARSWNDSEEDQDMDCSSGNQ
QQHAQQQQQQHNSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQTLLMK
QEQHQQQHQQQHQQQHQQQQQQQQQYLDELQQSHQQQLTANLFMARTIAL
SRSRDFPELFQNTIAAAAANATAASASPGNNASGPGQVVATGPGPGPGSA
APVAVGSGSGAAAGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCP
VIECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooo
oooooooooooooooooooo
>C4
MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
ATGSALSPATPPPSLNLSHQQQQQQQQHYALKWNDFQSSILSSFRHLRDE
EDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRC
DDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKAL
SAALSHNSSNNNNNNNNNKSSSNNSLSNNNNNNNNNNADSSNHNKISSYL
PPNQTSATCNNSNNSNHSSSNNNSSSNNNISGSLNSSLNSPFSAPQIPPP
VTASSAAAAAAAAASLTAAVAAAAAATAASVGSSGSASGQTSGTPAIQEL
KASSAASPVRNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSAD
LFRAQHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNMELRESL
LGQALENSNGQQANPKHELGQSAGEDSNSSDTEPSDRGDGQHDGTLDGID
NQRSHSFPNAFLGLQGIPGLLPGPSGLNSDFGTFLNAKSGIKQEVLEPET
EEDAVQQQQQPQPHEAHAADRRPAACKLAKLMQQQEQQQRQLFDQRRSHH
QPHHHHQPHHRHQHHHHHHHHRINNNNNNTKKNRSANSSPTPSARSWNDS
EDDQDMDCSSGNQQQSAQQQQQQQQQHNSNEDEDDRSSSASSAISLTMKR
TRQDSESTLYQTLLMKQEQHQQQHQQQQQQHQQQQQQQQYLDELQQSHQQ
QLTANLFMARTIALSRSRDFPELFQNTIAAAAANATAASASPGNNASGPG
QQVVASGPGPGPGSAAPVAVGGGSGAAAGNSNYMLPCPLCETPLEQRVFR
QHLDRHYPRDSPVCPVIECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSS
GGPFAGGPDFKooooooooo
>C5
MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
ATGAALSPATPPPSLNLSHQQQQQQHQQHYALKWNDFQSSILSSFRHLRD
EEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRDVR
CDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKA
LSAALSHSSTSNNNNSSSGGSSSNSLSNNNNNNNNNNAESSNHNKISSYL
PPNQASATCNNSSSNSHSSSSNNNSHSSSSSSNNISGSLNSSLNSPFSAP
QIPPPVTASSAAAAAAAAASLTAAVAAAAAATAASAGSSSSASGQTSGTP
AIQELKASSAASPVRNPNPPNPSKASSSNHWDMGEMEGSRKSHLTPPPQK
RIKSADLFRAQHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNL
ELRESLLGQALENSNGQQANQKHELGQSAGEDSNSSDTEPSDRGDGQHDG
TLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGLNSDFGTFLNAKSGIKQE
VLEPEAEEDAVQQQRPHEAHAADRRPAASKLAKLMQQQEQQQRQLFDQRR
SHHQPHHHHQPHHRHQHHHHHHRLNNNNNNTKRNRSANSSPTPSARSWND
SEEDQDMDCGSGNQQQNAQQQQQQHNSNEDEDDRSSSASSAISLTMKRTR
QDSESTLYQTLLMKQEQHQQQHQQQQQQQQHQQQQQQYLDELQQSHQQQL
TANLFMARTIALSRSRDFPELFQSTIAAAAANATAASASPGHNASGPGQV
VAPGPGPGPGPGPGSAAPVAVGSGSGAAAGNSNYMLPCPLCETPLEQRVF
RQHLDRHYPRDSPVCPVIECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRS
SGGPFAGGPDFKoooooooo
>C6
MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLSMA
ATGSALSPATPPPSSLNLSHSSQQHSQHQQHYALKWNDFQSSILSSFRHL
RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
KALSAALSHNNSSSNNNNNSSSNSLSNNNNNNNNIAESSNHNKISSYLQQ
PTQTSATSNNSSNNHSSSSNNSSSNNISGSLNSSLNSPFSAPQVPPSVTA
SSAAAAAAAAAAASLTAAVAAAAVAATSSSSSSNAGGQSGGNSSGTPAIQ
ELKASSAASPVRNPNSNPNQNPNPSKASSSNHWDMGEMEGSRKSHLTPPP
QKRIKSADLFRAQHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRER
NMELRESLLGQALENSNGQQANQKHDLGQSAGEDSNSSDTEPSDRGDGQH
DGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGINSDFGTFLNAKSGIK
QEVMEPEVEEDAAQLQQQLPHEAHAADRRPAACKLAKLMQQQQQQRQLFD
QRRSHHQAHHHHQPHHRHHHNHHHRINNNNNNNNNTKKNRSANSSPTPSA
RSWNDSEEDQDMDCNHSQQQQQQSQQQQQQQQHNSNEDEDDRSSSASSAI
SLTMKRTRQDSESTLYQTLLMKQEQHQQQHQQQQQQHQQQQHQQQQQYLD
ELQQSHQQQLTANLFMARTIALSRSRDFPELFQNTIAAAAANATAASVSP
GNNGGGAVKVAGPGPPGNAAPVGTVGGSGAAGSGATGSGSNYMLPCPLCE
TPLEQRVFRQHLDRHYPRDSPVCPVIECGRRFAHPNSVRNHMRIKHTLQW
AKMKAMRSSGGPFAGGPDFK
>C7
MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLSMA
ATGSALSPATPPPSLNLSHQQQHSQHQQHYALKWNDFQSSILSSFRHLRD
EEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRDVR
CDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYSKA
LSAALSQNNSGSNNNNNNSSNSLTNNNNNNIAESSNHNKISSYLPPTQAS
AASNNNGNSSSSNNHSSNNSSSNNISGSQNSSLNSPFSAPQVPPSVTASS
AAAAAAAAASLTAAVAAAAAATASSSSASGQSGGASGTPAIQELKASSAA
SPVRNPNPNPNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRA
QHGISPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQA
LENSNGQQANQKHDLGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRS
HSFPNAFLGLQGIPGLLPGPSGLNSDFGNFLNAKSGIKQEVMEPETEEDV
VQQQPHEAHAADRRPAASKLAKLMQQQQQRQLFDQRRSHHQPHHHHQPHQ
RHHHHNHHRINNNNNTKKNRSANSSPTPSARSWNDSEEDQDMDCSSGNHN
QQQQAQQQHNSNEDEDDRSSSASSAISLTVKRTRQDSESTLYQTLLMKQD
QHQQQHQHQQQQQHQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDF
PELFQNTIAAAAANATAASSSPGNNGSGAVKVAGPGPGPGPLPGSAAPVA
VGSGSGAATGAGSSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooooo
oooooooooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=970 

C1              MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
C2              MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
C3              MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
C4              MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
C5              MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMA
C6              MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLSMA
C7              MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLSMA
                ***********************************************:**

C1              ATGSALSPATPPPS-LNLSHQQ---QQHQQHYALKWNDFQSSILSSFRHL
C2              ATGSALSPATPPPS-LNLSHQQ---QQHQQHYALKWNDFQSSILSSFRHL
C3              ATGSALSPATPPPS-LNLSHQQ---QQHQQHYALKWNDFQSSILSSFRHL
C4              ATGSALSPATPPPS-LNLSHQQQ-QQQ-QQHYALKWNDFQSSILSSFRHL
C5              ATGAALSPATPPPS-LNLSHQQQ-QQQHQQHYALKWNDFQSSILSSFRHL
C6              ATGSALSPATPPPSSLNLSHSSQQHSQHQQHYALKWNDFQSSILSSFRHL
C7              ATGSALSPATPPPS-LNLSHQQQ-HSQHQQHYALKWNDFQSSILSSFRHL
                ***:********** *****..   .* **********************

C1              RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
C2              RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
C3              RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
C4              RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
C5              RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
C6              RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
C7              RDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKANPCEHPIVILRD
                **************************************************

C1              VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
C2              VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
C3              VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
C4              VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
C5              VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
C6              VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
C7              VRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLADVNGGYPYS
                **************************************************

C1              KALSAALSHNSSNNNNN----NSSSNNSLSNNNNNNNNN-AESSNHNKIS
C2              KALSAALSHNSSNNNNN----NNSSSNSLSNNNNNNNNN-AESSNHNKIS
C3              KALSAALSHNSSSNNNN----SNS--NSLSNNNNNNNNN-AESSNHNKIS
C4              KALSAALSHNSSNNNNNNNNNKSSSNNSLSNNNNNNNNNNADSSNHNKIS
C5              KALSAALSHSSTSNNNNSSSGGSSSN-SLSNNNNNNNNNNAESSNHNKIS
C6              KALSAALSHNNSSSNNN----NNSSSNSLSNNNNNNN-NIAESSNHNKIS
C7              KALSAALSQNNSGSNNN----NNNSSNSLTNNNNN---NIAESSNHNKIS
                ********:..:..***     ..   **:*****   * *:********

C1              SYLS-PNQTSAACNNSSNSNSNNHSSSHNN------SSSNNISGSLNSSL
C2              SYLS-PNQTSAACNNSSNSNSNNHSSSHNN------SSSNNISGSLNSSL
C3              SYLS-PNQTSAACNNSSNSNSNNHSSSHNN------SSSNNISGSLNSSL
C4              SYLP-PNQTSATCNNS---NNSNHSSSNNN-----SSSNNNISGSLNSSL
C5              SYLP-PNQASATCNNS---SSNSHSSSSNNNSHSSSSSSNNISGSLNSSL
C6              SYLQQPTQTSATSNNS----SNNHSSSSNN------SSSNNISGSLNSSL
C7              SYLP-PTQASAASNNNGNSSSSNNHSSNNS-------SSNNISGSQNSSL
                ***  *.*:**:.**.    ...: ** *.       *.****** ****

C1              NSPFSAPQIPPPVTAS--SAAAAAAAAASLTAAVAAAAAATAASAGSSSS
C2              NSPFSAPQIPPPVTAS--SAAAAAAAAASLTAAVAAAAAATAASAGSSS-
C3              NSPFSAPQIPPPVTAS--SAAAAAAAAASLTAAVAAAAAATAASAGSSS-
C4              NSPFSAPQIPPPVTAS--SAAAAAAAAASLTAAVAAAAAATAASVGSSG-
C5              NSPFSAPQIPPPVTAS--SAAAAAAAAASLTAAVAAAAAATAASAGSSS-
C6              NSPFSAPQVPPSVTASSAAAAAAAAAAASLTAAVAAAAVAATSSSSSSNA
C7              NSPFSAPQVPPSVTAS--SAAAAAAAAASLTAAVAAAAAATASSSSASG-
                ********:**.****  :*******************.*:::* .:*. 

C1              --AASGQTSGTPAIQELKASSAASPVRNPNP------NPSKASSSNHWDM
C2              --SASGQTSGTPAIQELKASSAASPVRNPNP------NPSKASSSNHWDM
C3              --SASGQTSGTPAIQELKASSAASPVRNPNP------NPSKASSSNHWDM
C4              --SASGQTSGTPAIQELKASSAASPVRNPNP------NPSKASSSNHWDM
C5              --SASGQTSGTPAIQELKASSAASPVRNPNPP-----NPSKASSSNHWDM
C6              GGQSGGNSSGTPAIQELKASSAASPVRNPNSNPNQNPNPSKASSSNHWDM
C7              ---QSGGASGTPAIQELKASSAASPVRNPNPNP----NPSKASSSNHWDM
                    .* :**********************.      *************

C1              GEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPL
C2              GEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPL
C3              GEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPL
C4              GEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPL
C5              GEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPL
C6              GEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPL
C7              GEMEGSRKSHLTPPPQKRIKSADLFRAQHGISPERLLLDREFPVAGQHPL
                **************************************************

C1              TRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANPKHELGQSAGEDS
C2              TRNRSGRDTSKDRERNMELRESLLGQALENSNGQQANPKHELGQSAGEDS
C3              TRNRSGRDTSKDRERNMELRESLLGQALENSNGQQANPKHELGQSAGEDS
C4              TRNRSGRDTSKDRERNMELRESLLGQALENSNGQQANPKHELGQSAGEDS
C5              TRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANQKHELGQSAGEDS
C6              TRNRSGRDTSKDRERNMELRESLLGQALENSNGQQANQKHDLGQSAGEDS
C7              TRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANQKHDLGQSAGEDS
                ****************:******************** **:*********

C1              NSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGI
C2              NSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGI
C3              NSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGI
C4              NSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGL
C5              NSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGL
C6              NSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGI
C7              NSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGL
                *************************************************:

C1              NSDFGTFLNAKSGIKQEVLEPETEEDAVQQQR---PHEAHAADRRPAACK
C2              NSDFGTFLNAKSGIKQEVLEPETEEDAVQQQR---PHEAHAADRRPAACK
C3              NSDFGTFLNAKSGIKQEVLEPETEEDAVQQQR---PHEDH--DRRPVACK
C4              NSDFGTFLNAKSGIKQEVLEPETEEDAVQQQQQPQPHEAHAADRRPAACK
C5              NSDFGTFLNAKSGIKQEVLEPEAEEDAVQQQR---PHEAHAADRRPAASK
C6              NSDFGTFLNAKSGIKQEVMEPEVEEDAAQLQQQ-LPHEAHAADRRPAACK
C7              NSDFGNFLNAKSGIKQEVMEPETEEDVVQQQP----HEAHAADRRPAASK
                *****.************:***.***..* *     ** *  ****.*.*

C1              LAKLMQQQEQQQRQLFDQRRSHHQPHHHHQPHHHRHHHHHQ--QRINNNN
C2              LAKLMQQQEQQQRQLFDQRRSHHQPHHHHQPHHHRHHHHHQ--QRINNNN
C3              LAKLMQQQEQQQRQLFDQRRSHHQPHHHHQPHHHRHHHHHQ--QRINNNN
C4              LAKLMQQQEQQQRQLFDQRRSHHQPHHHHQPHHRHQHHHHHHHHRINNNN
C5              LAKLMQQQEQQQRQLFDQRRSHHQPHHHHQPHHRHQHHHHH--HRLNNNN
C6              LAKLMQQQ-QQQRQLFDQRRSHHQAHHHHQPHHRHHHNHHHRINNNNNNN
C7              LAKLMQQ--QQQRQLFDQRRSHHQPHHHHQPHQRHHHHNHH---RINNNN
                *******  ***************.*******::::*::*:   . ****

C1              NNTKKNRSANSSPTPSARSWNDSEEDQDMDCSSGNQQQHGQQQQQ---QH
C2              NNTKKNRSANSSPTPSARSWNDSEEDQDMDCSSGNQQQHAQQQQQ---QH
C3              NNTKKNRSANSSPTPSARSWNDSEEDQDMDCSSGNQQQHAQQQQQ---QH
C4              NNTKKNRSANSSPTPSARSWNDSEDDQDMDCSSGNQQQSAQQQQQQQQQH
C5              NNTKRNRSANSSPTPSARSWNDSEEDQDMDCGSGNQQQNAQQQQQ---QH
C6              NNTKKNRSANSSPTPSARSWNDSEEDQDMDCNHSQQQQQQSQQQQQQQQH
C7              N-TKKNRSANSSPTPSARSWNDSEEDQDMDCSSGNHNQQQQAQQQ----H
                * **:*******************:******. .:::*  . ***    *

C1              NSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQTLLMKQEQHQQQHQQQ
C2              NSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQTLLMKQEQHQQQHQQQ
C3              NSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQTLLMKQEQHQQQHQQQ
C4              NSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQTLLMKQEQHQQQHQQQ
C5              NSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQTLLMKQEQHQQQHQQQ
C6              NSNEDEDDRSSSASSAISLTMKRTRQDSESTLYQTLLMKQEQHQQQHQQQ
C7              NSNEDEDDRSSSASSAISLTVKRTRQDSESTLYQTLLMKQDQHQQQHQHQ
                ********************:*******************:*******:*

C1              HQQQ--QHQQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDFPELFQ
C2              HQQQHQQQQQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDFPELFQ
C3              HQQQHQQQQQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDFPELFQ
C4              QQQH--QQQQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDFPELFQ
C5              QQQQ--QHQQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDFPELFQ
C6              QQQHQQQQHQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDFPELFQ
C7              QQQQ----HQQQQQYLDELQQSHQQQLTANLFMARTIALSRSRDFPELFQ
                :**:    :*****************************************

C1              NTIAAAAANATAASASPGNNASGPGQVVATG----PGPGPGSAAPVAVGS
C2              NTIAAAAANATAASASPGNNASGPGQVVATG----PGPGPGSAEPVAMGS
C3              NTIAAAAANATAASASPGNNASGPGQVVATG----PGPGPGSAAPVAVGS
C4              NTIAAAAANATAASASPGNNASGPGQQVVAS---GPGPGPGSAAPVAVGG
C5              STIAAAAANATAASASPGHNASGPGQVVAPGPGPGPGPGPGSAAPVAVGS
C6              NTIAAAAANATAASVSPGNNGGGAVKVAGPGP-------PGNAAPVGTVG
C7              NTIAAAAANATAASSSPGNNGSGAVKVAGPGP--GPGPLPGSAAPVAVGS
                .************* ***:*..*. : . ..        **.* **.  .

C1              GSGAS-----AGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
C2              GSGAA-----AGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
C3              GSGAA-----AGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
C4              GSGAA-----AGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
C5              GSGAA-----AGNSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
C6              GSGAAGSGATGSGSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
C7              GSGAATG---AGSSNYMLPCPLCETPLEQRVFRQHLDRHYPRDSPVCPVI
                ****:     ...*************************************

C1              ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooooo
C2              ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooooo
C3              ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooooo
C4              ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooooo
C5              ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooooo
C6              ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFK------
C7              ECGRRFAHPNSVRNHMRIKHTLQWAKMKAMRSSGGPFAGGPDFKoooooo
                ********************************************      

C1              ooooooooooooooo-----
C2              oooooooooooooo------
C3              oooooooooooooooooo--
C4              ooo-----------------
C5              oo------------------
C6              --------------------
C7              oooooooooooooooooooo
                                    




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  920 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [53918]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  920 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/ab-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  920 type PROTEIN Struct Unchecked
  Inp