--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Sat Nov 12 06:33:31 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/2/aay-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2091.86 -2109.68 2 -2092.05 -2104.31 -------------------------------------- TOTAL -2091.95 -2108.99 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.595119 0.005995 0.450219 0.746304 0.588543 1163.59 1262.74 1.000 r(A<->C){all} 0.124925 0.001025 0.061693 0.185846 0.123012 789.39 934.88 1.001 r(A<->G){all} 0.249220 0.001852 0.169875 0.334516 0.246963 773.03 873.93 1.000 r(A<->T){all} 0.080162 0.001108 0.020768 0.144338 0.077337 706.00 781.90 1.001 r(C<->G){all} 0.056181 0.000346 0.023007 0.094871 0.054047 1019.80 1023.56 1.000 r(C<->T){all} 0.415210 0.002813 0.312582 0.522440 0.414621 526.58 648.06 1.001 r(G<->T){all} 0.074302 0.000575 0.029641 0.121435 0.072112 1128.21 1172.40 1.000 pi(A){all} 0.246813 0.000209 0.218702 0.274661 0.246554 1062.07 1140.81 1.001 pi(C){all} 0.265360 0.000211 0.236745 0.292729 0.265356 1175.72 1252.27 1.000 pi(G){all} 0.283722 0.000227 0.254777 0.313835 0.283485 1225.27 1251.85 1.000 pi(T){all} 0.204105 0.000179 0.178155 0.230790 0.203830 1181.20 1229.08 1.000 alpha{1,2} 0.063021 0.001241 0.000142 0.118538 0.065143 1195.55 1229.54 1.000 alpha{3} 2.634940 0.708362 1.188567 4.303611 2.522565 1094.45 1297.72 1.000 pinvar{all} 0.431065 0.003322 0.320603 0.541641 0.431538 1272.84 1313.87 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1946.043099 Model 2: PositiveSelection -1946.043099 Model 0: one-ratio -1962.638927 Model 3: discrete -1945.150938 Model 7: beta -1945.156686 Model 8: beta&w>1 -1945.156786 Model 0 vs 1 33.191655999999966 Model 2 vs 1 0.0 Model 8 vs 7 1.999999999497959E-4
>C1 MSGSVLSLARPAAATNGHNLLTKQLNCNGNGTTGGAAKTTVASAITPPKQ PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMG GAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAEGK QVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPTS RSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNVVR PEVYRRAQYYVTDFEQLMGQo >C2 MSGSVLSLARPAAATNGHNLLAKQLNCNGNGTTDGAAKTTVASAITPPKQ PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMG GAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFFSHLKAEGK QVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQPTS RSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNVVR PEVYRRAQYYVTDFEQLMGQo >C3 MSGSVLSLARPAAATNGHNLLAKQLNCNGNGTTGGAAKTTVASAITPPKQ PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMG GAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAEGK QVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQPTS RSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNVVR PEVYRRAQYYVTDFEQLMGQo >C4 MSGSVLSLARPAAAANGHNLLAKQLNCNGNGTTGGAAKTTVASAITPPKQ PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMG GAMTFQDALKIRLNIIRPTQQQVRDFIEERPSTLSKNVKRFVSHLKAEGK QVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQPTS RSGGKAEAIALIRKENSDDALITMIGDGATDLEAVPPANYFIGFGGNVVR PEVYRRAQYYVTDFEQLMGQo >C5 MSGSVLSLARPAAATNGHNLLAKQLNCNGNGTTGGAAKTTVASAITPPKQ PQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMG GAMTFQDALKIRLNIIRPTQRQVRDFIQERPSTLSKNVKRFVSHLKAEGK QVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQPTS RSGGKAEAIALIRKENNEDALITMIGDGATDLEAVPPANYFIGFGGNVVR PEVYRRAQYYVTDFEQLMGQo >C6 MSGSVLSLARPAAAAATNGHNLLAKQLNCNGNGTAGVAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPSQQQVQDFIRERPSTLSKNVRRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKQENSGDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMo >C7 MSGSVLSLARPAAATANGHNLLAKQLNCNGNGTSGGAAKTTVASAITPPK QPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAM GGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLTKNVKRFVAHLKAEG KQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQPT SRSGGKAEAIALIKKENNVDSLITMIGDGATDLEAVPPANYFIGFGGNVV RPEVYRRAQYYVTDFEQLMGQ CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=273 C1 MSGSVLSLARPAAAT--NGHNLLTKQLNCNGNGTTGGAAKTTVASAITPP C2 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTDGAAKTTVASAITPP C3 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP C4 MSGSVLSLARPAAAA--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP C5 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP C6 MSGSVLSLARPAAAAATNGHNLLAKQLNCNGNGTAGVAAKTTVASAITPP C7 MSGSVLSLARPAAATA-NGHNLLAKQLNCNGNGTSGGAAKTTVASAITPP **************: ******:**********:. ************* C1 KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA C2 KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA C3 KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA C4 KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA C5 KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA C6 KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA C7 KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA ************************************************** C1 MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE C2 MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFFSHLKAE C3 MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE C4 MGGAMTFQDALKIRLNIIRPTQQQVRDFIEERPSTLSKNVKRFVSHLKAE C5 MGGAMTFQDALKIRLNIIRPTQRQVRDFIQERPSTLSKNVKRFVSHLKAE C6 MGGAMTFQDALKIRLNIIRPSQQQVQDFIRERPSTLSKNVRRFVAHLKAE C7 MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLTKNVKRFVAHLKAE ********************:*:**:***.******:***:**.:***** C1 GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQP C2 GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP C3 GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP C4 GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP C5 GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP C6 GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP C7 GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP ****************************************:******.** C1 TSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNV C2 TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV C3 TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV C4 TSRSGGKAEAIALIRKENSDDALITMIGDGATDLEAVPPANYFIGFGGNV C5 TSRSGGKAEAIALIRKENNEDALITMIGDGATDLEAVPPANYFIGFGGNV C6 TSRSGGKAEAIALIKQENSGDSLITMIGDGATDLEAVPPANYFIGFGGNV C7 TSRSGGKAEAIALIKKENNVDSLITMIGDGATDLEAVPPANYFIGFGGNV **************::**. *:**************************** C1 VRPEVYRRAQYYVTDFEQLMGQo C2 VRPEVYRRAQYYVTDFEQLMGQo C3 VRPEVYRRAQYYVTDFEQLMGQo C4 VRPEVYRRAQYYVTDFEQLMGQo C5 VRPEVYRRAQYYVTDFEQLMGQo C6 VRPEVYRRAQYYVTDFEQLMo-- C7 VRPEVYRRAQYYVTDFEQLMGQ- ******************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] s S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11550] Library Relaxation: Multi_proc [72] Relaxation Summary: [11550]--->[11536] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/2/aay-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.401 Mb, Max= 30.799 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MSGSVLSLARPAAAT--NGHNLLTKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQP TSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C2 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTDGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFFSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C3 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C4 MSGSVLSLARPAAAA--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIEERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENSDDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C5 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQRQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENNEDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C6 MSGSVLSLARPAAAAATNGHNLLAKQLNCNGNGTAGVAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPSQQQVQDFIRERPSTLSKNVRRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKQENSGDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMo-- >C7 MSGSVLSLARPAAATA-NGHNLLAKQLNCNGNGTSGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLTKNVKRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKKENNVDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ- FORMAT of file /tmp/tmp2071150447995365783aln Not Supported[FATAL:T-COFFEE] >C1 MSGSVLSLARPAAAT--NGHNLLTKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQP TSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C2 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTDGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFFSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C3 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C4 MSGSVLSLARPAAAA--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIEERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENSDDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C5 MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQRQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENNEDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQo >C6 MSGSVLSLARPAAAAATNGHNLLAKQLNCNGNGTAGVAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPSQQQVQDFIRERPSTLSKNVRRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKQENSGDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMo-- >C7 MSGSVLSLARPAAATA-NGHNLLAKQLNCNGNGTSGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLTKNVKRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKKENNVDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:273 S:99 BS:273 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # PW_SEQ_DISTANCES BOT 0 1 98.15 C1 C2 98.15 TOP 1 0 98.15 C2 C1 98.15 BOT 0 2 98.89 C1 C3 98.89 TOP 2 0 98.89 C3 C1 98.89 BOT 0 3 98.15 C1 C4 98.15 TOP 3 0 98.15 C4 C1 98.15 BOT 0 4 97.79 C1 C5 97.79 TOP 4 0 97.79 C5 C1 97.79 BOT 0 5 94.80 C1 C6 94.80 TOP 5 0 94.80 C6 C1 94.80 BOT 0 6 97.04 C1 C7 97.04 TOP 6 0 97.04 C7 C1 97.04 BOT 1 2 99.26 C2 C3 99.26 TOP 2 1 99.26 C3 C2 99.26 BOT 1 3 97.05 C2 C4 97.05 TOP 3 1 97.05 C4 C2 97.05 BOT 1 4 97.42 C2 C5 97.42 TOP 4 1 97.42 C5 C2 97.42 BOT 1 5 93.68 C2 C6 93.68 TOP 5 1 93.68 C6 C2 93.68 BOT 1 6 96.67 C2 C7 96.67 TOP 6 1 96.67 C7 C2 96.67 BOT 2 3 97.79 C3 C4 97.79 TOP 3 2 97.79 C4 C3 97.79 BOT 2 4 98.15 C3 C5 98.15 TOP 4 2 98.15 C5 C3 98.15 BOT 2 5 94.42 C3 C6 94.42 TOP 5 2 94.42 C6 C3 94.42 BOT 2 6 97.41 C3 C7 97.41 TOP 6 2 97.41 C7 C3 97.41 BOT 3 4 98.15 C4 C5 98.15 TOP 4 3 98.15 C5 C4 98.15 BOT 3 5 95.17 C4 C6 95.17 TOP 5 3 95.17 C6 C4 95.17 BOT 3 6 96.30 C4 C7 96.30 TOP 6 3 96.30 C7 C4 96.30 BOT 4 5 94.05 C5 C6 94.05 TOP 5 4 94.05 C6 C5 94.05 BOT 4 6 97.04 C5 C7 97.04 TOP 6 4 97.04 C7 C5 97.04 BOT 5 6 95.56 C6 C7 95.56 TOP 6 5 95.56 C7 C6 95.56 AVG 0 C1 * 97.47 AVG 1 C2 * 97.04 AVG 2 C3 * 97.65 AVG 3 C4 * 97.10 AVG 4 C5 * 97.10 AVG 5 C6 * 94.61 AVG 6 C7 * 96.67 TOT TOT * 96.81 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- C2 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- C3 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- C4 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCGCA----- C5 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- C6 ATGAGCGGTTCCGTTTTAAGTTTGGCGCGTCCTGCAGCCGCAGCAGCCAC C7 ATGAGCGGTTCCGTTTTGAGTTTGGCCCGTCCTGCAGCAGCCACAGCA-- **************:**.******** ***********.**..** C1 -AATGGCCATAATCTGCTGACCAAACAGCTGAATTGCAATGGCAATGGCA C2 -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA C3 -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA C4 -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA C5 -AATGGCCATAATCTGCTGGCCAAACAGCTGAATTGCAATGGCAATGGCA C6 AAATGGCCATAATCTTCTGGCCAAACAGCTAAATTGCAATGGCAATGGCA C7 -AATGGCCATAATCTTCTGGCCAAACAGCTCAACTGCAATGGCAATGGCA ************** ***.****.***** ** **************** C1 CCACCGGTGGCGCGGCGAAAACCACTGTGGCCTCGGCCATAACACCGCCC C2 CCACCGATGGCGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC C3 CCACCGGTGGCGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC C4 CCACCGGTGGGGCGGCCAAAACCACTGTGGCCTCGGCCATAACGCCGCCC C5 CCACCGGTGGGGCTGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC C6 CCGCAGGCGTGGCGGCCAAAACCACAGTGGCCTCGGCCATAACACCACCC C7 CCTCCGGAGGAGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCACCC ** *.*. * ** ** ********:*****************.**.*** C1 AAGCAGCCCCAGTTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG C2 AAGCAGCCCCAGCTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG C3 AAGCAGCCCCAGCTGGCGGCCAAGGTCATCCAGCAGTCACAGATCGTCTG C4 AAGCAGCCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG C5 AAGCAGCCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG C6 AAACAACCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTTTG C7 AAACAGCCTCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTTTG **.**.** **. *************************.******** ** C1 TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG C2 TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG C3 TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG C4 TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG C5 TTTCGATGTGGATTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG C6 CTTCGATGTCGATTCAACGGTGATTTGCGAGGAGGGCATCGACGAGCTGG C7 TTTCGATGTGGATTCCACAGTGATTTGCGAGGAGGGTATCGATGAGTTGG ******** ** **.**.***************** ***** **. *** C1 CCGAATATTGTGGCAAGGGGAGCGAGGTGGCTCGCGTTACCAAGGAGGCG C2 CCGAATATTGTGGCAAGGGAAGTGAGGTGGCTCGCGTTACCAAGGAGGCG C3 CCGAATATTGCGGCAAGGGGAGCGAGGTGGCTCGCGTTACCAAGGAGGCG C4 CCGAGTATTGTGGCAAGGGTAGCGAGGTGGCGCGCGTCACCAAGGAGGCG C5 CCGAATATTGCGGCAAGGGTAGCGAGGTGGCCCGCGTCACCAAGGAGGCG C6 CCGAATATTGCGGCAAGGGCAGCGAGGTGGCGCGTGTCACCAAGGAGGCG C7 CCGAGTATTGCGGCAAAGGAAGTGAAGTGGCGCGTGTCACCAAGGAGGCG ****.***** *****.** ** **.***** ** ** ************ C1 ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATTCGCTTGAACAT C2 ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGCTTGAACAT C3 ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGCTTGAACAT C4 ATGGGCGGTGCCATGACCTTCCAGGATGCCCTTAAAATCCGCTTGAACAT C5 ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGATTGAACAT C6 ATGGGCGGGGCCATGACCTTCCAGGATGCCCTCAAAATCCGGCTGAACAT C7 ATGGGCGGTGCCATGACCTTTCAGGATGCCCTTAAAATCAGATTGAACAT ******** *********** *********** ***** .* ******* C1 CATACGGCCGACACAGCAGCAAGTGAGGGATTTCATCCAGGAGCGACCCA C2 CATACGACCGACACAGCAGCAAGTGAGGGATTTTATCCAGGAGCGACCCA C3 CATACGGCCGACACAGCAGCAAGTGAGGGATTTCATCCAGGAGCGACCCA C4 CATCAGGCCTACACAGCAGCAAGTGAGGGATTTCATTGAGGAGCGACCCA C5 CATTAGGCCCACACAGCGGCAAGTGAGGGATTTCATTCAAGAGCGACCCA C6 CATAAGGCCCTCGCAGCAGCAAGTGCAGGATTTCATTCGCGAACGACCCA C7 CATCCGGCCCACTCAACAGCAAGTAAGGGATTTCATCCAAGAGCGGCCCA *** .*.** :* **.*.******...****** ** . **.**.**** C1 GTACACTGAGCAAAAACGTGAAGCGTTTCGTCAGCCATTTGAAGGCGGAG C2 GTACACTGAGCAAAAACGTGAAACGTTTCTTCAGCCATTTGAAGGCGGAG C3 GTACACTGAGCAAAAACGTGAAGCGTTTCGTCAGCCATTTGAAGGCGGAG C4 GTACACTGAGCAAAAACGTCAAGCGTTTCGTGAGCCACTTGAAGGCGGAG C5 GTACACTGAGCAAAAACGTGAAGCGTTTCGTGAGCCACTTGAAGGCGGAA C6 GTACACTGAGCAAAAACGTGCGGCGTTTCGTGGCCCACCTGAAGGCGGAG C7 GCACACTGACCAAAAACGTCAAGCGTTTCGTTGCCCACTTGAAGGCGGAG * ******* ********* ...****** * . *** **********. C1 GGAAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC C2 GGCAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC C3 GGCAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC C4 GGCAAACAGGTTTATTTGATATCCGGCGGATTCGATTGCCTAATTGCGCC C5 GGCAAACAGGTTTATTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC C6 GGCAAACAGGTTTATTTGATCTCCGGCGGATTCGATTGTCTCATCGCTCC C7 GGCAAACAAGTATATTTGATCTCCGGCGGTTTCGATTGCCTCATAGCACC **.*****.**:** *****.********:******** **.** ** ** C1 CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA C2 CGTGGCCAATGAATTGGGTATTCCCCTGAAAAATGTCTATGCCAACAAGA C3 CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA C4 CGTGGCCAATGAATTGGGAATTCCGCTGAAAAACGTGTATGCCAACAAGA C5 CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA C6 GGTGGCCAATGAACTGGGCATTCCCCTGAAAAATGTCTATGCCAACAAGA C7 AGTGGCCAACGAATTGGGTATTCCCCTGAAAAATGTTTATGCCAACAAGA ******** *** **** ***** ******** ** ************* C1 TGCTGTTCGATTATTTGGGCGAATACGATAGCTTTGATATCAACCAGCCC C2 TGCTTTTCGATTATCTGGGCGACTATGATAGCTTTGATATCAACCAGCCC C3 TGCTTTTCGATTATCTGGGCGACTACGATAGCTTTGATATCAACCAGCCC C4 TGCTCTTTGATTATCTGGGCGAATACGATAGCTTTGATATCAGCCAGCCG C5 TGCTGTTTGATTATCTAGGCGAATACGATAGCTTTGATATCAGCCAGCCC C6 TGCTGTTCGACTATTTGGGCGAATACGATAGCTTTGACATCACACAGCCC C7 TGCTGTTCGATTATTTGGGCGAATACGATAGCTTTGACATCACCCAGCCC **** ** ** *** *.*****.** *********** **** .***** C1 ACTTCGCGTTCCGGCGGAAAGGCAGAGGCTATCGCCCTGATAAGGAAGGA C2 ACTTCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA C3 ACTTCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA C4 ACATCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA C5 ACTTCTCGTTCCGGCGGCAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA C6 ACCTCGCGTTCCGGTGGAAAGGCCGAGGCCATCGCCCTGATAAAGCAGGA C7 ACATCACGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAAGAAGGA ** ** ******** **.*****.***** *************.*.**** C1 GAATAGCGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC C2 GAATAACGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC C3 GAATAACGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC C4 GAATAGCGACGATGCCCTAATCACCATGATCGGCGATGGAGCCACCGATC C5 GAATAACGAAGACGCCCTAATCACCATGATCGGCGATGGAGCCACCGATC C6 GAACAGCGGGGATTCCCTCATCACAATGATCGGCGATGGAGCCACCGATC C7 GAATAATGTCGATTCTCTGATCACCATGATCGGCGATGGAGCCACCGATC *** *. * ** * ** *****.************************* C1 TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC C2 TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC C3 TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC C4 TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC C5 TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTTGGTGGCAATGTC C6 TGGAGGCCGTACCGCCGGCCAACTATTTCATTGGCTTTGGGGGAAATGTT C7 TTGAGGCCGTACCGCCAGCTAACTATTTTATTGGATTTGGTGGCAATGTA * **************.** ***** ** **:** ** ** **.***** C1 GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGATTTTGA C2 GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGACTTTGA C3 GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGACTTTGA C4 GTGCGGCCGGAGGTCTATCGCCGGGCGCAGTATTACGTAACGGACTTTGA C5 GTGCGGCCGGAGGTCTATCGCCGAGCCCAGTATTACGTAACGGACTTTGA C6 GTGCGACCGGAGGTCTATCGCCGGGCCCAGTATTACGTAACGGACTTTGA C7 GTACGACCGGAGGTCTATCGCCGGGCCCAGTATTACGTAACGGACTTTGA **.**.***************** ** ***************** ***** C1 GCAGCTGATGGGGCAG--- C2 GCAGCTGATGGGGCAG--- C3 GCAGCTGATGGGGCAG--- C4 GCAGCTGATGGGGCAG--- C5 GCAGCTGATGGGGCAG--- C6 GCAGCTGATG--------- C7 GCAGCTGATGGGGCAG--- ********** >C1 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGACCAAACAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGCGCGGCGAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAGTTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGTGGCAAGGGGAGCGAGGTGGCTCGCGTTACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATTCGCTTGAACAT CATACGGCCGACACAGCAGCAAGTGAGGGATTTCATCCAGGAGCGACCCA GTACACTGAGCAAAAACGTGAAGCGTTTCGTCAGCCATTTGAAGGCGGAG GGAAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA TGCTGTTCGATTATTTGGGCGAATACGATAGCTTTGATATCAACCAGCCC ACTTCGCGTTCCGGCGGAAAGGCAGAGGCTATCGCCCTGATAAGGAAGGA GAATAGCGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGATTTTGA GCAGCTGATGGGGCAG--- >C2 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA CCACCGATGGCGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAGCTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGTGGCAAGGGAAGTGAGGTGGCTCGCGTTACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGCTTGAACAT CATACGACCGACACAGCAGCAAGTGAGGGATTTTATCCAGGAGCGACCCA GTACACTGAGCAAAAACGTGAAACGTTTCTTCAGCCATTTGAAGGCGGAG GGCAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAATGTCTATGCCAACAAGA TGCTTTTCGATTATCTGGGCGACTATGATAGCTTTGATATCAACCAGCCC ACTTCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAACGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >C3 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGCGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAGCTGGCGGCCAAGGTCATCCAGCAGTCACAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGCGGCAAGGGGAGCGAGGTGGCTCGCGTTACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGCTTGAACAT CATACGGCCGACACAGCAGCAAGTGAGGGATTTCATCCAGGAGCGACCCA GTACACTGAGCAAAAACGTGAAGCGTTTCGTCAGCCATTTGAAGGCGGAG GGCAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA TGCTTTTCGATTATCTGGGCGACTACGATAGCTTTGATATCAACCAGCCC ACTTCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAACGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >C4 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCGCA----- -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGGGCGGCCAAAACCACTGTGGCCTCGGCCATAACGCCGCCC AAGCAGCCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAGTATTGTGGCAAGGGTAGCGAGGTGGCGCGCGTCACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTTAAAATCCGCTTGAACAT CATCAGGCCTACACAGCAGCAAGTGAGGGATTTCATTGAGGAGCGACCCA GTACACTGAGCAAAAACGTCAAGCGTTTCGTGAGCCACTTGAAGGCGGAG GGCAAACAGGTTTATTTGATATCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGAATTCCGCTGAAAAACGTGTATGCCAACAAGA TGCTCTTTGATTATCTGGGCGAATACGATAGCTTTGATATCAGCCAGCCG ACATCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAGCGACGATGCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGGGCGCAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >C5 ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGGCCAAACAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGGGCTGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGATTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGCGGCAAGGGTAGCGAGGTGGCCCGCGTCACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGATTGAACAT CATTAGGCCCACACAGCGGCAAGTGAGGGATTTCATTCAAGAGCGACCCA GTACACTGAGCAAAAACGTGAAGCGTTTCGTGAGCCACTTGAAGGCGGAA GGCAAACAGGTTTATTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA TGCTGTTTGATTATCTAGGCGAATACGATAGCTTTGATATCAGCCAGCCC ACTTCTCGTTCCGGCGGCAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAACGAAGACGCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTTGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGAGCCCAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >C6 ATGAGCGGTTCCGTTTTAAGTTTGGCGCGTCCTGCAGCCGCAGCAGCCAC AAATGGCCATAATCTTCTGGCCAAACAGCTAAATTGCAATGGCAATGGCA CCGCAGGCGTGGCGGCCAAAACCACAGTGGCCTCGGCCATAACACCACCC AAACAACCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTTTG CTTCGATGTCGATTCAACGGTGATTTGCGAGGAGGGCATCGACGAGCTGG CCGAATATTGCGGCAAGGGCAGCGAGGTGGCGCGTGTCACCAAGGAGGCG ATGGGCGGGGCCATGACCTTCCAGGATGCCCTCAAAATCCGGCTGAACAT CATAAGGCCCTCGCAGCAGCAAGTGCAGGATTTCATTCGCGAACGACCCA GTACACTGAGCAAAAACGTGCGGCGTTTCGTGGCCCACCTGAAGGCGGAG GGCAAACAGGTTTATTTGATCTCCGGCGGATTCGATTGTCTCATCGCTCC GGTGGCCAATGAACTGGGCATTCCCCTGAAAAATGTCTATGCCAACAAGA TGCTGTTCGACTATTTGGGCGAATACGATAGCTTTGACATCACACAGCCC ACCTCGCGTTCCGGTGGAAAGGCCGAGGCCATCGCCCTGATAAAGCAGGA GAACAGCGGGGATTCCCTCATCACAATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCGGCCAACTATTTCATTGGCTTTGGGGGAAATGTT GTGCGACCGGAGGTCTATCGCCGGGCCCAGTATTACGTAACGGACTTTGA GCAGCTGATG--------- >C7 ATGAGCGGTTCCGTTTTGAGTTTGGCCCGTCCTGCAGCAGCCACAGCA-- -AATGGCCATAATCTTCTGGCCAAACAGCTCAACTGCAATGGCAATGGCA CCTCCGGAGGAGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCACCC AAACAGCCTCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTTTG TTTCGATGTGGATTCCACAGTGATTTGCGAGGAGGGTATCGATGAGTTGG CCGAGTATTGCGGCAAAGGAAGTGAAGTGGCGCGTGTCACCAAGGAGGCG ATGGGCGGTGCCATGACCTTTCAGGATGCCCTTAAAATCAGATTGAACAT CATCCGGCCCACTCAACAGCAAGTAAGGGATTTCATCCAAGAGCGGCCCA GCACACTGACCAAAAACGTCAAGCGTTTCGTTGCCCACTTGAAGGCGGAG GGCAAACAAGTATATTTGATCTCCGGCGGTTTCGATTGCCTCATAGCACC AGTGGCCAACGAATTGGGTATTCCCCTGAAAAATGTTTATGCCAACAAGA TGCTGTTCGATTATTTGGGCGAATACGATAGCTTTGACATCACCCAGCCC ACATCACGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAAGAAGGA GAATAATGTCGATTCTCTGATCACCATGATCGGCGATGGAGCCACCGATC TTGAGGCCGTACCGCCAGCTAACTATTTTATTGGATTTGGTGGCAATGTA GTACGACCGGAGGTCTATCGCCGGGCCCAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >C1 MSGSVLSLARPAAATooNGHNLLTKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQP TSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >C2 MSGSVLSLARPAAATooNGHNLLAKQLNCNGNGTTDGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFFSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >C3 MSGSVLSLARPAAATooNGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >C4 MSGSVLSLARPAAAAooNGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIEERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENSDDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >C5 MSGSVLSLARPAAATooNGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQRQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENNEDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >C6 MSGSVLSLARPAAAAATNGHNLLAKQLNCNGNGTAGVAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPSQQQVQDFIRERPSTLSKNVRRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKQENSGDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMoo >C7 MSGSVLSLARPAAATAoNGHNLLAKQLNCNGNGTSGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLTKNVKRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKKENNVDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 7 taxa and 819 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1478931922 Setting output file names to "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1667868455 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 6841426400 Seed = 1330005351 Swapseed = 1478931922 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 24 unique site patterns Division 2 has 20 unique site patterns Division 3 has 82 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2772.700399 -- -24.557203 Chain 2 -- -2756.792276 -- -24.557203 Chain 3 -- -2662.463994 -- -24.557203 Chain 4 -- -2676.451304 -- -24.557203 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2656.019266 -- -24.557203 Chain 2 -- -2773.041081 -- -24.557203 Chain 3 -- -2775.776150 -- -24.557203 Chain 4 -- -2738.528634 -- -24.557203 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2772.700] (-2756.792) (-2662.464) (-2676.451) * [-2656.019] (-2773.041) (-2775.776) (-2738.529) 500 -- (-2171.069) (-2171.619) [-2158.128] (-2183.259) * (-2168.128) [-2175.349] (-2176.585) (-2178.174) -- 0:33:19 1000 -- (-2155.786) (-2155.283) [-2129.546] (-2159.551) * (-2160.806) (-2157.994) [-2158.637] (-2173.967) -- 0:16:39 1500 -- (-2127.557) (-2135.685) [-2115.415] (-2143.849) * (-2153.445) (-2140.611) [-2120.956] (-2160.733) -- 0:11:05 2000 -- (-2101.202) (-2105.405) [-2106.728] (-2147.547) * (-2141.502) (-2125.147) [-2102.957] (-2132.078) -- 0:08:19 2500 -- (-2102.949) [-2093.014] (-2104.156) (-2120.724) * (-2122.139) [-2098.209] (-2097.775) (-2102.265) -- 0:06:39 3000 -- (-2096.944) (-2094.132) (-2103.999) [-2099.143] * (-2100.389) (-2102.771) (-2095.336) [-2098.338] -- 0:05:32 3500 -- (-2100.383) (-2097.597) [-2093.609] (-2098.883) * (-2094.917) (-2099.110) [-2095.033] (-2093.339) -- 0:04:44 4000 -- (-2097.106) [-2099.520] (-2099.519) (-2099.091) * [-2095.199] (-2103.357) (-2099.833) (-2100.798) -- 0:08:18 4500 -- (-2105.811) (-2099.663) [-2093.524] (-2102.876) * (-2096.953) (-2100.523) (-2100.620) [-2096.386] -- 0:07:22 5000 -- (-2104.008) (-2100.515) (-2096.321) [-2098.013] * [-2090.295] (-2101.599) (-2093.355) (-2109.137) -- 0:06:38 Average standard deviation of split frequencies: 0.031427 5500 -- (-2097.035) (-2094.194) (-2095.126) [-2090.369] * [-2090.953] (-2113.597) (-2100.797) (-2094.899) -- 0:06:01 6000 -- (-2095.595) (-2095.876) (-2104.384) [-2092.415] * (-2096.763) [-2097.957] (-2093.928) (-2100.010) -- 0:05:31 6500 -- (-2095.103) [-2093.703] (-2098.016) (-2089.487) * (-2096.855) (-2099.030) [-2099.152] (-2096.710) -- 0:05:05 7000 -- [-2092.286] (-2093.870) (-2094.890) (-2102.838) * (-2100.171) (-2097.162) [-2104.241] (-2096.076) -- 0:07:05 7500 -- (-2098.163) [-2090.084] (-2094.679) (-2093.066) * (-2094.741) [-2092.418] (-2106.679) (-2098.590) -- 0:06:37 8000 -- (-2095.253) [-2094.760] (-2097.348) (-2095.988) * (-2099.947) [-2094.720] (-2099.484) (-2096.621) -- 0:06:12 8500 -- (-2098.009) [-2096.544] (-2104.876) (-2106.361) * (-2092.676) (-2090.691) (-2107.998) [-2098.689] -- 0:05:49 9000 -- (-2096.767) (-2100.157) (-2096.047) [-2097.651] * [-2095.059] (-2093.737) (-2102.803) (-2099.263) -- 0:05:30 9500 -- (-2097.702) (-2101.115) (-2097.194) [-2094.488] * (-2091.391) [-2099.147] (-2102.874) (-2093.950) -- 0:05:12 10000 -- (-2098.926) [-2093.547] (-2099.096) (-2096.190) * (-2097.917) (-2096.589) (-2094.479) [-2092.214] -- 0:04:57 Average standard deviation of split frequencies: 0.033146 10500 -- (-2097.670) [-2094.844] (-2095.796) (-2107.806) * (-2096.513) (-2099.560) [-2102.529] (-2092.367) -- 0:06:16 11000 -- (-2097.756) (-2104.877) [-2092.146] (-2104.855) * (-2101.000) (-2095.381) (-2099.849) [-2094.826] -- 0:05:59 11500 -- (-2093.964) (-2106.041) (-2095.837) [-2094.735] * (-2103.299) (-2095.611) (-2090.864) [-2096.033] -- 0:05:43 12000 -- (-2094.542) (-2099.026) [-2097.031] (-2093.007) * (-2096.202) [-2093.319] (-2093.711) (-2100.752) -- 0:05:29 12500 -- (-2095.708) (-2100.352) [-2097.227] (-2096.918) * (-2094.455) [-2097.245] (-2091.875) (-2099.985) -- 0:05:16 13000 -- [-2099.230] (-2099.746) (-2090.963) (-2095.324) * (-2101.065) [-2095.661] (-2095.820) (-2098.193) -- 0:05:03 13500 -- (-2097.387) (-2096.482) [-2099.142] (-2097.548) * (-2093.945) (-2097.169) [-2104.664] (-2099.796) -- 0:06:05 14000 -- [-2095.838] (-2094.455) (-2102.965) (-2092.651) * [-2095.765] (-2094.809) (-2103.958) (-2092.591) -- 0:05:52 14500 -- [-2098.103] (-2101.345) (-2099.043) (-2099.162) * (-2093.263) (-2102.975) [-2102.549] (-2099.335) -- 0:05:39 15000 -- (-2104.023) (-2094.721) (-2101.775) [-2092.449] * (-2100.432) (-2103.029) [-2102.292] (-2103.537) -- 0:05:28 Average standard deviation of split frequencies: 0.014731 15500 -- (-2100.775) [-2093.195] (-2093.953) (-2092.679) * (-2098.139) [-2091.588] (-2099.865) (-2096.267) -- 0:05:17 16000 -- (-2107.645) [-2094.982] (-2106.489) (-2100.944) * (-2100.560) (-2097.711) [-2095.964] (-2096.374) -- 0:05:07 16500 -- [-2095.575] (-2095.574) (-2106.771) (-2104.140) * (-2101.615) (-2096.537) [-2100.472] (-2099.306) -- 0:04:58 17000 -- (-2097.405) (-2099.165) (-2099.792) [-2098.641] * (-2096.507) (-2098.830) (-2109.789) [-2102.347] -- 0:05:46 17500 -- (-2097.634) [-2095.476] (-2104.708) (-2100.652) * (-2095.171) (-2096.108) [-2102.964] (-2100.616) -- 0:05:36 18000 -- [-2093.936] (-2097.145) (-2103.792) (-2100.379) * (-2099.637) (-2094.266) [-2097.713] (-2094.625) -- 0:05:27 18500 -- (-2088.719) (-2096.214) [-2094.990] (-2097.791) * (-2094.687) [-2092.123] (-2097.854) (-2088.602) -- 0:05:18 19000 -- [-2095.930] (-2098.922) (-2094.756) (-2092.702) * (-2092.312) (-2093.438) (-2095.698) [-2098.328] -- 0:05:09 19500 -- (-2101.287) (-2098.467) [-2091.006] (-2101.116) * (-2103.219) (-2093.815) [-2101.717] (-2099.584) -- 0:05:01 20000 -- (-2100.870) (-2098.042) (-2096.790) [-2098.870] * (-2100.609) (-2096.574) [-2094.996] (-2104.523) -- 0:05:43 Average standard deviation of split frequencies: 0.017107 20500 -- (-2108.249) [-2092.016] (-2099.518) (-2101.275) * (-2096.453) (-2090.044) [-2089.201] (-2098.484) -- 0:05:34 21000 -- (-2096.912) [-2100.248] (-2097.145) (-2101.130) * [-2092.618] (-2100.331) (-2102.509) (-2093.710) -- 0:05:26 21500 -- (-2099.866) [-2094.757] (-2094.763) (-2096.479) * [-2098.015] (-2102.990) (-2093.788) (-2099.783) -- 0:05:18 22000 -- (-2104.830) (-2094.571) [-2097.273] (-2090.790) * (-2096.059) [-2096.878] (-2096.435) (-2090.688) -- 0:05:11 22500 -- (-2103.433) (-2095.257) [-2093.297] (-2088.710) * (-2098.329) (-2094.147) (-2102.209) [-2098.417] -- 0:05:04 23000 -- (-2101.826) (-2093.293) (-2098.591) [-2095.717] * [-2101.180] (-2091.868) (-2102.218) (-2100.033) -- 0:04:57 23500 -- (-2097.730) [-2096.471] (-2100.586) (-2095.153) * (-2099.120) (-2092.412) [-2093.080] (-2094.332) -- 0:05:32 24000 -- (-2094.429) [-2098.618] (-2096.639) (-2094.374) * (-2091.875) (-2101.151) (-2092.685) [-2096.029] -- 0:05:25 24500 -- (-2095.170) (-2091.217) (-2096.111) [-2095.316] * (-2099.396) [-2094.077] (-2091.787) (-2093.592) -- 0:05:18 25000 -- [-2094.908] (-2093.498) (-2093.078) (-2100.925) * (-2094.820) (-2095.727) (-2100.506) [-2092.511] -- 0:05:12 Average standard deviation of split frequencies: 0.013598 25500 -- (-2102.415) (-2090.760) (-2097.879) [-2089.507] * (-2104.685) (-2095.758) (-2094.908) [-2098.067] -- 0:05:05 26000 -- (-2098.041) (-2093.832) [-2088.294] (-2089.527) * [-2098.027] (-2098.186) (-2093.379) (-2095.293) -- 0:04:59 26500 -- (-2100.800) (-2092.409) (-2090.082) [-2092.806] * (-2100.066) (-2109.616) (-2096.491) [-2100.440] -- 0:05:30 27000 -- (-2097.598) [-2097.138] (-2099.907) (-2093.933) * (-2096.342) (-2101.231) (-2098.843) [-2097.458] -- 0:05:24 27500 -- (-2091.965) (-2102.629) [-2091.157] (-2097.259) * [-2094.240] (-2100.466) (-2103.796) (-2095.787) -- 0:05:18 28000 -- (-2095.989) (-2093.817) [-2095.111] (-2099.416) * (-2102.524) (-2094.343) (-2098.355) [-2093.186] -- 0:05:12 28500 -- (-2104.124) (-2100.615) (-2105.755) [-2093.961] * (-2098.128) (-2092.474) (-2102.872) [-2091.589] -- 0:05:06 29000 -- (-2096.652) (-2093.974) (-2096.316) [-2095.153] * (-2099.092) [-2089.872] (-2097.772) (-2092.944) -- 0:05:01 29500 -- (-2096.479) [-2091.710] (-2104.364) (-2098.464) * (-2093.527) (-2100.362) (-2094.739) [-2092.257] -- 0:04:56 30000 -- [-2101.891] (-2095.811) (-2100.086) (-2098.686) * (-2097.539) [-2094.429] (-2099.640) (-2097.947) -- 0:05:23 Average standard deviation of split frequencies: 0.019215 30500 -- (-2102.542) (-2102.026) [-2097.101] (-2097.746) * [-2094.517] (-2098.860) (-2095.801) (-2097.622) -- 0:05:17 31000 -- [-2101.893] (-2112.907) (-2105.285) (-2094.440) * (-2102.299) (-2094.408) (-2103.566) [-2100.455] -- 0:05:12 31500 -- (-2098.768) (-2096.482) [-2100.145] (-2095.646) * (-2104.179) (-2100.240) (-2104.223) [-2096.095] -- 0:05:07 32000 -- (-2094.463) (-2092.489) [-2093.190] (-2100.970) * [-2100.322] (-2102.368) (-2103.136) (-2106.341) -- 0:05:02 32500 -- [-2094.281] (-2094.224) (-2096.201) (-2095.336) * [-2092.011] (-2100.635) (-2094.346) (-2095.400) -- 0:04:57 33000 -- (-2096.709) (-2107.092) [-2097.112] (-2094.334) * [-2092.205] (-2096.750) (-2094.932) (-2098.592) -- 0:04:53 33500 -- (-2099.355) (-2096.819) (-2099.377) [-2095.193] * (-2097.967) (-2102.258) [-2093.542] (-2105.250) -- 0:05:17 34000 -- (-2104.503) [-2105.344] (-2096.659) (-2096.246) * (-2097.519) [-2103.535] (-2092.829) (-2099.267) -- 0:05:12 34500 -- (-2099.834) [-2094.418] (-2100.793) (-2094.568) * (-2100.263) (-2096.534) (-2094.321) [-2099.429] -- 0:05:07 35000 -- (-2099.723) (-2097.464) [-2099.588] (-2094.394) * (-2100.237) (-2101.550) (-2106.770) [-2096.877] -- 0:05:03 Average standard deviation of split frequencies: 0.026189 35500 -- (-2110.051) [-2101.414] (-2099.787) (-2092.749) * (-2102.783) (-2096.926) (-2097.145) [-2098.243] -- 0:04:58 36000 -- (-2103.005) [-2101.276] (-2091.738) (-2098.417) * (-2105.021) [-2098.442] (-2092.431) (-2101.858) -- 0:04:54 36500 -- (-2109.062) [-2092.250] (-2097.107) (-2097.111) * (-2111.321) (-2092.736) (-2094.309) [-2093.041] -- 0:05:16 37000 -- (-2099.194) [-2089.693] (-2103.795) (-2095.973) * (-2099.938) (-2105.467) (-2094.475) [-2094.408] -- 0:05:12 37500 -- (-2101.750) (-2095.121) [-2096.056] (-2097.793) * (-2097.304) (-2104.779) [-2101.327] (-2103.244) -- 0:05:08 38000 -- [-2101.079] (-2100.749) (-2096.785) (-2099.263) * (-2101.919) [-2093.303] (-2094.196) (-2099.396) -- 0:05:03 38500 -- (-2096.647) (-2103.941) (-2096.229) [-2092.724] * (-2094.693) (-2092.831) [-2094.437] (-2097.419) -- 0:04:59 39000 -- (-2090.192) (-2098.314) (-2101.433) [-2095.646] * [-2094.731] (-2093.935) (-2100.537) (-2094.409) -- 0:04:55 39500 -- (-2094.814) (-2106.243) (-2097.329) [-2096.894] * (-2088.317) (-2095.933) (-2101.633) [-2098.744] -- 0:04:51 40000 -- (-2094.887) [-2095.164] (-2090.200) (-2096.154) * [-2102.020] (-2098.030) (-2091.030) (-2093.237) -- 0:05:12 Average standard deviation of split frequencies: 0.023184 40500 -- [-2097.509] (-2101.883) (-2094.340) (-2093.542) * (-2098.523) (-2096.002) [-2095.869] (-2100.115) -- 0:05:07 41000 -- (-2099.437) (-2098.300) (-2098.737) [-2094.922] * (-2095.146) (-2094.440) [-2094.309] (-2093.525) -- 0:05:04 41500 -- [-2092.330] (-2095.326) (-2097.008) (-2095.046) * (-2102.797) [-2097.571] (-2095.145) (-2101.045) -- 0:05:00 42000 -- [-2095.201] (-2097.434) (-2092.601) (-2101.952) * (-2093.867) (-2097.673) (-2096.798) [-2095.874] -- 0:04:56 42500 -- (-2090.795) [-2098.333] (-2096.400) (-2098.444) * [-2095.145] (-2093.759) (-2092.425) (-2101.852) -- 0:04:52 43000 -- (-2094.484) [-2096.422] (-2095.870) (-2093.551) * (-2101.901) (-2098.287) (-2094.682) [-2098.474] -- 0:04:49 43500 -- [-2100.649] (-2095.403) (-2100.559) (-2098.006) * (-2102.446) (-2100.772) [-2092.592] (-2100.718) -- 0:05:07 44000 -- (-2098.609) [-2092.281] (-2095.662) (-2103.319) * [-2097.141] (-2097.644) (-2099.343) (-2104.868) -- 0:05:04 44500 -- [-2096.727] (-2097.958) (-2094.940) (-2100.304) * (-2088.184) [-2098.254] (-2096.660) (-2103.781) -- 0:05:00 45000 -- [-2096.718] (-2095.255) (-2102.380) (-2101.206) * (-2093.519) (-2092.863) [-2097.150] (-2102.311) -- 0:04:57 Average standard deviation of split frequencies: 0.030744 45500 -- (-2091.206) (-2096.261) (-2098.284) [-2095.579] * (-2092.877) [-2098.101] (-2091.346) (-2102.867) -- 0:04:53 46000 -- (-2097.318) (-2097.872) [-2093.158] (-2096.375) * [-2091.106] (-2092.088) (-2096.395) (-2104.838) -- 0:04:50 46500 -- (-2094.423) (-2095.347) (-2091.728) [-2093.573] * (-2095.660) (-2099.195) [-2090.908] (-2103.403) -- 0:05:07 47000 -- [-2098.670] (-2095.289) (-2098.024) (-2094.693) * (-2090.178) [-2091.673] (-2102.944) (-2112.868) -- 0:05:04 47500 -- (-2095.133) (-2098.645) (-2103.367) [-2092.680] * (-2100.982) (-2092.226) [-2090.414] (-2107.552) -- 0:05:00 48000 -- [-2101.153] (-2097.056) (-2098.086) (-2102.417) * (-2096.344) [-2093.647] (-2097.280) (-2098.710) -- 0:04:57 48500 -- (-2096.103) [-2093.926] (-2092.620) (-2100.371) * (-2103.938) (-2096.173) [-2093.050] (-2104.640) -- 0:04:54 49000 -- (-2094.375) (-2099.784) (-2094.657) [-2089.925] * (-2097.103) [-2099.302] (-2097.630) (-2103.294) -- 0:04:51 49500 -- [-2098.620] (-2110.469) (-2102.846) (-2092.737) * (-2098.762) (-2094.924) (-2100.382) [-2101.153] -- 0:05:07 50000 -- (-2096.671) [-2098.978] (-2106.712) (-2093.828) * (-2090.432) [-2104.882] (-2097.382) (-2096.513) -- 0:05:04 Average standard deviation of split frequencies: 0.018608 50500 -- (-2101.341) [-2094.715] (-2099.518) (-2100.955) * (-2097.839) [-2094.680] (-2096.565) (-2092.690) -- 0:05:00 51000 -- [-2095.995] (-2099.809) (-2100.633) (-2098.236) * (-2094.240) (-2095.663) (-2099.630) [-2096.309] -- 0:04:57 51500 -- (-2093.696) (-2099.103) [-2102.051] (-2100.138) * (-2093.467) (-2097.329) (-2098.398) [-2091.260] -- 0:04:54 52000 -- (-2098.731) (-2094.820) [-2096.625] (-2094.377) * [-2095.026] (-2097.047) (-2094.495) (-2101.155) -- 0:04:51 52500 -- (-2100.402) [-2089.385] (-2096.659) (-2096.304) * (-2097.251) (-2098.659) [-2100.043] (-2096.557) -- 0:04:48 53000 -- [-2099.028] (-2094.268) (-2093.794) (-2104.970) * (-2104.616) [-2095.689] (-2101.387) (-2098.200) -- 0:05:03 53500 -- [-2100.549] (-2098.434) (-2092.669) (-2098.768) * (-2095.488) (-2096.469) [-2090.571] (-2091.102) -- 0:05:00 54000 -- [-2099.449] (-2101.468) (-2097.355) (-2095.909) * (-2101.201) (-2103.094) (-2095.914) [-2095.527] -- 0:04:57 54500 -- (-2091.267) (-2102.149) (-2102.024) [-2089.124] * (-2093.318) (-2100.921) (-2098.912) [-2096.350] -- 0:04:54 55000 -- [-2092.468] (-2091.377) (-2096.904) (-2101.330) * (-2095.596) (-2100.646) (-2099.997) [-2093.704] -- 0:04:52 Average standard deviation of split frequencies: 0.018940 55500 -- (-2094.906) (-2097.965) [-2097.344] (-2092.050) * (-2096.896) (-2111.129) (-2099.952) [-2099.369] -- 0:04:49 56000 -- [-2089.923] (-2097.140) (-2104.418) (-2093.673) * (-2093.454) [-2097.155] (-2094.517) (-2096.786) -- 0:04:46 56500 -- (-2090.643) [-2089.430] (-2098.023) (-2096.925) * (-2094.396) (-2102.935) [-2095.959] (-2093.683) -- 0:05:00 57000 -- (-2094.665) (-2089.855) (-2098.045) [-2093.538] * (-2098.462) [-2095.974] (-2102.177) (-2093.519) -- 0:04:57 57500 -- (-2087.388) (-2095.710) (-2093.157) [-2097.611] * [-2094.781] (-2096.709) (-2095.703) (-2101.532) -- 0:04:55 58000 -- (-2107.217) (-2094.491) (-2098.297) [-2094.411] * (-2095.263) [-2094.897] (-2093.882) (-2103.378) -- 0:04:52 58500 -- (-2100.856) (-2096.940) (-2091.658) [-2097.512] * (-2094.109) (-2099.994) (-2094.825) [-2097.859] -- 0:04:49 59000 -- (-2100.699) (-2101.893) (-2110.225) [-2093.798] * (-2092.123) (-2094.841) [-2097.612] (-2101.230) -- 0:04:47 59500 -- (-2100.036) (-2092.468) [-2100.144] (-2093.897) * [-2092.383] (-2097.144) (-2111.362) (-2099.605) -- 0:05:00 60000 -- (-2103.550) (-2099.453) (-2093.847) [-2093.088] * (-2092.380) (-2099.724) (-2102.319) [-2095.294] -- 0:04:57 Average standard deviation of split frequencies: 0.025254 60500 -- (-2105.576) (-2092.392) (-2099.097) [-2094.230] * (-2101.091) (-2094.951) (-2096.891) [-2097.296] -- 0:04:55 61000 -- [-2094.330] (-2102.329) (-2093.864) (-2096.953) * (-2095.124) (-2094.385) [-2096.988] (-2097.126) -- 0:04:52 61500 -- (-2098.885) (-2097.928) (-2096.190) [-2096.762] * (-2095.980) [-2094.647] (-2104.346) (-2099.511) -- 0:04:49 62000 -- (-2100.058) (-2094.709) (-2096.334) [-2096.084] * [-2090.411] (-2095.156) (-2098.860) (-2098.716) -- 0:04:47 62500 -- (-2099.541) (-2099.328) (-2095.940) [-2093.920] * (-2095.968) [-2096.509] (-2103.057) (-2098.081) -- 0:04:45 63000 -- [-2098.982] (-2098.991) (-2096.440) (-2096.302) * (-2093.606) (-2094.622) [-2097.559] (-2101.091) -- 0:04:57 63500 -- (-2100.812) (-2103.739) (-2100.811) [-2104.688] * (-2094.887) (-2101.228) (-2104.589) [-2092.455] -- 0:04:54 64000 -- (-2093.087) [-2091.478] (-2104.238) (-2102.693) * (-2099.573) [-2093.557] (-2105.809) (-2099.094) -- 0:04:52 64500 -- (-2096.051) [-2095.328] (-2101.943) (-2094.224) * (-2095.527) (-2091.187) [-2092.648] (-2099.769) -- 0:04:50 65000 -- [-2095.877] (-2093.882) (-2104.238) (-2096.739) * (-2094.040) (-2090.709) (-2098.509) [-2095.120] -- 0:04:47 Average standard deviation of split frequencies: 0.023213 65500 -- (-2096.113) (-2090.712) [-2094.842] (-2098.273) * (-2095.652) (-2087.335) (-2104.298) [-2091.193] -- 0:04:45 66000 -- [-2093.480] (-2094.364) (-2095.721) (-2109.305) * (-2095.540) [-2106.966] (-2101.678) (-2093.989) -- 0:04:43 66500 -- (-2099.333) (-2099.798) [-2095.124] (-2097.110) * (-2098.396) (-2104.515) [-2091.515] (-2095.556) -- 0:04:54 67000 -- (-2095.833) (-2107.772) [-2094.886] (-2096.715) * (-2095.752) [-2094.255] (-2093.640) (-2099.662) -- 0:04:52 67500 -- (-2104.595) (-2098.722) [-2096.418] (-2093.792) * [-2093.870] (-2106.697) (-2101.587) (-2095.892) -- 0:04:50 68000 -- (-2094.839) [-2097.995] (-2098.086) (-2095.854) * [-2092.925] (-2102.365) (-2098.364) (-2098.258) -- 0:04:47 68500 -- [-2092.205] (-2100.761) (-2096.695) (-2092.205) * (-2094.625) [-2096.938] (-2094.473) (-2095.628) -- 0:04:45 69000 -- [-2093.819] (-2099.475) (-2097.920) (-2094.627) * (-2096.817) [-2094.955] (-2097.636) (-2101.165) -- 0:04:43 69500 -- (-2101.301) (-2100.168) [-2095.576] (-2095.749) * (-2094.433) (-2101.760) (-2101.123) [-2093.174] -- 0:04:54 70000 -- [-2094.994] (-2099.176) (-2095.485) (-2090.880) * [-2094.723] (-2090.420) (-2099.825) (-2105.512) -- 0:04:52 Average standard deviation of split frequencies: 0.015009 70500 -- [-2089.128] (-2097.926) (-2096.833) (-2095.724) * (-2091.659) [-2092.559] (-2104.102) (-2091.855) -- 0:04:50 71000 -- (-2092.612) [-2101.314] (-2094.060) (-2096.281) * (-2096.758) (-2097.288) (-2093.425) [-2096.947] -- 0:04:47 71500 -- (-2096.760) (-2098.564) (-2098.617) [-2093.478] * (-2098.406) (-2094.878) [-2089.258] (-2093.930) -- 0:04:45 72000 -- (-2094.946) (-2102.057) [-2095.142] (-2096.485) * [-2097.118] (-2101.594) (-2099.700) (-2097.636) -- 0:04:43 72500 -- (-2092.156) (-2109.273) [-2094.531] (-2098.419) * (-2098.919) (-2095.926) (-2098.130) [-2097.365] -- 0:04:41 73000 -- [-2093.302] (-2107.437) (-2093.358) (-2098.732) * (-2092.332) (-2093.378) [-2095.131] (-2099.861) -- 0:04:52 73500 -- (-2094.829) (-2094.288) [-2094.720] (-2103.290) * (-2091.589) (-2104.227) (-2099.462) [-2099.985] -- 0:04:49 74000 -- (-2097.353) (-2105.699) (-2103.330) [-2091.667] * (-2099.364) (-2099.151) [-2092.814] (-2098.530) -- 0:04:47 74500 -- (-2096.428) [-2090.145] (-2091.834) (-2095.008) * (-2117.919) (-2098.322) (-2096.216) [-2099.041] -- 0:04:45 75000 -- (-2101.339) [-2094.474] (-2093.405) (-2104.392) * (-2109.892) (-2098.846) (-2093.909) [-2091.854] -- 0:04:43 Average standard deviation of split frequencies: 0.015507 75500 -- (-2096.326) (-2094.372) (-2091.783) [-2096.147] * [-2095.450] (-2101.539) (-2093.983) (-2098.961) -- 0:04:41 76000 -- (-2094.822) [-2098.002] (-2096.128) (-2094.029) * (-2096.301) (-2100.731) [-2094.954] (-2093.137) -- 0:04:39 76500 -- (-2093.704) (-2099.609) (-2091.207) [-2091.277] * (-2096.131) (-2103.655) [-2094.513] (-2094.001) -- 0:04:49 77000 -- (-2100.055) (-2092.016) (-2090.993) [-2091.922] * (-2095.674) (-2104.809) [-2096.429] (-2091.290) -- 0:04:47 77500 -- (-2096.072) [-2099.306] (-2104.506) (-2095.676) * (-2099.089) [-2093.484] (-2100.284) (-2092.235) -- 0:04:45 78000 -- (-2098.079) (-2097.841) [-2091.580] (-2097.199) * (-2096.544) (-2095.208) (-2100.520) [-2089.909] -- 0:04:43 78500 -- [-2094.330] (-2093.417) (-2096.706) (-2093.592) * (-2100.884) [-2094.777] (-2107.257) (-2094.634) -- 0:04:41 79000 -- (-2096.880) (-2096.905) (-2094.288) [-2097.140] * (-2102.145) (-2101.463) [-2096.514] (-2099.450) -- 0:04:39 79500 -- (-2093.350) (-2098.346) [-2092.431] (-2110.040) * (-2096.811) (-2094.493) (-2107.877) [-2090.725] -- 0:04:49 80000 -- (-2102.095) (-2090.521) [-2095.666] (-2100.964) * [-2093.004] (-2097.728) (-2094.506) (-2099.414) -- 0:04:47 Average standard deviation of split frequencies: 0.014610 80500 -- (-2095.823) [-2091.267] (-2096.471) (-2097.135) * [-2099.436] (-2095.817) (-2103.749) (-2102.297) -- 0:04:45 81000 -- [-2095.579] (-2094.482) (-2106.328) (-2094.874) * (-2099.664) [-2093.618] (-2094.983) (-2100.993) -- 0:04:43 81500 -- (-2095.785) [-2092.502] (-2091.244) (-2098.830) * (-2096.999) (-2095.495) (-2104.219) [-2098.798] -- 0:04:41 82000 -- [-2094.183] (-2094.981) (-2091.858) (-2100.994) * (-2096.574) (-2100.868) [-2094.253] (-2092.858) -- 0:04:39 82500 -- (-2099.266) (-2102.438) [-2098.633] (-2100.345) * (-2097.707) [-2096.130] (-2092.192) (-2105.452) -- 0:04:38 83000 -- [-2103.164] (-2091.813) (-2097.766) (-2091.601) * (-2093.644) [-2098.521] (-2097.818) (-2096.836) -- 0:04:47 83500 -- [-2094.790] (-2105.847) (-2091.091) (-2096.697) * [-2091.548] (-2092.603) (-2096.831) (-2096.145) -- 0:04:45 84000 -- [-2102.916] (-2107.025) (-2096.440) (-2094.970) * [-2094.339] (-2100.408) (-2091.673) (-2095.231) -- 0:04:43 84500 -- [-2097.494] (-2105.291) (-2093.996) (-2100.111) * (-2101.769) (-2097.260) [-2095.302] (-2098.636) -- 0:04:41 85000 -- (-2098.336) (-2096.022) (-2100.250) [-2105.752] * (-2098.406) (-2097.232) [-2090.295] (-2102.983) -- 0:04:39 Average standard deviation of split frequencies: 0.012333 85500 -- (-2102.328) (-2101.939) (-2099.233) [-2098.204] * [-2092.343] (-2103.791) (-2098.244) (-2095.283) -- 0:04:38 86000 -- (-2102.792) [-2099.793] (-2110.912) (-2089.887) * (-2093.581) [-2098.754] (-2097.238) (-2094.396) -- 0:04:36 86500 -- (-2102.998) (-2098.616) (-2091.758) [-2095.201] * (-2098.038) (-2097.908) [-2092.882] (-2095.500) -- 0:04:45 87000 -- (-2104.730) (-2099.788) (-2098.305) [-2092.406] * [-2097.687] (-2094.371) (-2096.370) (-2096.857) -- 0:04:43 87500 -- (-2092.601) (-2114.820) [-2088.769] (-2098.866) * [-2093.864] (-2100.189) (-2096.903) (-2095.815) -- 0:04:41 88000 -- (-2097.445) [-2093.447] (-2096.995) (-2100.984) * (-2107.327) [-2097.117] (-2106.924) (-2090.688) -- 0:04:39 88500 -- (-2095.838) (-2107.482) [-2094.441] (-2091.919) * (-2114.579) (-2099.765) [-2093.505] (-2098.899) -- 0:04:38 89000 -- (-2100.069) [-2095.251] (-2093.861) (-2094.167) * [-2094.713] (-2101.841) (-2098.635) (-2106.159) -- 0:04:36 89500 -- (-2100.293) [-2093.372] (-2094.800) (-2094.223) * (-2101.121) (-2104.207) [-2093.686] (-2096.853) -- 0:04:44 90000 -- (-2096.296) (-2091.850) (-2094.597) [-2105.498] * (-2097.541) (-2091.276) (-2095.014) [-2093.001] -- 0:04:43 Average standard deviation of split frequencies: 0.014298 90500 -- (-2089.838) (-2097.368) (-2095.815) [-2095.141] * (-2097.402) (-2100.531) [-2091.989] (-2094.170) -- 0:04:41 91000 -- (-2091.439) (-2093.927) (-2097.673) [-2095.498] * (-2100.296) (-2098.676) (-2094.497) [-2105.500] -- 0:04:39 91500 -- (-2097.009) (-2097.955) (-2095.219) [-2093.947] * (-2103.168) (-2096.550) (-2095.234) [-2094.866] -- 0:04:38 92000 -- [-2096.870] (-2100.340) (-2094.421) (-2092.576) * [-2095.619] (-2104.892) (-2096.519) (-2101.512) -- 0:04:36 92500 -- (-2103.542) (-2091.980) (-2093.319) [-2099.043] * (-2102.762) [-2102.469] (-2095.035) (-2093.662) -- 0:04:34 93000 -- (-2097.581) (-2095.065) (-2102.474) [-2098.026] * (-2097.900) [-2102.166] (-2098.445) (-2095.139) -- 0:04:42 93500 -- (-2096.348) [-2103.768] (-2096.112) (-2095.247) * (-2101.390) [-2095.953] (-2098.154) (-2096.272) -- 0:04:41 94000 -- [-2093.777] (-2109.721) (-2100.863) (-2102.055) * [-2097.505] (-2098.110) (-2093.151) (-2101.481) -- 0:04:39 94500 -- [-2103.079] (-2098.397) (-2099.372) (-2098.528) * (-2095.727) (-2094.132) (-2099.459) [-2096.613] -- 0:04:37 95000 -- (-2095.354) (-2096.429) [-2095.827] (-2100.479) * (-2094.422) (-2097.115) [-2094.932] (-2099.344) -- 0:04:36 Average standard deviation of split frequencies: 0.015959 95500 -- [-2100.366] (-2099.060) (-2093.659) (-2097.278) * (-2098.845) [-2096.561] (-2095.350) (-2107.168) -- 0:04:34 96000 -- (-2100.350) (-2107.297) (-2095.765) [-2095.952] * (-2098.810) (-2094.516) [-2096.962] (-2108.966) -- 0:04:42 96500 -- [-2108.622] (-2108.425) (-2104.216) (-2095.746) * (-2101.115) (-2096.760) [-2094.063] (-2102.013) -- 0:04:40 97000 -- (-2091.887) (-2101.937) (-2117.408) [-2089.205] * (-2096.999) (-2100.798) [-2092.398] (-2098.690) -- 0:04:39 97500 -- [-2097.368] (-2106.408) (-2105.443) (-2097.117) * (-2106.191) (-2104.604) (-2091.018) [-2092.334] -- 0:04:37 98000 -- [-2102.253] (-2101.509) (-2097.258) (-2095.611) * (-2096.891) (-2101.052) (-2092.540) [-2095.074] -- 0:04:36 98500 -- (-2095.646) (-2101.879) (-2103.102) [-2093.225] * [-2103.198] (-2106.533) (-2098.533) (-2105.449) -- 0:04:34 99000 -- (-2100.800) [-2092.308] (-2092.180) (-2099.914) * [-2099.965] (-2101.246) (-2100.129) (-2096.411) -- 0:04:33 99500 -- [-2102.722] (-2096.116) (-2097.953) (-2103.781) * (-2101.176) (-2106.643) (-2103.677) [-2102.066] -- 0:04:40 100000 -- (-2096.307) (-2090.340) [-2099.853] (-2100.632) * (-2099.886) (-2093.102) (-2103.305) [-2097.504] -- 0:04:39 Average standard deviation of split frequencies: 0.009366 100500 -- (-2102.745) (-2098.343) (-2092.372) [-2100.690] * (-2098.637) (-2092.440) (-2102.400) [-2094.920] -- 0:04:37 101000 -- (-2100.757) (-2099.623) (-2102.253) [-2099.621] * [-2094.938] (-2096.803) (-2116.428) (-2091.352) -- 0:04:35 101500 -- [-2093.698] (-2094.966) (-2098.487) (-2090.980) * (-2101.280) (-2100.458) (-2101.438) [-2094.598] -- 0:04:34 102000 -- (-2091.508) [-2093.815] (-2099.716) (-2095.217) * [-2093.495] (-2100.779) (-2097.914) (-2098.653) -- 0:04:32 102500 -- [-2096.662] (-2098.499) (-2098.979) (-2095.425) * (-2098.074) (-2095.813) (-2104.889) [-2095.115] -- 0:04:40 103000 -- (-2102.054) (-2098.273) [-2093.216] (-2095.076) * [-2100.658] (-2104.315) (-2091.954) (-2093.515) -- 0:04:38 103500 -- [-2098.322] (-2091.012) (-2097.458) (-2095.062) * (-2092.629) (-2096.331) (-2097.491) [-2093.284] -- 0:04:37 104000 -- [-2099.764] (-2097.455) (-2091.051) (-2094.721) * (-2098.848) [-2097.941] (-2104.493) (-2095.487) -- 0:04:35 104500 -- [-2097.987] (-2099.467) (-2095.067) (-2092.052) * [-2099.640] (-2098.454) (-2098.895) (-2102.458) -- 0:04:34 105000 -- (-2097.239) (-2100.899) (-2094.020) [-2094.888] * [-2093.358] (-2099.344) (-2096.037) (-2097.712) -- 0:04:32 Average standard deviation of split frequencies: 0.011118 105500 -- (-2092.544) (-2095.254) (-2095.897) [-2098.121] * (-2100.946) (-2093.846) (-2098.622) [-2092.147] -- 0:04:31 106000 -- (-2092.623) [-2095.749] (-2092.628) (-2095.039) * (-2106.218) (-2104.023) (-2094.032) [-2101.459] -- 0:04:38 106500 -- [-2098.780] (-2095.932) (-2099.889) (-2097.431) * [-2091.408] (-2098.932) (-2097.169) (-2100.841) -- 0:04:36 107000 -- (-2100.752) [-2092.510] (-2093.321) (-2104.166) * (-2093.735) (-2101.834) [-2092.495] (-2095.540) -- 0:04:35 107500 -- (-2091.160) (-2096.390) [-2094.805] (-2095.853) * (-2105.488) [-2092.869] (-2095.858) (-2107.124) -- 0:04:33 108000 -- [-2093.433] (-2100.341) (-2094.344) (-2094.221) * (-2098.060) (-2109.568) (-2097.319) [-2098.220] -- 0:04:32 108500 -- (-2089.739) (-2101.708) (-2091.574) [-2092.132] * (-2101.129) (-2103.819) (-2095.777) [-2100.775] -- 0:04:31 109000 -- (-2094.576) (-2100.591) [-2097.591] (-2091.856) * (-2103.625) [-2099.835] (-2091.486) (-2093.196) -- 0:04:37 109500 -- (-2098.692) (-2097.727) [-2098.248] (-2098.394) * (-2102.324) (-2105.932) [-2096.369] (-2101.463) -- 0:04:36 110000 -- [-2092.998] (-2095.288) (-2100.658) (-2097.131) * (-2105.947) (-2110.003) [-2101.209] (-2103.501) -- 0:04:35 Average standard deviation of split frequencies: 0.010649 110500 -- (-2097.973) (-2098.023) (-2098.082) [-2094.775] * (-2100.345) (-2094.263) [-2093.599] (-2095.648) -- 0:04:33 111000 -- (-2098.211) (-2101.191) [-2095.916] (-2103.721) * [-2092.578] (-2098.421) (-2101.870) (-2092.388) -- 0:04:32 111500 -- (-2096.890) (-2094.825) [-2097.815] (-2097.244) * (-2094.585) [-2099.525] (-2096.655) (-2104.389) -- 0:04:30 112000 -- (-2105.020) [-2100.867] (-2103.145) (-2097.399) * (-2099.106) (-2103.817) (-2096.248) [-2097.897] -- 0:04:29 112500 -- (-2100.792) (-2093.215) (-2101.931) [-2106.144] * (-2098.757) (-2101.296) [-2092.320] (-2094.261) -- 0:04:36 113000 -- (-2098.473) (-2094.582) (-2098.752) [-2091.472] * [-2099.899] (-2101.071) (-2096.533) (-2097.159) -- 0:04:34 113500 -- [-2102.383] (-2101.078) (-2097.020) (-2097.504) * [-2098.363] (-2099.104) (-2096.842) (-2099.425) -- 0:04:33 114000 -- (-2095.543) (-2099.377) (-2103.803) [-2108.714] * (-2093.860) (-2090.455) (-2102.204) [-2090.743] -- 0:04:32 114500 -- (-2100.276) [-2097.970] (-2101.521) (-2096.609) * (-2103.717) (-2098.694) [-2099.145] (-2098.707) -- 0:04:30 115000 -- [-2093.994] (-2103.676) (-2105.885) (-2103.906) * (-2097.535) [-2098.563] (-2100.016) (-2093.360) -- 0:04:29 Average standard deviation of split frequencies: 0.009144 115500 -- (-2091.120) [-2097.147] (-2093.595) (-2099.684) * [-2092.500] (-2092.963) (-2102.922) (-2094.284) -- 0:04:35 116000 -- (-2091.624) (-2099.722) [-2091.733] (-2096.589) * [-2090.490] (-2095.412) (-2103.297) (-2098.230) -- 0:04:34 116500 -- [-2094.405] (-2103.299) (-2094.463) (-2101.262) * [-2092.882] (-2092.636) (-2099.054) (-2097.622) -- 0:04:33 117000 -- (-2091.110) (-2102.592) [-2091.519] (-2100.660) * (-2098.764) [-2094.130] (-2090.715) (-2093.634) -- 0:04:31 117500 -- (-2096.479) (-2100.641) (-2101.028) [-2093.202] * [-2095.732] (-2091.772) (-2095.974) (-2100.421) -- 0:04:30 118000 -- (-2098.628) (-2097.678) (-2099.446) [-2095.453] * [-2092.899] (-2101.933) (-2098.353) (-2097.013) -- 0:04:29 118500 -- (-2098.999) (-2094.206) (-2102.648) [-2092.542] * (-2097.839) (-2098.373) [-2093.979] (-2100.262) -- 0:04:35 119000 -- (-2095.792) [-2100.923] (-2094.715) (-2103.304) * (-2107.348) (-2105.743) [-2098.139] (-2102.630) -- 0:04:33 119500 -- (-2092.044) (-2096.342) [-2095.801] (-2105.675) * (-2099.786) (-2100.972) (-2092.240) [-2093.357] -- 0:04:32 120000 -- [-2089.894] (-2093.108) (-2093.952) (-2107.609) * (-2103.043) (-2097.514) [-2100.948] (-2093.198) -- 0:04:31 Average standard deviation of split frequencies: 0.009767 120500 -- (-2092.700) (-2097.701) (-2095.499) [-2096.384] * [-2101.917] (-2097.888) (-2095.883) (-2097.870) -- 0:04:30 121000 -- [-2090.731] (-2095.019) (-2093.631) (-2097.399) * (-2099.331) (-2105.176) [-2099.506] (-2092.784) -- 0:04:28 121500 -- (-2093.178) (-2098.172) [-2094.317] (-2109.647) * (-2109.501) (-2094.237) [-2094.188] (-2095.966) -- 0:04:27 122000 -- (-2092.608) [-2094.377] (-2097.707) (-2102.170) * [-2096.878] (-2095.525) (-2092.023) (-2094.524) -- 0:04:33 122500 -- (-2090.865) [-2091.592] (-2093.776) (-2102.124) * (-2095.104) (-2091.722) [-2101.238] (-2092.239) -- 0:04:32 123000 -- (-2099.190) (-2104.157) (-2091.452) [-2102.032] * (-2097.868) (-2097.673) (-2098.222) [-2093.825] -- 0:04:30 123500 -- (-2105.395) (-2099.172) [-2095.370] (-2099.424) * [-2093.254] (-2094.233) (-2093.998) (-2091.869) -- 0:04:29 124000 -- [-2092.191] (-2092.951) (-2093.389) (-2097.984) * (-2090.780) (-2096.828) [-2093.234] (-2097.617) -- 0:04:28 124500 -- [-2089.949] (-2093.891) (-2095.124) (-2097.447) * (-2100.853) [-2094.406] (-2093.259) (-2094.512) -- 0:04:27 125000 -- [-2088.320] (-2096.104) (-2100.979) (-2102.451) * (-2103.029) (-2094.110) [-2091.044] (-2103.443) -- 0:04:33 Average standard deviation of split frequencies: 0.009353 125500 -- [-2089.887] (-2100.685) (-2104.862) (-2100.636) * (-2092.924) [-2095.646] (-2100.653) (-2097.057) -- 0:04:31 126000 -- (-2091.588) [-2100.403] (-2105.031) (-2100.824) * (-2099.718) (-2098.048) [-2094.244] (-2097.287) -- 0:04:30 126500 -- (-2096.728) (-2101.047) (-2106.439) [-2095.051] * (-2096.333) (-2093.113) (-2107.569) [-2097.587] -- 0:04:29 127000 -- (-2103.372) (-2096.639) (-2093.163) [-2100.314] * [-2095.176] (-2096.569) (-2099.048) (-2093.558) -- 0:04:28 127500 -- [-2088.758] (-2098.670) (-2103.346) (-2097.477) * (-2091.773) (-2095.070) (-2095.472) [-2093.134] -- 0:04:26 128000 -- (-2094.220) (-2099.460) [-2090.701] (-2093.388) * (-2092.645) (-2098.471) [-2096.950] (-2096.704) -- 0:04:32 128500 -- [-2089.949] (-2095.409) (-2099.330) (-2107.726) * (-2096.470) [-2094.515] (-2108.415) (-2092.017) -- 0:04:31 129000 -- (-2099.486) (-2098.225) (-2095.835) [-2097.747] * [-2093.538] (-2104.125) (-2097.693) (-2101.663) -- 0:04:30 129500 -- (-2106.423) (-2099.532) [-2097.912] (-2103.710) * (-2100.267) (-2097.813) [-2094.777] (-2100.675) -- 0:04:28 130000 -- (-2099.209) (-2102.188) [-2095.264] (-2097.890) * [-2092.652] (-2099.398) (-2092.656) (-2101.831) -- 0:04:27 Average standard deviation of split frequencies: 0.006313 130500 -- (-2094.265) (-2102.143) [-2098.074] (-2104.383) * (-2097.878) (-2097.537) (-2102.952) [-2096.072] -- 0:04:26 131000 -- (-2096.042) (-2096.401) [-2091.576] (-2094.612) * [-2100.298] (-2093.040) (-2094.314) (-2098.709) -- 0:04:25 131500 -- (-2105.773) (-2100.050) [-2095.818] (-2097.868) * [-2098.524] (-2095.867) (-2089.981) (-2104.243) -- 0:04:30 132000 -- [-2096.390] (-2093.458) (-2096.599) (-2097.975) * (-2099.363) (-2098.386) (-2091.392) [-2099.843] -- 0:04:29 132500 -- [-2098.224] (-2093.973) (-2109.122) (-2097.688) * (-2099.218) (-2096.439) (-2101.752) [-2093.943] -- 0:04:28 133000 -- (-2095.467) (-2093.143) [-2093.850] (-2101.449) * (-2099.340) (-2106.314) (-2101.388) [-2100.245] -- 0:04:27 133500 -- (-2101.060) (-2094.033) (-2103.713) [-2101.079] * [-2097.979] (-2094.325) (-2098.756) (-2093.550) -- 0:04:26 134000 -- [-2098.875] (-2096.276) (-2100.795) (-2090.548) * (-2094.185) (-2097.575) (-2094.028) [-2096.476] -- 0:04:24 134500 -- (-2101.475) (-2098.411) [-2101.731] (-2096.041) * (-2092.641) (-2094.647) [-2093.727] (-2094.804) -- 0:04:23 135000 -- (-2098.792) [-2096.606] (-2109.443) (-2096.999) * (-2094.652) [-2100.826] (-2096.285) (-2095.654) -- 0:04:29 Average standard deviation of split frequencies: 0.005199 135500 -- [-2099.513] (-2106.721) (-2098.847) (-2099.022) * (-2092.178) (-2091.614) [-2097.177] (-2100.793) -- 0:04:27 136000 -- (-2096.930) (-2092.138) (-2096.271) [-2101.660] * (-2094.597) [-2100.592] (-2100.776) (-2105.663) -- 0:04:26 136500 -- (-2091.639) (-2103.031) (-2091.450) [-2095.550] * [-2096.176] (-2092.384) (-2096.966) (-2102.534) -- 0:04:25 137000 -- (-2088.472) (-2098.292) [-2091.023] (-2093.918) * [-2097.073] (-2096.326) (-2103.380) (-2095.226) -- 0:04:24 137500 -- (-2096.154) (-2103.128) [-2091.878] (-2095.311) * (-2098.648) (-2095.004) [-2102.358] (-2092.123) -- 0:04:23 138000 -- [-2095.159] (-2094.226) (-2093.971) (-2094.127) * (-2106.263) (-2095.878) [-2089.291] (-2098.959) -- 0:04:28 138500 -- [-2103.349] (-2098.153) (-2098.378) (-2098.559) * (-2101.914) (-2093.996) (-2094.383) [-2092.472] -- 0:04:27 139000 -- (-2102.157) [-2096.712] (-2091.952) (-2095.938) * (-2099.014) [-2097.474] (-2097.591) (-2102.591) -- 0:04:26 139500 -- (-2098.479) (-2103.906) [-2094.658] (-2099.175) * (-2099.288) (-2101.578) [-2094.926] (-2095.112) -- 0:04:25 140000 -- (-2095.686) [-2100.037] (-2099.468) (-2098.988) * [-2097.415] (-2100.725) (-2092.031) (-2090.247) -- 0:04:24 Average standard deviation of split frequencies: 0.003351 140500 -- (-2093.033) (-2103.069) [-2095.983] (-2103.355) * [-2089.652] (-2097.389) (-2092.077) (-2096.727) -- 0:04:23 141000 -- (-2096.602) [-2091.548] (-2104.899) (-2098.440) * [-2096.167] (-2101.826) (-2092.554) (-2094.029) -- 0:04:21 141500 -- (-2094.861) (-2099.339) [-2096.482] (-2099.100) * (-2094.936) (-2103.797) (-2090.816) [-2092.495] -- 0:04:26 142000 -- [-2089.354] (-2096.057) (-2091.540) (-2103.626) * (-2096.145) (-2096.597) (-2096.692) [-2097.291] -- 0:04:25 142500 -- (-2097.232) (-2096.218) [-2091.274] (-2100.548) * (-2098.969) (-2092.482) (-2097.944) [-2096.443] -- 0:04:24 143000 -- [-2094.071] (-2097.758) (-2093.982) (-2102.713) * (-2091.966) (-2103.346) [-2094.946] (-2096.145) -- 0:04:23 143500 -- (-2090.482) [-2097.256] (-2099.657) (-2098.844) * (-2096.618) (-2095.841) (-2099.628) [-2098.362] -- 0:04:22 144000 -- (-2102.565) (-2105.096) (-2104.643) [-2097.488] * (-2097.410) (-2105.647) [-2091.793] (-2093.634) -- 0:04:21 144500 -- [-2093.446] (-2094.511) (-2091.090) (-2099.662) * (-2097.055) [-2091.608] (-2098.084) (-2098.663) -- 0:04:26 145000 -- (-2092.595) [-2096.758] (-2102.359) (-2096.102) * (-2099.916) [-2094.612] (-2103.406) (-2100.672) -- 0:04:25 Average standard deviation of split frequencies: 0.002422 145500 -- (-2098.077) [-2094.681] (-2101.079) (-2097.927) * [-2094.967] (-2098.102) (-2093.213) (-2109.589) -- 0:04:24 146000 -- [-2089.340] (-2101.526) (-2103.757) (-2090.786) * (-2093.851) (-2100.032) (-2091.312) [-2097.125] -- 0:04:23 146500 -- (-2091.298) [-2092.444] (-2099.126) (-2101.233) * (-2088.367) (-2094.297) (-2099.251) [-2099.498] -- 0:04:22 147000 -- (-2098.401) (-2091.723) [-2096.427] (-2096.913) * [-2095.614] (-2094.909) (-2097.460) (-2101.011) -- 0:04:21 147500 -- (-2090.353) (-2094.043) (-2098.528) [-2093.457] * [-2096.268] (-2102.561) (-2091.007) (-2100.038) -- 0:04:20 148000 -- (-2099.827) (-2095.978) (-2099.778) [-2093.134] * [-2101.430] (-2100.519) (-2103.946) (-2089.822) -- 0:04:24 148500 -- (-2103.557) (-2099.535) (-2094.736) [-2095.123] * (-2094.509) (-2093.153) (-2091.642) [-2099.770] -- 0:04:23 149000 -- [-2092.624] (-2107.921) (-2096.280) (-2098.853) * (-2092.302) (-2096.245) [-2096.691] (-2096.152) -- 0:04:22 149500 -- (-2093.977) (-2103.105) [-2094.173] (-2104.183) * (-2094.434) [-2101.077] (-2097.573) (-2105.803) -- 0:04:21 150000 -- [-2099.000] (-2099.138) (-2092.281) (-2099.743) * [-2095.510] (-2101.229) (-2093.012) (-2103.008) -- 0:04:20 Average standard deviation of split frequencies: 0.003129 150500 -- (-2100.329) (-2103.330) [-2094.930] (-2089.544) * (-2101.515) [-2097.266] (-2095.319) (-2100.368) -- 0:04:19 151000 -- (-2096.897) [-2094.663] (-2097.080) (-2091.434) * [-2091.827] (-2097.999) (-2099.223) (-2101.056) -- 0:04:24 151500 -- [-2098.857] (-2105.026) (-2100.840) (-2095.895) * (-2093.640) (-2097.076) (-2098.262) [-2098.867] -- 0:04:23 152000 -- (-2106.542) (-2092.145) [-2096.672] (-2095.615) * [-2099.356] (-2103.181) (-2098.446) (-2092.083) -- 0:04:22 152500 -- (-2104.227) (-2097.029) (-2100.215) [-2099.594] * (-2093.277) [-2100.523] (-2095.854) (-2100.545) -- 0:04:21 153000 -- (-2107.657) [-2103.732] (-2094.775) (-2098.888) * (-2094.979) (-2099.195) (-2096.745) [-2100.106] -- 0:04:20 153500 -- [-2099.108] (-2098.491) (-2101.022) (-2100.362) * (-2092.022) [-2103.080] (-2105.195) (-2101.437) -- 0:04:19 154000 -- (-2095.316) (-2098.556) (-2098.376) [-2095.176] * (-2098.628) [-2096.020] (-2092.803) (-2100.893) -- 0:04:23 154500 -- (-2111.693) (-2097.771) [-2098.378] (-2100.466) * [-2093.245] (-2093.952) (-2100.280) (-2093.229) -- 0:04:22 155000 -- (-2093.310) (-2102.631) [-2098.107] (-2097.818) * [-2092.813] (-2097.480) (-2102.799) (-2096.005) -- 0:04:21 Average standard deviation of split frequencies: 0.004533 155500 -- (-2097.145) (-2101.231) [-2093.568] (-2098.711) * [-2096.493] (-2099.494) (-2097.784) (-2095.986) -- 0:04:20 156000 -- (-2107.803) (-2098.406) [-2094.433] (-2105.467) * (-2092.595) [-2095.084] (-2090.483) (-2095.301) -- 0:04:19 156500 -- (-2098.662) [-2098.364] (-2095.343) (-2101.343) * (-2099.194) (-2102.980) [-2094.226] (-2103.279) -- 0:04:18 157000 -- [-2097.346] (-2101.128) (-2093.277) (-2095.345) * (-2093.644) [-2101.527] (-2095.726) (-2093.207) -- 0:04:17 157500 -- (-2100.766) (-2095.855) (-2095.278) [-2097.206] * (-2102.678) (-2095.281) (-2092.719) [-2091.921] -- 0:04:22 158000 -- (-2091.544) (-2101.098) (-2095.108) [-2094.487] * [-2103.138] (-2099.549) (-2091.990) (-2092.975) -- 0:04:21 158500 -- (-2097.920) [-2100.369] (-2093.076) (-2096.635) * (-2098.884) (-2098.777) [-2099.824] (-2091.210) -- 0:04:20 159000 -- (-2094.796) (-2096.758) [-2095.997] (-2095.204) * [-2093.876] (-2093.714) (-2096.569) (-2089.082) -- 0:04:19 159500 -- [-2093.010] (-2100.383) (-2090.758) (-2103.901) * (-2097.090) (-2092.748) (-2096.453) [-2099.519] -- 0:04:18 160000 -- (-2094.068) [-2098.569] (-2105.650) (-2106.137) * (-2092.622) [-2091.805] (-2099.506) (-2093.351) -- 0:04:17 Average standard deviation of split frequencies: 0.006602 160500 -- [-2097.456] (-2098.188) (-2109.348) (-2101.373) * (-2104.844) (-2099.506) (-2095.162) [-2097.815] -- 0:04:21 161000 -- (-2091.935) (-2105.854) (-2101.662) [-2096.836] * (-2097.394) (-2097.615) (-2097.282) [-2095.984] -- 0:04:20 161500 -- [-2093.470] (-2098.601) (-2096.854) (-2097.997) * (-2098.392) [-2098.967] (-2098.739) (-2099.451) -- 0:04:19 162000 -- (-2096.147) (-2097.879) [-2103.823] (-2097.659) * (-2099.563) [-2100.638] (-2095.171) (-2104.284) -- 0:04:18 162500 -- (-2096.986) (-2102.354) [-2095.570] (-2091.840) * (-2098.701) (-2094.468) (-2096.197) [-2092.356] -- 0:04:17 163000 -- (-2103.841) (-2103.588) [-2095.177] (-2096.830) * (-2099.649) (-2106.811) (-2089.932) [-2097.069] -- 0:04:16 163500 -- (-2104.441) [-2100.032] (-2095.348) (-2099.776) * (-2094.604) (-2100.035) [-2095.338] (-2095.345) -- 0:04:15 164000 -- (-2101.522) (-2095.863) [-2098.919] (-2101.582) * (-2096.836) [-2092.288] (-2096.110) (-2097.788) -- 0:04:19 164500 -- (-2090.908) (-2093.599) (-2106.588) [-2098.090] * (-2094.633) [-2098.240] (-2097.321) (-2095.369) -- 0:04:19 165000 -- (-2099.157) (-2094.857) (-2098.233) [-2091.313] * (-2095.297) (-2103.463) [-2097.113] (-2091.257) -- 0:04:18 Average standard deviation of split frequencies: 0.005680 165500 -- (-2096.955) [-2089.328] (-2099.297) (-2094.327) * (-2099.200) [-2094.288] (-2098.309) (-2095.916) -- 0:04:17 166000 -- (-2096.248) (-2091.326) [-2099.319] (-2093.421) * (-2101.177) (-2095.342) [-2095.198] (-2104.160) -- 0:04:16 166500 -- [-2093.102] (-2096.089) (-2098.300) (-2101.007) * [-2094.526] (-2097.213) (-2089.944) (-2100.919) -- 0:04:15 167000 -- (-2099.356) [-2092.438] (-2101.464) (-2094.360) * (-2099.850) (-2094.787) [-2096.702] (-2101.579) -- 0:04:19 167500 -- [-2098.694] (-2104.288) (-2104.804) (-2101.582) * (-2094.146) (-2090.646) [-2094.347] (-2100.333) -- 0:04:18 168000 -- (-2097.576) [-2097.010] (-2096.107) (-2093.006) * (-2098.507) (-2093.888) (-2096.381) [-2094.704] -- 0:04:17 168500 -- (-2095.069) (-2093.236) (-2093.632) [-2096.291] * (-2100.223) (-2092.063) (-2097.249) [-2098.400] -- 0:04:16 169000 -- [-2104.368] (-2101.083) (-2096.278) (-2100.966) * (-2103.687) [-2092.748] (-2092.479) (-2100.596) -- 0:04:15 169500 -- (-2096.938) (-2094.385) [-2092.540] (-2096.027) * [-2097.644] (-2100.517) (-2101.450) (-2109.803) -- 0:04:14 170000 -- [-2094.922] (-2094.454) (-2098.905) (-2094.429) * (-2100.147) (-2096.221) (-2100.257) [-2102.930] -- 0:04:18 Average standard deviation of split frequencies: 0.006215 170500 -- (-2101.209) (-2103.252) [-2091.363] (-2104.335) * (-2096.607) [-2092.880] (-2100.748) (-2100.229) -- 0:04:17 171000 -- [-2101.426] (-2094.564) (-2094.392) (-2094.874) * (-2101.441) [-2092.970] (-2099.924) (-2105.952) -- 0:04:16 171500 -- [-2105.286] (-2096.614) (-2094.821) (-2103.903) * (-2096.543) (-2095.075) [-2099.563] (-2096.563) -- 0:04:16 172000 -- (-2102.815) [-2099.719] (-2097.969) (-2097.459) * (-2100.776) [-2091.834] (-2103.205) (-2098.591) -- 0:04:15 172500 -- (-2106.495) (-2096.702) (-2090.950) [-2098.887] * (-2108.655) [-2103.730] (-2096.357) (-2097.513) -- 0:04:14 173000 -- [-2097.718] (-2097.069) (-2093.341) (-2101.070) * (-2102.186) (-2096.456) (-2097.438) [-2091.658] -- 0:04:13 173500 -- (-2097.282) [-2092.426] (-2098.221) (-2103.046) * (-2106.800) [-2096.716] (-2097.680) (-2108.128) -- 0:04:17 174000 -- (-2092.592) [-2095.299] (-2098.013) (-2099.969) * (-2101.143) (-2089.260) (-2089.559) [-2094.987] -- 0:04:16 174500 -- [-2098.679] (-2093.754) (-2096.300) (-2100.129) * (-2099.613) (-2098.195) (-2092.097) [-2094.692] -- 0:04:15 175000 -- [-2092.914] (-2096.861) (-2111.540) (-2099.010) * (-2099.942) (-2101.004) (-2100.859) [-2093.449] -- 0:04:14 Average standard deviation of split frequencies: 0.006696 175500 -- (-2093.015) [-2097.082] (-2102.301) (-2094.476) * (-2101.247) [-2099.495] (-2091.674) (-2092.800) -- 0:04:13 176000 -- [-2103.608] (-2095.615) (-2095.457) (-2107.879) * (-2102.148) (-2093.681) (-2100.147) [-2098.238] -- 0:04:12 176500 -- (-2105.737) (-2097.246) (-2097.185) [-2093.529] * (-2114.949) (-2096.116) [-2089.442] (-2093.208) -- 0:04:16 177000 -- (-2107.037) (-2092.829) [-2098.968] (-2096.676) * (-2094.945) (-2107.564) (-2099.407) [-2095.320] -- 0:04:15 177500 -- [-2094.401] (-2092.069) (-2097.835) (-2095.427) * [-2097.923] (-2101.964) (-2100.665) (-2099.310) -- 0:04:14 178000 -- (-2095.763) [-2091.322] (-2100.886) (-2091.348) * (-2093.413) (-2094.993) [-2095.241] (-2096.566) -- 0:04:13 178500 -- [-2098.057] (-2100.406) (-2096.293) (-2093.415) * (-2091.148) (-2105.906) (-2098.072) [-2096.505] -- 0:04:13 179000 -- (-2099.760) (-2100.287) (-2099.112) [-2098.889] * (-2099.690) [-2093.404] (-2106.285) (-2102.054) -- 0:04:12 179500 -- (-2101.728) [-2096.641] (-2101.780) (-2091.181) * (-2101.819) [-2095.458] (-2101.954) (-2100.401) -- 0:04:11 180000 -- (-2094.020) (-2095.121) [-2097.977] (-2093.024) * (-2100.870) (-2090.252) (-2097.476) [-2097.008] -- 0:04:15 Average standard deviation of split frequencies: 0.006523 180500 -- (-2093.280) [-2099.245] (-2119.643) (-2096.413) * (-2101.428) (-2098.913) (-2110.302) [-2094.454] -- 0:04:14 181000 -- (-2091.242) [-2099.073] (-2096.400) (-2097.190) * (-2099.057) (-2099.394) (-2096.309) [-2102.731] -- 0:04:13 181500 -- [-2097.619] (-2114.885) (-2091.435) (-2102.915) * [-2088.206] (-2095.879) (-2103.673) (-2096.692) -- 0:04:12 182000 -- (-2095.568) [-2093.579] (-2094.946) (-2103.067) * (-2095.685) [-2095.426] (-2096.408) (-2091.382) -- 0:04:11 182500 -- (-2094.135) (-2093.702) (-2093.246) [-2095.175] * (-2103.394) (-2098.695) (-2095.736) [-2090.544] -- 0:04:10 183000 -- (-2111.788) (-2095.526) (-2096.635) [-2095.602] * (-2102.001) (-2098.396) (-2101.723) [-2094.723] -- 0:04:10 183500 -- (-2098.510) (-2094.912) [-2095.182] (-2096.710) * (-2095.807) (-2091.010) (-2096.837) [-2098.085] -- 0:04:13 184000 -- (-2101.156) (-2099.691) (-2095.612) [-2097.930] * (-2092.414) (-2096.910) (-2099.012) [-2095.392] -- 0:04:12 184500 -- (-2097.829) (-2097.628) (-2101.549) [-2095.511] * [-2096.993] (-2098.859) (-2092.463) (-2094.842) -- 0:04:11 185000 -- [-2098.796] (-2096.069) (-2104.433) (-2099.544) * (-2098.612) [-2093.161] (-2094.065) (-2093.778) -- 0:04:11 Average standard deviation of split frequencies: 0.005069 185500 -- (-2103.273) [-2092.601] (-2100.654) (-2095.296) * (-2099.990) [-2100.965] (-2092.251) (-2100.210) -- 0:04:10 186000 -- (-2093.188) (-2097.467) [-2101.597] (-2092.499) * (-2093.295) [-2094.971] (-2104.754) (-2090.777) -- 0:04:09 186500 -- (-2100.075) (-2101.428) (-2101.100) [-2093.725] * (-2100.611) [-2092.951] (-2095.626) (-2097.276) -- 0:04:12 187000 -- (-2096.531) (-2103.373) [-2100.857] (-2094.291) * (-2099.677) (-2093.045) [-2090.284] (-2092.077) -- 0:04:12 187500 -- (-2096.163) (-2101.813) (-2105.545) [-2093.387] * (-2094.526) [-2097.440] (-2089.298) (-2101.194) -- 0:04:11 188000 -- (-2099.630) (-2098.374) [-2097.812] (-2094.188) * (-2087.958) [-2091.214] (-2093.992) (-2094.840) -- 0:04:10 188500 -- (-2097.922) (-2095.929) [-2098.400] (-2091.162) * (-2096.757) (-2100.948) [-2095.933] (-2101.015) -- 0:04:09 189000 -- [-2098.154] (-2095.220) (-2099.854) (-2092.867) * (-2097.417) (-2088.933) [-2097.107] (-2094.228) -- 0:04:08 189500 -- (-2102.163) (-2094.417) [-2095.168] (-2095.495) * [-2094.259] (-2095.190) (-2096.824) (-2101.479) -- 0:04:08 190000 -- [-2096.369] (-2102.866) (-2092.290) (-2097.916) * (-2109.434) [-2095.951] (-2094.602) (-2100.942) -- 0:04:11 Average standard deviation of split frequencies: 0.001854 190500 -- [-2095.648] (-2101.874) (-2092.383) (-2098.575) * (-2100.955) [-2095.728] (-2096.589) (-2093.422) -- 0:04:10 191000 -- (-2101.438) (-2093.924) [-2091.339] (-2100.511) * [-2097.953] (-2096.580) (-2102.420) (-2092.474) -- 0:04:09 191500 -- (-2095.997) [-2094.879] (-2099.386) (-2099.483) * [-2102.170] (-2095.360) (-2094.005) (-2096.668) -- 0:04:09 192000 -- (-2100.180) (-2102.683) (-2094.390) [-2095.163] * (-2095.217) [-2098.369] (-2097.210) (-2105.423) -- 0:04:08 192500 -- [-2094.299] (-2108.493) (-2104.797) (-2101.268) * [-2099.107] (-2099.982) (-2098.124) (-2099.275) -- 0:04:07 193000 -- (-2096.087) (-2092.879) (-2095.302) [-2096.514] * [-2097.541] (-2101.998) (-2100.298) (-2096.802) -- 0:04:10 193500 -- (-2099.013) (-2092.954) (-2093.031) [-2091.635] * [-2095.711] (-2093.791) (-2100.183) (-2098.450) -- 0:04:10 194000 -- (-2104.221) (-2101.531) [-2089.717] (-2097.423) * (-2094.883) (-2100.060) (-2100.598) [-2093.235] -- 0:04:09 194500 -- (-2099.690) (-2101.069) [-2098.384] (-2109.009) * (-2100.398) (-2093.178) (-2101.353) [-2099.754] -- 0:04:08 195000 -- [-2100.019] (-2105.210) (-2098.752) (-2101.615) * (-2098.388) [-2093.346] (-2100.488) (-2097.178) -- 0:04:07 Average standard deviation of split frequencies: 0.002405 195500 -- (-2109.122) (-2104.130) [-2092.980] (-2100.631) * (-2094.402) (-2094.944) [-2092.777] (-2093.920) -- 0:04:06 196000 -- (-2107.018) (-2102.044) (-2096.231) [-2092.989] * [-2094.421] (-2093.557) (-2099.153) (-2097.791) -- 0:04:06 196500 -- (-2096.520) [-2097.077] (-2100.518) (-2097.304) * (-2094.899) [-2093.146] (-2098.556) (-2098.069) -- 0:04:09 197000 -- (-2099.336) [-2094.379] (-2093.110) (-2095.984) * (-2092.932) (-2092.435) (-2095.963) [-2094.167] -- 0:04:08 197500 -- (-2097.105) [-2095.967] (-2099.456) (-2102.343) * (-2099.314) (-2099.649) (-2103.363) [-2099.040] -- 0:04:07 198000 -- [-2099.401] (-2094.587) (-2092.615) (-2103.230) * [-2103.346] (-2092.284) (-2096.885) (-2094.814) -- 0:04:07 198500 -- (-2098.769) [-2088.462] (-2097.902) (-2101.153) * (-2097.164) [-2097.179] (-2107.051) (-2103.743) -- 0:04:06 199000 -- (-2101.852) (-2093.248) (-2112.129) [-2088.705] * (-2100.587) [-2094.636] (-2099.969) (-2100.806) -- 0:04:05 199500 -- (-2105.398) (-2095.745) (-2103.924) [-2099.096] * (-2102.795) (-2090.441) [-2095.711] (-2100.428) -- 0:04:08 200000 -- (-2096.938) [-2095.926] (-2098.725) (-2095.184) * (-2098.470) [-2090.609] (-2096.221) (-2093.228) -- 0:04:08 Average standard deviation of split frequencies: 0.002936 200500 -- (-2092.699) (-2096.798) (-2092.761) [-2100.423] * [-2094.765] (-2100.490) (-2095.191) (-2099.619) -- 0:04:07 201000 -- (-2094.350) (-2099.977) [-2094.449] (-2098.154) * (-2109.300) (-2095.499) [-2101.021] (-2098.478) -- 0:04:06 201500 -- (-2095.188) (-2097.768) (-2097.351) [-2098.563] * (-2094.849) (-2098.748) [-2093.252] (-2098.056) -- 0:04:05 202000 -- [-2097.752] (-2098.283) (-2092.549) (-2103.845) * (-2109.596) (-2101.880) (-2089.733) [-2089.450] -- 0:04:04 202500 -- [-2089.827] (-2109.823) (-2099.777) (-2096.678) * (-2104.826) [-2097.339] (-2099.319) (-2094.757) -- 0:04:04 203000 -- (-2096.159) (-2096.422) [-2092.708] (-2104.465) * (-2095.864) (-2101.123) (-2093.469) [-2096.833] -- 0:04:07 203500 -- (-2098.032) [-2093.543] (-2095.901) (-2099.649) * (-2101.957) (-2101.193) (-2102.185) [-2094.067] -- 0:04:06 204000 -- (-2098.926) [-2099.319] (-2100.492) (-2096.174) * (-2102.329) (-2096.403) (-2097.841) [-2091.129] -- 0:04:05 204500 -- (-2099.108) (-2095.505) [-2103.219] (-2101.580) * (-2098.784) (-2104.094) [-2097.431] (-2090.632) -- 0:04:05 205000 -- (-2105.215) (-2109.470) [-2094.931] (-2098.455) * [-2091.882] (-2101.784) (-2104.709) (-2088.267) -- 0:04:04 Average standard deviation of split frequencies: 0.001716 205500 -- [-2093.412] (-2101.390) (-2104.660) (-2098.417) * [-2097.541] (-2091.480) (-2103.974) (-2092.580) -- 0:04:03 206000 -- (-2096.109) (-2099.947) [-2096.540] (-2094.223) * [-2100.805] (-2094.253) (-2097.782) (-2101.673) -- 0:04:02 206500 -- [-2094.984] (-2097.405) (-2095.714) (-2093.029) * [-2094.729] (-2101.358) (-2097.667) (-2100.116) -- 0:04:05 207000 -- [-2090.544] (-2093.120) (-2092.751) (-2096.021) * (-2092.750) (-2104.988) (-2095.619) [-2093.965] -- 0:04:05 207500 -- (-2099.389) (-2104.005) [-2098.169] (-2102.822) * [-2094.019] (-2093.024) (-2105.824) (-2096.715) -- 0:04:04 208000 -- [-2095.195] (-2106.335) (-2096.456) (-2097.058) * (-2096.084) (-2098.367) [-2104.279] (-2104.156) -- 0:04:03 208500 -- (-2097.175) (-2095.463) (-2097.259) [-2090.747] * [-2097.942] (-2095.127) (-2099.158) (-2094.514) -- 0:04:02 209000 -- (-2091.788) (-2101.658) (-2093.011) [-2090.238] * [-2095.441] (-2097.029) (-2104.886) (-2091.104) -- 0:04:02 209500 -- (-2093.320) (-2097.998) (-2095.072) [-2096.240] * [-2091.724] (-2093.958) (-2102.032) (-2095.838) -- 0:04:05 210000 -- [-2095.657] (-2092.064) (-2100.818) (-2094.704) * (-2096.600) (-2101.819) (-2098.356) [-2095.568] -- 0:04:04 Average standard deviation of split frequencies: 0.001678 210500 -- (-2092.448) [-2099.482] (-2093.621) (-2097.857) * (-2095.670) (-2090.628) [-2095.154] (-2097.653) -- 0:04:03 211000 -- (-2094.920) (-2097.809) (-2093.550) [-2095.260] * [-2094.545] (-2099.755) (-2096.123) (-2094.991) -- 0:04:03 211500 -- (-2101.296) (-2102.193) (-2099.558) [-2096.038] * (-2101.876) [-2100.497] (-2096.851) (-2097.385) -- 0:04:02 212000 -- (-2101.974) [-2091.466] (-2097.077) (-2094.036) * [-2092.853] (-2108.613) (-2099.824) (-2097.907) -- 0:04:01 212500 -- (-2094.276) (-2109.904) [-2098.621] (-2095.648) * [-2088.915] (-2108.222) (-2096.544) (-2096.532) -- 0:04:00 213000 -- (-2094.742) (-2099.413) [-2095.658] (-2094.523) * (-2093.695) (-2106.975) [-2091.443] (-2101.196) -- 0:04:03 213500 -- (-2088.143) (-2098.336) (-2091.556) [-2093.729] * (-2096.870) [-2105.249] (-2092.483) (-2098.200) -- 0:04:03 214000 -- (-2107.960) [-2100.181] (-2095.212) (-2096.446) * (-2098.925) (-2102.101) [-2095.869] (-2093.748) -- 0:04:02 214500 -- [-2098.317] (-2094.108) (-2093.441) (-2093.676) * [-2091.123] (-2108.018) (-2098.096) (-2094.765) -- 0:04:01 215000 -- (-2100.544) (-2096.320) [-2090.501] (-2098.532) * (-2094.308) (-2110.264) (-2095.397) [-2095.322] -- 0:04:00 Average standard deviation of split frequencies: 0.001637 215500 -- (-2099.498) [-2097.844] (-2090.309) (-2096.150) * (-2101.864) [-2092.563] (-2100.176) (-2096.899) -- 0:04:00 216000 -- (-2099.629) [-2096.269] (-2100.034) (-2097.559) * (-2098.990) (-2103.707) [-2094.492] (-2097.731) -- 0:04:03 216500 -- (-2095.523) (-2092.186) [-2095.420] (-2099.333) * (-2095.540) [-2091.062] (-2093.226) (-2110.375) -- 0:04:02 217000 -- [-2100.819] (-2093.715) (-2099.384) (-2098.316) * (-2094.187) (-2093.621) [-2098.304] (-2097.941) -- 0:04:01 217500 -- (-2093.845) (-2090.597) (-2098.319) [-2095.351] * (-2094.161) [-2091.667] (-2097.276) (-2103.468) -- 0:04:01 218000 -- (-2092.562) [-2093.349] (-2100.339) (-2100.484) * (-2096.305) (-2095.741) (-2098.465) [-2093.968] -- 0:04:00 218500 -- (-2092.049) (-2093.963) (-2096.743) [-2095.430] * [-2100.399] (-2096.347) (-2098.083) (-2095.219) -- 0:03:59 219000 -- (-2098.822) [-2097.235] (-2099.587) (-2099.657) * [-2096.053] (-2095.585) (-2096.614) (-2105.046) -- 0:03:58 219500 -- (-2098.318) (-2095.726) [-2099.626] (-2100.574) * (-2101.289) [-2092.970] (-2092.930) (-2099.601) -- 0:04:01 220000 -- (-2095.965) [-2091.659] (-2097.022) (-2095.042) * (-2100.733) (-2096.734) [-2096.763] (-2098.850) -- 0:04:01 Average standard deviation of split frequencies: 0.001602 220500 -- (-2092.322) (-2094.151) (-2094.890) [-2097.091] * (-2112.239) (-2097.694) [-2097.463] (-2101.073) -- 0:04:00 221000 -- (-2093.013) (-2096.630) (-2098.833) [-2095.956] * (-2114.246) (-2096.912) (-2105.973) [-2096.132] -- 0:03:59 221500 -- (-2108.857) (-2092.158) [-2094.780] (-2102.439) * (-2106.027) (-2102.498) (-2101.665) [-2106.005] -- 0:03:58 222000 -- (-2096.338) (-2098.245) (-2092.013) [-2097.601] * (-2100.370) (-2103.819) [-2094.819] (-2094.365) -- 0:03:58 222500 -- (-2092.739) (-2101.806) (-2097.861) [-2096.998] * (-2095.388) (-2096.147) (-2096.526) [-2098.532] -- 0:04:01 223000 -- (-2098.769) (-2095.071) (-2098.361) [-2100.089] * (-2093.087) (-2100.015) [-2096.624] (-2093.069) -- 0:04:00 223500 -- (-2095.891) [-2099.157] (-2099.571) (-2092.849) * (-2098.752) [-2096.979] (-2092.203) (-2098.569) -- 0:03:59 224000 -- [-2097.459] (-2098.852) (-2091.205) (-2103.863) * (-2100.273) (-2098.730) (-2090.065) [-2096.807] -- 0:03:59 224500 -- [-2090.359] (-2098.030) (-2095.101) (-2094.870) * [-2098.033] (-2096.129) (-2099.160) (-2096.700) -- 0:03:58 225000 -- (-2091.830) (-2101.777) [-2094.449] (-2112.177) * [-2095.524] (-2096.253) (-2097.472) (-2094.785) -- 0:03:57 Average standard deviation of split frequencies: 0.001564 225500 -- (-2095.663) (-2102.453) [-2092.603] (-2093.645) * [-2096.487] (-2100.815) (-2096.947) (-2095.505) -- 0:04:00 226000 -- (-2092.482) (-2098.715) [-2094.140] (-2096.938) * (-2095.464) (-2098.765) [-2099.989] (-2107.320) -- 0:03:59 226500 -- [-2092.589] (-2096.028) (-2093.523) (-2089.861) * (-2100.640) (-2095.663) [-2087.733] (-2098.230) -- 0:03:59 227000 -- (-2098.001) (-2096.857) (-2093.611) [-2102.171] * [-2099.815] (-2100.303) (-2098.274) (-2096.463) -- 0:03:58 227500 -- (-2100.456) (-2116.386) [-2094.723] (-2094.830) * (-2097.282) [-2095.420] (-2098.339) (-2098.103) -- 0:03:57 228000 -- (-2094.657) (-2103.396) [-2095.940] (-2091.664) * (-2095.367) (-2091.624) (-2095.752) [-2091.253] -- 0:03:57 228500 -- [-2093.087] (-2108.476) (-2099.963) (-2090.079) * [-2094.450] (-2103.942) (-2098.667) (-2092.808) -- 0:03:59 229000 -- (-2092.072) (-2111.625) (-2096.399) [-2094.735] * (-2093.593) [-2094.859] (-2097.453) (-2093.752) -- 0:03:59 229500 -- (-2093.963) (-2099.011) (-2098.820) [-2094.991] * [-2090.061] (-2094.258) (-2090.447) (-2100.624) -- 0:03:58 230000 -- (-2092.429) (-2097.158) (-2101.212) [-2095.992] * [-2094.813] (-2101.419) (-2094.709) (-2097.181) -- 0:03:57 Average standard deviation of split frequencies: 0.002044 230500 -- (-2105.943) [-2099.850] (-2100.579) (-2098.874) * (-2095.082) (-2096.852) [-2108.101] (-2098.765) -- 0:03:57 231000 -- (-2093.268) [-2102.689] (-2101.577) (-2097.792) * [-2090.920] (-2099.582) (-2098.470) (-2094.207) -- 0:03:56 231500 -- (-2095.940) (-2098.070) [-2094.351] (-2093.247) * (-2096.015) (-2094.219) (-2096.809) [-2094.775] -- 0:03:55 232000 -- (-2096.849) (-2098.128) [-2091.939] (-2103.636) * [-2102.049] (-2098.654) (-2096.733) (-2098.156) -- 0:03:58 232500 -- [-2098.986] (-2098.887) (-2094.176) (-2101.092) * (-2103.689) [-2099.860] (-2092.915) (-2107.033) -- 0:03:57 233000 -- [-2095.996] (-2098.065) (-2089.674) (-2099.835) * (-2096.664) [-2091.235] (-2096.411) (-2100.008) -- 0:03:57 233500 -- (-2106.705) (-2097.996) (-2096.883) [-2093.754] * (-2092.522) (-2103.183) (-2096.889) [-2098.221] -- 0:03:56 234000 -- [-2094.531] (-2096.645) (-2095.688) (-2092.811) * (-2102.203) (-2096.215) [-2097.309] (-2098.966) -- 0:03:55 234500 -- [-2097.470] (-2097.865) (-2100.086) (-2097.998) * [-2094.282] (-2093.016) (-2093.698) (-2096.204) -- 0:03:55 235000 -- (-2095.274) (-2097.876) [-2099.744] (-2098.784) * (-2101.722) [-2093.270] (-2093.740) (-2099.820) -- 0:03:54 Average standard deviation of split frequencies: 0.000999 235500 -- (-2093.261) (-2101.247) (-2095.923) [-2100.529] * (-2103.735) (-2110.220) [-2095.320] (-2097.612) -- 0:03:56 236000 -- (-2092.560) (-2102.977) (-2099.030) [-2099.768] * (-2104.371) (-2109.919) (-2107.437) [-2095.423] -- 0:03:56 236500 -- (-2103.142) (-2100.029) [-2093.496] (-2094.739) * (-2096.947) (-2095.064) (-2094.216) [-2095.875] -- 0:03:55 237000 -- (-2097.591) [-2097.155] (-2093.012) (-2091.825) * (-2108.888) (-2095.987) [-2098.297] (-2099.881) -- 0:03:55 237500 -- (-2101.680) (-2096.556) [-2096.023] (-2101.095) * (-2098.373) [-2097.227] (-2097.342) (-2095.227) -- 0:03:54 238000 -- (-2102.343) (-2097.218) [-2088.412] (-2104.314) * (-2098.237) (-2094.040) [-2099.222] (-2102.699) -- 0:03:53 238500 -- (-2098.181) (-2102.675) (-2092.243) [-2096.254] * (-2097.651) (-2090.227) [-2095.740] (-2100.006) -- 0:03:56 239000 -- [-2094.159] (-2101.334) (-2092.065) (-2096.403) * (-2093.711) [-2094.303] (-2106.557) (-2100.392) -- 0:03:55 239500 -- (-2092.020) (-2102.947) [-2092.842] (-2093.757) * (-2101.597) (-2095.248) [-2103.674] (-2105.884) -- 0:03:54 240000 -- (-2103.350) (-2100.587) [-2094.040] (-2100.774) * [-2096.385] (-2097.018) (-2100.810) (-2093.402) -- 0:03:54 Average standard deviation of split frequencies: 0.003428 240500 -- (-2093.725) (-2100.425) [-2101.935] (-2096.545) * [-2095.735] (-2108.316) (-2102.152) (-2106.004) -- 0:03:53 241000 -- (-2095.081) (-2094.345) [-2099.802] (-2096.215) * (-2104.463) [-2096.054] (-2096.082) (-2095.528) -- 0:03:53 241500 -- (-2101.708) (-2090.237) (-2103.096) [-2096.919] * (-2092.199) (-2108.144) (-2093.977) [-2097.110] -- 0:03:52 242000 -- [-2101.528] (-2099.120) (-2094.394) (-2099.198) * (-2091.253) (-2101.876) [-2101.180] (-2091.836) -- 0:03:54 242500 -- (-2097.682) (-2098.518) (-2094.508) [-2096.465] * (-2095.830) (-2102.653) (-2095.663) [-2091.350] -- 0:03:54 243000 -- [-2092.472] (-2092.622) (-2089.539) (-2102.389) * [-2093.270] (-2093.336) (-2097.833) (-2093.664) -- 0:03:53 243500 -- (-2090.123) (-2107.274) [-2095.919] (-2108.167) * [-2096.157] (-2098.670) (-2094.020) (-2110.397) -- 0:03:53 244000 -- (-2094.286) (-2095.265) (-2098.217) [-2096.034] * (-2098.591) (-2099.430) [-2091.012] (-2106.606) -- 0:03:52 244500 -- [-2094.489] (-2103.245) (-2095.866) (-2100.796) * (-2107.450) (-2097.584) (-2093.631) [-2103.497] -- 0:03:51 245000 -- (-2105.480) (-2092.204) [-2098.754] (-2100.116) * (-2096.509) [-2091.785] (-2098.060) (-2095.908) -- 0:03:51 Average standard deviation of split frequencies: 0.003833 245500 -- (-2096.871) (-2101.440) (-2098.193) [-2093.865] * [-2094.862] (-2102.039) (-2097.498) (-2100.241) -- 0:03:53 246000 -- [-2091.565] (-2105.195) (-2099.444) (-2097.863) * (-2100.021) (-2100.039) (-2109.131) [-2100.131] -- 0:03:52 246500 -- (-2096.271) [-2097.919] (-2099.652) (-2098.173) * (-2101.292) [-2095.302] (-2099.496) (-2102.475) -- 0:03:52 247000 -- [-2098.377] (-2108.099) (-2103.853) (-2093.462) * (-2092.261) [-2102.917] (-2094.565) (-2107.194) -- 0:03:51 247500 -- (-2094.853) (-2101.297) [-2095.548] (-2110.125) * (-2093.722) [-2098.674] (-2096.872) (-2105.160) -- 0:03:51 248000 -- [-2096.030] (-2090.858) (-2093.847) (-2105.261) * [-2096.749] (-2092.716) (-2091.593) (-2101.662) -- 0:03:50 248500 -- (-2099.326) (-2096.509) [-2089.118] (-2102.295) * (-2093.877) [-2100.372] (-2097.484) (-2090.540) -- 0:03:52 249000 -- [-2094.570] (-2092.006) (-2095.668) (-2106.728) * (-2092.311) (-2105.407) (-2094.117) [-2098.128] -- 0:03:52 249500 -- [-2093.980] (-2098.452) (-2100.455) (-2101.452) * (-2089.084) [-2097.500] (-2101.662) (-2097.147) -- 0:03:51 250000 -- (-2103.789) [-2093.561] (-2091.011) (-2093.923) * (-2100.613) (-2090.882) [-2092.348] (-2096.972) -- 0:03:51 Average standard deviation of split frequencies: 0.005172 250500 -- (-2098.120) (-2092.406) (-2102.658) [-2099.279] * (-2096.756) (-2094.957) [-2093.689] (-2093.537) -- 0:03:50 251000 -- (-2099.346) (-2092.012) [-2096.862] (-2096.852) * [-2094.322] (-2094.176) (-2104.099) (-2104.941) -- 0:03:49 251500 -- (-2093.808) [-2093.353] (-2101.865) (-2101.552) * (-2093.488) (-2094.448) (-2101.375) [-2099.029] -- 0:03:49 252000 -- [-2098.763] (-2106.113) (-2098.931) (-2106.258) * (-2094.277) (-2096.909) (-2089.768) [-2098.182] -- 0:03:51 252500 -- [-2098.201] (-2095.319) (-2093.241) (-2099.418) * [-2099.391] (-2092.318) (-2101.959) (-2093.773) -- 0:03:50 253000 -- (-2096.125) (-2096.687) [-2090.397] (-2106.208) * (-2107.093) (-2097.235) (-2099.630) [-2091.450] -- 0:03:50 253500 -- [-2092.151] (-2102.801) (-2094.522) (-2097.711) * (-2101.637) (-2092.477) [-2100.422] (-2100.496) -- 0:03:49 254000 -- (-2097.735) (-2102.720) [-2095.111] (-2101.305) * (-2090.625) (-2095.999) (-2101.866) [-2101.201] -- 0:03:49 254500 -- [-2097.424] (-2105.494) (-2098.755) (-2099.345) * (-2097.708) (-2089.007) [-2098.039] (-2096.885) -- 0:03:48 255000 -- (-2091.535) (-2103.344) (-2098.279) [-2097.638] * [-2103.424] (-2095.100) (-2104.242) (-2102.508) -- 0:03:47 Average standard deviation of split frequencies: 0.005064 255500 -- (-2094.630) (-2100.062) (-2101.300) [-2102.120] * (-2095.279) (-2098.424) [-2100.790] (-2095.669) -- 0:03:50 256000 -- [-2099.977] (-2089.453) (-2096.495) (-2096.033) * (-2095.154) (-2102.099) (-2097.282) [-2101.238] -- 0:03:49 256500 -- [-2091.823] (-2104.529) (-2089.228) (-2096.092) * (-2095.120) (-2098.022) (-2098.267) [-2099.308] -- 0:03:48 257000 -- (-2100.203) (-2102.771) [-2095.854] (-2099.353) * (-2094.455) (-2093.780) (-2093.788) [-2095.857] -- 0:03:48 257500 -- (-2113.861) [-2097.414] (-2103.644) (-2101.408) * [-2092.865] (-2096.292) (-2099.401) (-2098.657) -- 0:03:47 258000 -- (-2103.067) [-2095.559] (-2092.456) (-2102.919) * (-2094.637) [-2096.836] (-2101.408) (-2095.522) -- 0:03:47 258500 -- (-2097.744) (-2094.382) [-2092.875] (-2095.158) * (-2101.049) (-2099.939) (-2111.592) [-2096.809] -- 0:03:49 259000 -- (-2095.528) (-2090.286) [-2094.040] (-2095.511) * (-2097.955) (-2095.898) (-2095.837) [-2089.045] -- 0:03:48 259500 -- [-2096.444] (-2095.393) (-2097.535) (-2103.280) * (-2092.372) (-2101.828) [-2094.971] (-2099.488) -- 0:03:48 260000 -- (-2096.927) (-2098.276) [-2089.377] (-2101.643) * (-2099.006) (-2095.415) [-2098.891] (-2092.231) -- 0:03:47 Average standard deviation of split frequencies: 0.005425 260500 -- (-2094.742) (-2100.960) [-2098.640] (-2094.971) * (-2100.711) (-2097.292) [-2103.995] (-2097.472) -- 0:03:47 261000 -- (-2097.278) (-2097.925) [-2092.664] (-2105.155) * (-2095.263) (-2094.648) (-2097.725) [-2098.586] -- 0:03:46 261500 -- (-2095.743) [-2095.889] (-2093.478) (-2096.294) * (-2098.788) (-2094.844) (-2094.419) [-2100.302] -- 0:03:45 262000 -- [-2098.526] (-2106.339) (-2098.958) (-2099.268) * (-2091.516) (-2099.500) (-2096.163) [-2094.221] -- 0:03:48 262500 -- (-2090.577) (-2105.332) (-2100.073) [-2093.435] * (-2096.862) (-2096.117) [-2095.179] (-2097.824) -- 0:03:47 263000 -- (-2094.547) (-2100.148) (-2110.778) [-2087.731] * (-2106.710) [-2097.412] (-2096.036) (-2097.107) -- 0:03:46 263500 -- (-2088.374) (-2094.191) [-2100.013] (-2096.649) * (-2104.410) (-2097.463) (-2098.236) [-2095.773] -- 0:03:46 264000 -- [-2094.674] (-2098.831) (-2098.881) (-2100.385) * [-2099.962] (-2103.681) (-2098.889) (-2095.938) -- 0:03:45 264500 -- (-2091.219) (-2098.952) (-2103.018) [-2090.269] * (-2098.344) (-2092.445) [-2104.916] (-2093.816) -- 0:03:45 265000 -- (-2090.796) [-2091.420] (-2105.942) (-2094.067) * [-2095.144] (-2106.595) (-2093.251) (-2095.104) -- 0:03:44 Average standard deviation of split frequencies: 0.006203 265500 -- (-2094.415) (-2091.825) (-2088.840) [-2098.993] * (-2098.080) (-2093.718) [-2098.823] (-2096.824) -- 0:03:46 266000 -- (-2101.669) (-2101.681) (-2099.821) [-2093.454] * (-2099.305) (-2098.770) [-2090.775] (-2101.508) -- 0:03:46 266500 -- [-2108.029] (-2098.853) (-2093.366) (-2091.522) * (-2103.573) (-2095.278) [-2098.290] (-2097.310) -- 0:03:45 267000 -- (-2103.094) [-2099.506] (-2104.482) (-2092.035) * [-2094.820] (-2095.330) (-2108.025) (-2094.002) -- 0:03:45 267500 -- [-2093.528] (-2104.703) (-2093.936) (-2095.735) * [-2096.247] (-2107.599) (-2100.732) (-2095.696) -- 0:03:44 268000 -- [-2095.499] (-2102.115) (-2093.690) (-2098.521) * (-2105.871) [-2094.748] (-2098.173) (-2093.224) -- 0:03:43 268500 -- (-2105.507) [-2096.411] (-2108.883) (-2101.582) * (-2093.295) [-2097.398] (-2098.910) (-2099.582) -- 0:03:43 269000 -- [-2101.275] (-2096.987) (-2102.532) (-2102.374) * (-2094.707) (-2098.786) (-2095.802) [-2095.979] -- 0:03:45 269500 -- [-2096.271] (-2100.975) (-2101.311) (-2096.649) * (-2097.871) [-2096.459] (-2103.980) (-2098.931) -- 0:03:44 270000 -- (-2107.367) [-2089.561] (-2098.792) (-2091.345) * (-2106.421) (-2100.005) (-2090.331) [-2090.183] -- 0:03:44 Average standard deviation of split frequencies: 0.005225 270500 -- (-2098.385) (-2090.984) [-2094.148] (-2095.483) * (-2102.748) (-2095.992) (-2105.343) [-2092.382] -- 0:03:43 271000 -- (-2101.996) (-2097.821) (-2099.797) [-2095.926] * [-2090.845] (-2106.260) (-2092.873) (-2090.904) -- 0:03:43 271500 -- (-2106.668) [-2097.730] (-2096.475) (-2104.188) * (-2088.342) (-2093.882) [-2096.724] (-2094.532) -- 0:03:42 272000 -- [-2096.150] (-2100.463) (-2091.941) (-2092.073) * (-2101.198) (-2096.824) (-2096.183) [-2094.830] -- 0:03:42 272500 -- (-2100.440) [-2099.328] (-2093.150) (-2093.105) * [-2092.058] (-2100.039) (-2099.113) (-2101.059) -- 0:03:44 273000 -- (-2111.417) (-2097.457) (-2097.252) [-2092.115] * (-2093.092) (-2096.344) [-2097.466] (-2091.187) -- 0:03:43 273500 -- (-2105.398) [-2098.915] (-2096.899) (-2102.787) * (-2091.287) (-2099.227) [-2093.862] (-2095.331) -- 0:03:43 274000 -- [-2101.093] (-2088.222) (-2102.281) (-2092.250) * (-2096.672) (-2099.997) (-2094.362) [-2098.101] -- 0:03:42 274500 -- (-2095.488) (-2092.229) (-2099.831) [-2094.147] * (-2098.797) [-2096.576] (-2096.224) (-2095.184) -- 0:03:42 275000 -- (-2095.677) (-2093.496) [-2091.456] (-2095.291) * (-2096.246) (-2105.059) [-2095.983] (-2102.092) -- 0:03:41 Average standard deviation of split frequencies: 0.004697 275500 -- (-2099.235) [-2089.771] (-2095.937) (-2098.441) * (-2099.159) [-2097.713] (-2096.043) (-2097.739) -- 0:03:43 276000 -- (-2099.262) (-2095.375) (-2094.677) [-2089.002] * (-2091.132) (-2100.568) [-2092.426] (-2092.037) -- 0:03:42 276500 -- (-2108.131) (-2099.592) (-2094.756) [-2096.800] * [-2095.788] (-2094.438) (-2103.714) (-2097.250) -- 0:03:42 277000 -- (-2101.969) [-2093.859] (-2097.029) (-2107.792) * (-2100.307) [-2098.691] (-2096.552) (-2094.899) -- 0:03:41 277500 -- (-2100.810) (-2100.460) [-2090.010] (-2096.940) * [-2096.494] (-2095.434) (-2100.610) (-2097.824) -- 0:03:41 278000 -- (-2096.296) (-2098.930) (-2101.672) [-2096.384] * [-2095.303] (-2092.924) (-2102.491) (-2100.155) -- 0:03:40 278500 -- [-2093.926] (-2099.362) (-2092.993) (-2094.408) * (-2101.663) [-2097.174] (-2101.138) (-2101.770) -- 0:03:40 279000 -- (-2099.657) (-2091.833) (-2094.646) [-2096.776] * (-2093.708) (-2096.139) (-2095.924) [-2098.657] -- 0:03:42 279500 -- (-2095.937) [-2093.459] (-2095.218) (-2094.628) * (-2092.011) (-2098.462) (-2094.365) [-2097.376] -- 0:03:41 280000 -- (-2102.726) (-2094.743) (-2098.393) [-2099.329] * (-2095.039) [-2096.493] (-2097.959) (-2110.608) -- 0:03:41 Average standard deviation of split frequencies: 0.004619 280500 -- (-2093.504) (-2097.893) [-2099.209] (-2097.789) * [-2095.823] (-2100.000) (-2089.086) (-2094.614) -- 0:03:40 281000 -- (-2095.318) (-2106.762) (-2102.325) [-2104.149] * (-2098.234) (-2095.300) [-2092.869] (-2105.219) -- 0:03:40 281500 -- (-2102.755) (-2096.641) [-2092.761] (-2091.227) * (-2092.697) [-2090.833] (-2098.350) (-2094.125) -- 0:03:39 282000 -- [-2093.623] (-2101.864) (-2093.672) (-2092.983) * (-2096.435) (-2095.892) [-2095.042] (-2103.938) -- 0:03:41 282500 -- (-2090.837) (-2100.946) (-2093.771) [-2093.860] * (-2101.427) (-2098.017) (-2093.408) [-2098.090] -- 0:03:40 283000 -- (-2092.927) [-2094.836] (-2100.095) (-2094.715) * (-2103.375) [-2097.593] (-2092.323) (-2094.567) -- 0:03:40 283500 -- (-2095.868) (-2096.430) [-2106.361] (-2094.637) * (-2098.647) (-2095.814) (-2098.169) [-2097.222] -- 0:03:39 284000 -- (-2095.905) (-2095.530) [-2091.953] (-2106.403) * (-2098.546) (-2094.874) (-2101.733) [-2095.324] -- 0:03:39 284500 -- (-2090.912) (-2095.411) [-2096.169] (-2104.739) * (-2098.240) (-2100.522) [-2091.662] (-2097.375) -- 0:03:38 285000 -- (-2098.504) [-2102.505] (-2096.462) (-2095.407) * (-2104.929) (-2096.031) (-2096.509) [-2095.979] -- 0:03:40 Average standard deviation of split frequencies: 0.004121 285500 -- (-2093.908) (-2099.148) (-2102.950) [-2099.731] * (-2102.678) (-2098.332) [-2093.079] (-2095.007) -- 0:03:40 286000 -- (-2098.129) [-2095.473] (-2097.802) (-2109.111) * [-2097.807] (-2097.666) (-2092.171) (-2094.310) -- 0:03:39 286500 -- (-2092.858) (-2100.415) [-2100.112] (-2106.537) * (-2096.638) (-2090.781) [-2096.074] (-2097.504) -- 0:03:39 287000 -- [-2094.552] (-2094.915) (-2106.660) (-2100.072) * (-2096.552) (-2094.315) [-2091.784] (-2104.347) -- 0:03:38 287500 -- (-2105.215) (-2098.853) (-2094.452) [-2094.411] * (-2095.308) [-2093.993] (-2099.041) (-2097.165) -- 0:03:38 288000 -- [-2100.805] (-2099.293) (-2094.100) (-2094.507) * (-2103.958) (-2093.895) (-2098.744) [-2105.667] -- 0:03:37 288500 -- (-2095.911) (-2098.019) (-2096.188) [-2093.417] * (-2094.779) (-2101.194) (-2095.915) [-2094.744] -- 0:03:39 289000 -- (-2095.602) (-2091.175) [-2104.020] (-2092.661) * (-2104.643) [-2097.847] (-2092.765) (-2094.488) -- 0:03:38 289500 -- (-2102.316) [-2097.449] (-2094.690) (-2096.257) * [-2092.982] (-2100.079) (-2094.670) (-2097.284) -- 0:03:38 290000 -- (-2093.652) [-2097.321] (-2100.704) (-2097.276) * (-2090.658) [-2091.288] (-2095.411) (-2105.056) -- 0:03:37 Average standard deviation of split frequencies: 0.005271 290500 -- (-2090.586) (-2099.615) [-2091.475] (-2102.984) * (-2096.809) [-2092.284] (-2095.682) (-2094.881) -- 0:03:37 291000 -- (-2096.791) (-2098.068) [-2100.956] (-2099.271) * (-2102.318) [-2094.954] (-2094.533) (-2102.881) -- 0:03:36 291500 -- (-2107.018) (-2098.871) [-2090.127] (-2095.397) * (-2095.047) (-2102.533) [-2098.347] (-2100.623) -- 0:03:38 292000 -- (-2094.950) (-2110.723) [-2099.259] (-2095.782) * (-2101.695) (-2095.444) [-2096.061] (-2094.968) -- 0:03:38 292500 -- [-2095.845] (-2096.200) (-2094.969) (-2095.159) * (-2101.553) (-2100.011) (-2099.549) [-2099.726] -- 0:03:37 293000 -- [-2101.362] (-2100.094) (-2095.245) (-2094.424) * (-2091.747) (-2097.307) (-2095.688) [-2099.658] -- 0:03:37 293500 -- (-2095.917) [-2098.392] (-2096.064) (-2098.625) * (-2105.098) (-2103.620) (-2095.633) [-2095.276] -- 0:03:36 294000 -- (-2092.191) (-2099.725) [-2094.147] (-2092.006) * [-2093.649] (-2102.757) (-2101.373) (-2092.961) -- 0:03:36 294500 -- (-2107.979) (-2099.871) (-2109.406) [-2097.845] * (-2099.797) [-2096.856] (-2096.407) (-2091.902) -- 0:03:35 295000 -- (-2101.029) (-2100.747) [-2093.502] (-2096.693) * (-2103.371) (-2100.930) (-2096.875) [-2094.652] -- 0:03:37 Average standard deviation of split frequencies: 0.005574 295500 -- [-2100.268] (-2099.105) (-2097.162) (-2099.433) * [-2094.446] (-2093.712) (-2094.612) (-2090.684) -- 0:03:36 296000 -- [-2094.650] (-2100.516) (-2096.184) (-2102.672) * (-2097.188) [-2096.521] (-2095.495) (-2102.435) -- 0:03:36 296500 -- (-2096.950) (-2098.105) [-2093.420] (-2103.599) * [-2098.159] (-2097.207) (-2111.790) (-2090.960) -- 0:03:35 297000 -- (-2095.225) [-2092.493] (-2098.184) (-2099.033) * (-2100.382) [-2093.766] (-2103.963) (-2096.568) -- 0:03:35 297500 -- (-2101.762) [-2091.199] (-2096.977) (-2097.934) * (-2104.896) (-2101.751) (-2093.374) [-2095.957] -- 0:03:34 298000 -- (-2100.096) (-2099.080) (-2097.473) [-2093.509] * (-2094.920) (-2103.216) [-2097.218] (-2102.001) -- 0:03:34 298500 -- (-2099.832) (-2101.349) (-2106.808) [-2092.469] * (-2100.108) (-2092.871) (-2098.139) [-2097.502] -- 0:03:36 299000 -- (-2098.709) [-2096.725] (-2101.882) (-2099.177) * (-2100.869) (-2097.811) [-2090.123] (-2099.184) -- 0:03:35 299500 -- (-2104.613) (-2092.800) [-2098.164] (-2092.710) * (-2103.834) (-2095.308) [-2093.296] (-2103.143) -- 0:03:35 300000 -- (-2097.694) (-2096.922) (-2106.480) [-2095.903] * (-2094.578) (-2098.109) [-2095.074] (-2102.410) -- 0:03:34 Average standard deviation of split frequencies: 0.005488 300500 -- (-2098.418) (-2096.866) (-2092.792) [-2096.648] * (-2096.912) [-2098.231] (-2099.436) (-2099.384) -- 0:03:34 301000 -- [-2097.607] (-2100.978) (-2093.583) (-2102.354) * (-2113.772) (-2105.069) [-2101.465] (-2098.455) -- 0:03:33 301500 -- (-2097.297) (-2097.583) [-2096.998] (-2095.872) * [-2092.459] (-2104.757) (-2099.767) (-2092.509) -- 0:03:33 302000 -- (-2103.679) (-2096.648) (-2097.359) [-2092.286] * (-2099.382) (-2094.470) [-2099.006] (-2092.368) -- 0:03:34 302500 -- [-2097.227] (-2091.530) (-2096.015) (-2096.837) * (-2095.056) (-2094.400) (-2095.597) [-2097.082] -- 0:03:34 303000 -- (-2092.675) (-2096.570) (-2095.144) [-2096.454] * (-2107.063) (-2099.520) [-2097.061] (-2113.253) -- 0:03:33 303500 -- [-2099.155] (-2100.366) (-2102.161) (-2091.989) * (-2097.561) [-2097.368] (-2091.548) (-2097.533) -- 0:03:33 304000 -- [-2092.098] (-2097.795) (-2093.629) (-2093.645) * [-2095.623] (-2094.967) (-2091.871) (-2091.552) -- 0:03:32 304500 -- (-2099.000) (-2093.989) (-2098.342) [-2104.994] * (-2093.389) (-2099.020) (-2098.648) [-2095.796] -- 0:03:32 305000 -- (-2096.466) [-2094.902] (-2107.714) (-2097.649) * (-2096.548) (-2093.430) [-2095.768] (-2101.516) -- 0:03:34 Average standard deviation of split frequencies: 0.006547 305500 -- (-2102.654) (-2095.607) (-2097.123) [-2096.439] * (-2093.418) (-2096.703) (-2100.101) [-2090.107] -- 0:03:33 306000 -- (-2095.449) (-2114.246) [-2096.180] (-2091.843) * (-2098.922) (-2101.124) [-2091.109] (-2099.754) -- 0:03:33 306500 -- (-2101.354) (-2104.217) (-2102.364) [-2096.202] * (-2098.820) [-2089.911] (-2104.926) (-2091.936) -- 0:03:32 307000 -- [-2095.197] (-2103.713) (-2098.221) (-2099.507) * (-2094.140) [-2094.537] (-2100.900) (-2093.031) -- 0:03:32 307500 -- (-2093.118) (-2090.444) [-2095.844] (-2098.643) * (-2097.400) (-2098.124) (-2094.232) [-2092.378] -- 0:03:31 308000 -- (-2101.111) (-2096.070) [-2095.317] (-2095.925) * [-2098.490] (-2098.644) (-2094.841) (-2093.351) -- 0:03:33 308500 -- (-2094.381) (-2100.816) (-2100.163) [-2099.531] * (-2101.344) (-2101.495) [-2097.330] (-2101.101) -- 0:03:32 309000 -- (-2099.652) (-2094.407) (-2103.767) [-2091.425] * [-2103.327] (-2101.310) (-2097.134) (-2105.865) -- 0:03:32 309500 -- (-2093.446) [-2092.154] (-2098.023) (-2102.165) * (-2107.826) [-2101.866] (-2097.967) (-2095.262) -- 0:03:31 310000 -- (-2097.478) (-2097.203) [-2095.757] (-2092.367) * (-2097.668) [-2092.771] (-2096.788) (-2094.679) -- 0:03:31 Average standard deviation of split frequencies: 0.006449 310500 -- (-2096.696) [-2096.762] (-2102.033) (-2096.962) * (-2095.368) (-2098.138) (-2103.910) [-2093.852] -- 0:03:30 311000 -- [-2095.569] (-2101.076) (-2099.456) (-2104.542) * (-2095.589) (-2101.236) (-2100.241) [-2096.133] -- 0:03:30 311500 -- (-2101.952) [-2095.112] (-2102.848) (-2093.058) * (-2092.370) (-2103.092) (-2096.893) [-2100.508] -- 0:03:32 312000 -- (-2099.069) (-2109.386) [-2096.501] (-2107.451) * (-2095.671) (-2103.418) [-2093.022] (-2096.957) -- 0:03:31 312500 -- (-2104.922) [-2091.657] (-2094.133) (-2102.225) * (-2096.143) [-2096.199] (-2100.904) (-2100.095) -- 0:03:31 313000 -- (-2099.112) (-2094.325) (-2093.668) [-2099.253] * (-2091.329) [-2096.406] (-2093.921) (-2098.126) -- 0:03:30 313500 -- (-2103.626) [-2100.879] (-2102.703) (-2098.795) * (-2094.066) (-2094.366) (-2101.565) [-2093.814] -- 0:03:30 314000 -- (-2096.388) (-2095.813) (-2094.003) [-2095.343] * (-2097.338) [-2096.784] (-2095.508) (-2101.754) -- 0:03:29 314500 -- (-2098.863) (-2090.010) [-2097.932] (-2100.094) * [-2092.579] (-2099.184) (-2096.376) (-2095.232) -- 0:03:29 315000 -- [-2107.291] (-2091.080) (-2103.815) (-2098.875) * (-2098.621) [-2102.007] (-2099.058) (-2089.977) -- 0:03:30 Average standard deviation of split frequencies: 0.006340 315500 -- (-2096.827) (-2100.358) (-2099.210) [-2109.507] * (-2094.167) (-2097.930) [-2096.106] (-2103.086) -- 0:03:30 316000 -- (-2098.114) (-2097.222) [-2094.246] (-2090.767) * [-2095.232] (-2108.117) (-2090.853) (-2098.023) -- 0:03:29 316500 -- (-2108.001) [-2090.579] (-2095.865) (-2097.075) * [-2093.961] (-2094.890) (-2095.545) (-2102.149) -- 0:03:29 317000 -- (-2100.717) (-2097.763) (-2094.388) [-2098.367] * (-2093.890) [-2100.074] (-2097.693) (-2102.015) -- 0:03:28 317500 -- (-2097.230) [-2094.887] (-2089.681) (-2102.052) * (-2102.567) [-2101.224] (-2097.519) (-2093.501) -- 0:03:28 318000 -- (-2096.089) (-2099.327) (-2109.480) [-2097.162] * (-2094.663) [-2095.653] (-2104.206) (-2094.491) -- 0:03:28 318500 -- (-2094.968) [-2089.906] (-2095.579) (-2102.534) * (-2092.919) (-2095.707) (-2099.366) [-2096.441] -- 0:03:29 319000 -- (-2092.250) (-2097.784) (-2097.893) [-2095.403] * [-2091.914] (-2100.817) (-2108.759) (-2098.836) -- 0:03:29 319500 -- [-2092.527] (-2097.069) (-2099.903) (-2091.813) * (-2103.422) (-2099.121) (-2097.909) [-2094.252] -- 0:03:28 320000 -- [-2093.831] (-2096.746) (-2097.929) (-2105.830) * (-2095.310) (-2091.617) [-2097.284] (-2101.822) -- 0:03:28 Average standard deviation of split frequencies: 0.006615 320500 -- [-2100.314] (-2098.877) (-2099.614) (-2102.441) * (-2091.162) [-2094.110] (-2099.784) (-2092.219) -- 0:03:27 321000 -- (-2092.896) [-2097.018] (-2109.583) (-2102.031) * (-2094.846) (-2104.204) [-2089.518] (-2091.160) -- 0:03:27 321500 -- (-2093.736) [-2100.067] (-2104.997) (-2095.250) * [-2098.720] (-2096.759) (-2097.661) (-2096.046) -- 0:03:28 322000 -- [-2101.349] (-2098.912) (-2109.105) (-2094.882) * (-2099.277) (-2100.455) (-2091.852) [-2093.204] -- 0:03:28 322500 -- (-2096.148) [-2093.452] (-2106.136) (-2098.598) * (-2099.331) (-2096.885) (-2101.620) [-2096.289] -- 0:03:27 323000 -- [-2098.422] (-2105.407) (-2098.325) (-2096.748) * [-2100.426] (-2093.617) (-2100.102) (-2108.657) -- 0:03:27 323500 -- (-2099.741) (-2100.632) [-2090.732] (-2101.557) * (-2097.777) (-2095.966) [-2094.245] (-2099.682) -- 0:03:27 324000 -- (-2095.264) (-2092.392) (-2098.527) [-2100.919] * (-2101.896) (-2092.572) [-2090.298] (-2097.087) -- 0:03:26 324500 -- (-2091.815) [-2097.744] (-2103.669) (-2093.501) * (-2107.613) (-2094.118) [-2094.078] (-2094.033) -- 0:03:28 325000 -- (-2097.794) [-2101.791] (-2097.101) (-2090.826) * [-2092.327] (-2100.376) (-2097.717) (-2097.551) -- 0:03:27 Average standard deviation of split frequencies: 0.006146 325500 -- (-2103.182) [-2096.753] (-2097.577) (-2095.548) * [-2092.391] (-2100.457) (-2105.516) (-2094.084) -- 0:03:27 326000 -- (-2101.962) [-2095.020] (-2106.266) (-2094.136) * [-2098.168] (-2097.911) (-2098.258) (-2105.455) -- 0:03:26 326500 -- (-2105.462) [-2093.317] (-2100.233) (-2094.997) * (-2099.875) (-2089.884) [-2103.010] (-2106.946) -- 0:03:26 327000 -- (-2110.734) (-2095.083) (-2100.829) [-2092.454] * (-2094.133) (-2099.880) [-2092.576] (-2100.075) -- 0:03:25 327500 -- (-2098.201) (-2098.478) [-2091.596] (-2097.763) * (-2091.685) (-2097.221) (-2092.047) [-2091.958] -- 0:03:25 328000 -- (-2099.568) [-2092.081] (-2094.021) (-2097.975) * (-2093.993) (-2102.457) [-2092.391] (-2097.269) -- 0:03:26 328500 -- (-2101.087) [-2100.034] (-2095.215) (-2091.613) * (-2098.539) [-2097.893] (-2096.044) (-2093.555) -- 0:03:26 329000 -- [-2098.257] (-2094.793) (-2098.292) (-2100.066) * (-2100.193) (-2100.058) [-2091.170] (-2103.882) -- 0:03:25 329500 -- [-2094.523] (-2091.205) (-2097.137) (-2094.290) * (-2096.818) (-2103.925) (-2096.306) [-2107.363] -- 0:03:25 330000 -- (-2097.172) [-2094.222] (-2098.951) (-2098.999) * (-2098.672) (-2097.469) [-2095.828] (-2098.909) -- 0:03:25 Average standard deviation of split frequencies: 0.004990 330500 -- (-2095.033) [-2098.956] (-2099.680) (-2095.061) * (-2096.450) (-2095.212) [-2093.581] (-2093.391) -- 0:03:24 331000 -- (-2094.849) (-2096.482) (-2098.980) [-2089.705] * (-2094.254) (-2102.890) [-2092.619] (-2097.001) -- 0:03:26 331500 -- (-2097.318) (-2098.751) [-2095.627] (-2101.698) * (-2102.285) (-2099.228) (-2102.682) [-2098.058] -- 0:03:25 332000 -- (-2098.511) (-2093.060) [-2090.582] (-2092.686) * (-2098.329) [-2096.845] (-2096.751) (-2089.186) -- 0:03:25 332500 -- (-2098.560) (-2091.062) (-2100.275) [-2099.633] * (-2104.333) [-2096.826] (-2099.867) (-2095.748) -- 0:03:24 333000 -- (-2099.755) (-2091.492) (-2098.092) [-2092.073] * (-2097.309) (-2093.942) (-2096.264) [-2093.720] -- 0:03:24 333500 -- (-2100.525) (-2099.067) (-2099.081) [-2095.302] * (-2103.529) [-2092.192] (-2089.889) (-2099.911) -- 0:03:23 334000 -- [-2099.316] (-2098.599) (-2103.601) (-2094.296) * (-2102.503) [-2096.758] (-2096.554) (-2104.053) -- 0:03:25 334500 -- [-2095.801] (-2098.356) (-2100.888) (-2097.660) * (-2105.228) (-2097.156) [-2090.403] (-2103.687) -- 0:03:24 335000 -- [-2095.227] (-2099.123) (-2092.864) (-2096.172) * (-2097.019) [-2099.575] (-2091.849) (-2097.611) -- 0:03:24 Average standard deviation of split frequencies: 0.004910 335500 -- (-2096.400) [-2098.594] (-2097.212) (-2106.977) * (-2101.092) (-2097.904) (-2093.319) [-2093.706] -- 0:03:24 336000 -- (-2092.494) (-2095.989) [-2098.677] (-2103.944) * (-2103.554) (-2093.880) [-2095.037] (-2099.082) -- 0:03:23 336500 -- (-2104.276) (-2095.359) [-2094.228] (-2097.515) * (-2093.961) (-2098.033) (-2102.763) [-2088.885] -- 0:03:23 337000 -- (-2100.735) (-2103.139) [-2097.097] (-2094.643) * (-2095.626) (-2095.663) [-2098.652] (-2093.998) -- 0:03:22 337500 -- (-2096.349) (-2101.110) [-2091.369] (-2091.305) * (-2108.778) (-2097.173) [-2095.497] (-2092.976) -- 0:03:24 338000 -- (-2097.711) (-2108.629) [-2093.533] (-2096.693) * (-2092.477) (-2100.244) [-2094.824] (-2094.965) -- 0:03:23 338500 -- (-2097.866) [-2101.608] (-2095.412) (-2096.635) * (-2099.836) (-2099.247) (-2098.809) [-2090.163] -- 0:03:23 339000 -- (-2101.068) (-2099.909) (-2093.367) [-2096.335] * [-2092.061] (-2100.379) (-2098.825) (-2092.073) -- 0:03:22 339500 -- (-2101.881) (-2099.690) (-2096.146) [-2094.429] * (-2101.554) (-2096.229) (-2096.472) [-2098.655] -- 0:03:22 340000 -- (-2093.721) (-2095.132) [-2098.319] (-2108.319) * [-2097.444] (-2088.526) (-2093.789) (-2104.090) -- 0:03:21 Average standard deviation of split frequencies: 0.003805 340500 -- (-2095.207) (-2095.144) [-2098.571] (-2101.960) * (-2097.300) [-2092.238] (-2100.701) (-2093.720) -- 0:03:23 341000 -- (-2102.880) (-2091.406) (-2102.551) [-2100.660] * (-2102.422) (-2092.046) (-2099.233) [-2096.904] -- 0:03:22 341500 -- (-2098.102) [-2101.738] (-2094.974) (-2096.357) * (-2104.048) (-2096.479) [-2098.375] (-2108.979) -- 0:03:22 342000 -- (-2104.154) (-2094.809) [-2095.464] (-2095.649) * (-2088.589) (-2097.256) [-2099.554] (-2098.099) -- 0:03:22 342500 -- (-2103.031) (-2102.459) (-2100.200) [-2097.088] * (-2102.537) [-2097.953] (-2101.053) (-2095.786) -- 0:03:21 343000 -- (-2106.814) (-2102.073) [-2102.099] (-2109.971) * [-2095.328] (-2093.174) (-2097.407) (-2099.979) -- 0:03:21 343500 -- (-2096.464) (-2098.210) [-2095.627] (-2103.343) * (-2101.791) [-2092.669] (-2101.412) (-2098.426) -- 0:03:20 344000 -- (-2096.910) [-2098.305] (-2107.415) (-2099.096) * [-2094.672] (-2107.767) (-2096.234) (-2096.572) -- 0:03:22 344500 -- (-2093.090) (-2098.927) (-2104.370) [-2097.209] * [-2097.268] (-2102.469) (-2094.585) (-2096.129) -- 0:03:21 345000 -- (-2096.144) (-2090.360) (-2106.910) [-2096.858] * [-2094.207] (-2094.549) (-2097.832) (-2110.250) -- 0:03:21 Average standard deviation of split frequencies: 0.004087 345500 -- (-2099.956) (-2096.161) (-2103.014) [-2098.458] * [-2095.598] (-2097.262) (-2100.177) (-2121.753) -- 0:03:20 346000 -- (-2096.365) [-2096.451] (-2098.646) (-2091.801) * (-2092.931) [-2096.617] (-2093.998) (-2091.752) -- 0:03:20 346500 -- (-2099.398) (-2095.680) [-2093.008] (-2095.446) * (-2100.572) (-2103.903) [-2098.673] (-2098.713) -- 0:03:19 347000 -- (-2094.585) (-2095.952) [-2094.844] (-2095.925) * (-2093.245) [-2096.049] (-2091.427) (-2092.048) -- 0:03:19 347500 -- (-2092.279) (-2107.010) [-2094.765] (-2096.572) * [-2104.589] (-2093.717) (-2096.349) (-2100.726) -- 0:03:20 348000 -- (-2099.735) (-2099.820) [-2092.707] (-2097.886) * [-2097.876] (-2101.794) (-2090.132) (-2096.441) -- 0:03:20 348500 -- [-2098.304] (-2099.221) (-2094.289) (-2093.113) * (-2092.034) (-2106.745) [-2097.000] (-2098.894) -- 0:03:20 349000 -- (-2095.613) [-2095.394] (-2101.688) (-2095.043) * (-2090.455) (-2098.771) [-2102.556] (-2099.433) -- 0:03:19 349500 -- (-2091.080) [-2093.311] (-2098.191) (-2099.829) * (-2095.294) [-2100.410] (-2104.621) (-2093.126) -- 0:03:19 350000 -- [-2092.529] (-2104.143) (-2094.402) (-2095.295) * (-2099.460) [-2095.417] (-2099.278) (-2098.554) -- 0:03:18 Average standard deviation of split frequencies: 0.005377 350500 -- (-2098.795) (-2096.909) [-2093.108] (-2094.367) * (-2098.560) (-2093.626) [-2092.853] (-2099.920) -- 0:03:18 351000 -- (-2101.476) (-2093.935) (-2105.387) [-2094.712] * (-2102.930) (-2098.295) [-2093.932] (-2099.034) -- 0:03:19 351500 -- (-2091.723) [-2095.066] (-2096.366) (-2096.091) * (-2097.739) (-2099.136) (-2098.626) [-2094.972] -- 0:03:19 352000 -- (-2100.361) [-2094.233] (-2093.668) (-2096.811) * (-2091.510) (-2104.812) [-2096.065] (-2095.765) -- 0:03:18 352500 -- (-2100.243) (-2094.731) (-2098.840) [-2093.247] * [-2096.657] (-2107.053) (-2091.381) (-2094.497) -- 0:03:18 353000 -- (-2102.500) (-2094.490) [-2090.962] (-2090.801) * (-2100.171) [-2091.634] (-2095.710) (-2093.651) -- 0:03:17 353500 -- (-2094.724) (-2092.876) (-2089.248) [-2092.979] * (-2101.600) (-2103.397) [-2100.283] (-2103.587) -- 0:03:17 354000 -- [-2096.003] (-2094.492) (-2096.290) (-2105.377) * (-2099.369) (-2096.570) [-2093.440] (-2100.170) -- 0:03:18 354500 -- (-2094.585) (-2100.991) [-2099.641] (-2106.561) * (-2097.147) (-2094.121) (-2098.975) [-2104.010] -- 0:03:18 355000 -- (-2096.364) [-2096.070] (-2101.502) (-2095.177) * (-2100.742) (-2099.403) (-2093.752) [-2104.901] -- 0:03:18 Average standard deviation of split frequencies: 0.004635 355500 -- (-2095.837) (-2097.294) (-2092.774) [-2095.190] * [-2090.696] (-2096.148) (-2091.230) (-2101.015) -- 0:03:17 356000 -- (-2093.180) (-2099.196) (-2095.362) [-2095.810] * (-2093.485) [-2103.902] (-2095.199) (-2101.995) -- 0:03:17 356500 -- (-2099.054) (-2099.190) [-2092.415] (-2094.000) * (-2100.213) (-2111.428) (-2099.725) [-2094.575] -- 0:03:16 357000 -- (-2092.058) (-2102.673) [-2089.928] (-2097.967) * [-2092.992] (-2103.956) (-2100.784) (-2104.203) -- 0:03:16 357500 -- (-2098.605) (-2096.816) (-2098.315) [-2092.647] * [-2098.293] (-2099.043) (-2092.571) (-2097.948) -- 0:03:17 358000 -- (-2094.418) (-2099.008) (-2097.791) [-2094.167] * (-2100.851) [-2097.724] (-2097.070) (-2092.217) -- 0:03:17 358500 -- (-2104.763) (-2101.091) [-2096.164] (-2092.879) * (-2107.381) (-2089.982) (-2090.542) [-2096.831] -- 0:03:16 359000 -- (-2095.009) (-2100.023) (-2098.292) [-2093.749] * (-2099.511) (-2099.250) [-2090.251] (-2091.711) -- 0:03:16 359500 -- (-2101.187) (-2098.107) [-2097.237] (-2095.689) * (-2095.747) (-2093.691) (-2094.867) [-2093.303] -- 0:03:15 360000 -- (-2096.438) [-2095.434] (-2095.020) (-2095.116) * (-2092.246) (-2099.198) (-2090.314) [-2092.693] -- 0:03:15 Average standard deviation of split frequencies: 0.004575 360500 -- [-2093.459] (-2098.586) (-2099.541) (-2103.367) * (-2108.805) (-2096.056) (-2096.331) [-2092.446] -- 0:03:15 361000 -- [-2094.535] (-2099.250) (-2101.550) (-2098.164) * (-2103.324) [-2095.802] (-2110.452) (-2092.500) -- 0:03:16 361500 -- (-2101.143) (-2093.142) [-2095.905] (-2093.457) * (-2101.661) (-2094.849) (-2101.640) [-2091.533] -- 0:03:16 362000 -- [-2094.874] (-2091.851) (-2103.437) (-2093.424) * (-2097.188) [-2089.190] (-2099.359) (-2095.131) -- 0:03:15 362500 -- (-2095.032) [-2097.232] (-2098.432) (-2099.297) * (-2094.270) (-2090.278) (-2098.009) [-2097.928] -- 0:03:15 363000 -- (-2106.955) (-2101.463) [-2098.957] (-2098.994) * [-2095.677] (-2097.497) (-2090.406) (-2099.840) -- 0:03:14 363500 -- (-2098.934) [-2099.121] (-2104.649) (-2106.080) * (-2111.256) [-2093.214] (-2103.842) (-2095.338) -- 0:03:14 364000 -- (-2099.255) (-2096.989) [-2094.469] (-2097.526) * (-2105.530) (-2103.768) (-2097.788) [-2097.407] -- 0:03:15 364500 -- (-2099.537) (-2100.616) [-2092.799] (-2094.859) * (-2102.721) (-2099.136) (-2104.743) [-2101.895] -- 0:03:15 365000 -- (-2097.759) [-2096.661] (-2099.747) (-2097.554) * [-2097.171] (-2105.533) (-2096.946) (-2094.665) -- 0:03:14 Average standard deviation of split frequencies: 0.005796 365500 -- (-2100.136) (-2096.081) [-2093.802] (-2097.571) * [-2096.269] (-2105.062) (-2096.777) (-2097.111) -- 0:03:14 366000 -- (-2096.246) (-2100.792) [-2095.341] (-2092.243) * [-2099.074] (-2096.912) (-2092.257) (-2098.735) -- 0:03:14 366500 -- (-2091.868) (-2099.299) [-2093.834] (-2097.081) * (-2102.702) (-2095.198) [-2090.627] (-2096.598) -- 0:03:13 367000 -- (-2097.599) (-2093.994) [-2099.417] (-2102.088) * [-2091.270] (-2091.656) (-2094.348) (-2097.102) -- 0:03:13 367500 -- [-2090.247] (-2095.470) (-2100.456) (-2096.318) * [-2100.958] (-2096.478) (-2098.800) (-2094.459) -- 0:03:14 368000 -- (-2093.385) [-2095.512] (-2092.414) (-2100.109) * (-2096.186) [-2103.540] (-2102.159) (-2096.156) -- 0:03:14 368500 -- [-2090.282] (-2096.793) (-2092.591) (-2097.970) * [-2093.736] (-2097.205) (-2099.332) (-2095.091) -- 0:03:13 369000 -- (-2097.234) (-2100.204) [-2101.401] (-2097.811) * (-2098.806) (-2098.871) (-2100.137) [-2094.546] -- 0:03:13 369500 -- (-2095.251) (-2093.987) [-2091.933] (-2106.529) * [-2094.670] (-2101.721) (-2099.903) (-2100.170) -- 0:03:12 370000 -- (-2096.943) (-2096.786) [-2099.257] (-2091.931) * (-2100.947) (-2099.366) (-2095.698) [-2095.412] -- 0:03:12 Average standard deviation of split frequencies: 0.005723 370500 -- (-2096.640) [-2096.736] (-2100.366) (-2097.360) * (-2100.763) (-2098.878) (-2093.980) [-2099.952] -- 0:03:11 371000 -- [-2092.392] (-2097.059) (-2099.822) (-2091.157) * (-2108.731) (-2097.051) (-2093.329) [-2098.069] -- 0:03:13 371500 -- (-2096.869) [-2097.675] (-2099.098) (-2094.089) * (-2094.675) (-2100.720) [-2102.489] (-2097.345) -- 0:03:12 372000 -- (-2107.790) [-2091.573] (-2099.494) (-2091.672) * (-2097.221) (-2104.792) [-2095.836] (-2093.896) -- 0:03:12 372500 -- [-2102.862] (-2094.567) (-2098.829) (-2102.631) * (-2105.179) (-2089.309) (-2098.367) [-2099.355] -- 0:03:12 373000 -- (-2103.063) (-2105.358) [-2091.587] (-2092.567) * (-2099.326) [-2091.394] (-2104.866) (-2111.867) -- 0:03:11 373500 -- (-2104.691) (-2096.237) (-2096.695) [-2094.553] * (-2099.829) (-2093.648) (-2104.721) [-2098.835] -- 0:03:11 374000 -- [-2096.445] (-2095.625) (-2093.005) (-2092.757) * (-2105.375) [-2088.922] (-2096.739) (-2098.962) -- 0:03:12 374500 -- (-2098.670) [-2097.615] (-2091.059) (-2088.560) * (-2098.524) [-2097.278] (-2103.403) (-2100.486) -- 0:03:12 375000 -- (-2099.474) (-2102.961) (-2097.832) [-2091.286] * (-2105.102) [-2092.946] (-2097.061) (-2097.447) -- 0:03:11 Average standard deviation of split frequencies: 0.005642 375500 -- [-2096.265] (-2096.897) (-2096.891) (-2099.697) * (-2095.819) (-2105.133) [-2100.516] (-2095.745) -- 0:03:11 376000 -- (-2100.911) [-2095.822] (-2103.737) (-2096.954) * (-2100.455) [-2103.933] (-2109.911) (-2099.197) -- 0:03:10 376500 -- [-2097.427] (-2093.877) (-2103.222) (-2098.597) * (-2097.443) (-2102.889) (-2098.882) [-2094.836] -- 0:03:10 377000 -- (-2099.466) (-2107.302) [-2095.695] (-2103.135) * (-2106.302) [-2091.165] (-2099.265) (-2094.811) -- 0:03:10 377500 -- (-2096.590) [-2097.691] (-2104.257) (-2092.721) * (-2104.786) (-2103.168) (-2099.030) [-2096.396] -- 0:03:11 378000 -- (-2100.707) (-2094.838) [-2103.101] (-2092.049) * [-2097.908] (-2094.413) (-2094.434) (-2104.511) -- 0:03:10 378500 -- (-2094.612) [-2097.562] (-2096.684) (-2094.476) * (-2101.909) (-2097.010) [-2099.013] (-2095.808) -- 0:03:10 379000 -- (-2098.652) [-2094.008] (-2106.240) (-2099.546) * (-2099.564) (-2106.194) [-2095.313] (-2097.301) -- 0:03:10 379500 -- (-2092.157) (-2100.562) [-2093.157] (-2101.121) * (-2113.079) [-2101.304] (-2100.240) (-2091.157) -- 0:03:09 380000 -- [-2100.540] (-2089.875) (-2090.615) (-2107.560) * (-2092.133) (-2099.468) (-2097.707) [-2092.486] -- 0:03:09 Average standard deviation of split frequencies: 0.004953 380500 -- (-2105.743) (-2097.681) [-2095.319] (-2093.522) * (-2097.532) (-2095.396) (-2091.579) [-2093.941] -- 0:03:08 381000 -- [-2097.220] (-2099.767) (-2098.989) (-2099.862) * (-2108.626) (-2098.439) [-2093.818] (-2094.556) -- 0:03:10 381500 -- [-2092.990] (-2091.292) (-2093.970) (-2101.182) * (-2105.485) (-2097.877) [-2094.185] (-2094.189) -- 0:03:09 382000 -- (-2101.259) [-2090.821] (-2093.486) (-2097.576) * [-2094.547] (-2103.676) (-2094.625) (-2097.122) -- 0:03:09 382500 -- (-2092.236) (-2101.457) [-2098.921] (-2091.213) * (-2094.124) (-2099.501) (-2098.840) [-2095.773] -- 0:03:08 383000 -- (-2098.641) (-2096.006) [-2091.013] (-2091.802) * (-2093.565) [-2100.768] (-2102.223) (-2101.634) -- 0:03:08 383500 -- (-2096.854) [-2094.712] (-2088.674) (-2096.075) * [-2091.810] (-2097.671) (-2099.375) (-2102.037) -- 0:03:08 384000 -- (-2094.670) [-2097.517] (-2096.144) (-2097.902) * [-2094.848] (-2095.437) (-2100.121) (-2110.932) -- 0:03:09 384500 -- (-2107.092) [-2094.636] (-2093.925) (-2099.053) * [-2091.699] (-2108.556) (-2095.647) (-2098.962) -- 0:03:08 385000 -- (-2103.258) [-2096.819] (-2099.885) (-2095.933) * (-2100.991) (-2102.438) (-2111.158) [-2097.725] -- 0:03:08 Average standard deviation of split frequencies: 0.005190 385500 -- (-2102.162) [-2091.501] (-2102.294) (-2091.679) * (-2091.508) [-2097.763] (-2098.730) (-2094.933) -- 0:03:08 386000 -- (-2110.610) (-2094.389) (-2106.318) [-2090.510] * (-2098.312) (-2105.364) (-2094.276) [-2090.608] -- 0:03:07 386500 -- (-2099.265) [-2092.162] (-2100.563) (-2097.906) * (-2095.558) [-2103.506] (-2098.077) (-2090.631) -- 0:03:07 387000 -- (-2091.785) (-2090.955) [-2096.255] (-2098.184) * (-2102.386) (-2115.953) [-2096.213] (-2097.694) -- 0:03:06 387500 -- (-2097.119) (-2095.801) (-2100.706) [-2092.809] * (-2095.793) (-2110.670) [-2094.831] (-2094.851) -- 0:03:08 388000 -- (-2096.787) (-2090.804) (-2098.330) [-2095.396] * (-2098.418) [-2095.393] (-2093.724) (-2100.146) -- 0:03:07 388500 -- [-2090.150] (-2101.124) (-2094.335) (-2100.044) * (-2094.917) [-2101.581] (-2091.120) (-2096.771) -- 0:03:07 389000 -- (-2092.187) [-2095.415] (-2100.027) (-2100.250) * (-2092.375) [-2092.958] (-2094.799) (-2092.027) -- 0:03:06 389500 -- (-2100.119) (-2095.029) [-2091.135] (-2098.220) * (-2102.166) (-2099.407) [-2094.258] (-2090.998) -- 0:03:06 390000 -- (-2096.588) [-2092.774] (-2091.434) (-2092.209) * (-2099.677) [-2099.128] (-2101.776) (-2093.459) -- 0:03:06 Average standard deviation of split frequencies: 0.005732 390500 -- (-2096.920) (-2092.833) (-2096.029) [-2094.145] * (-2096.531) (-2095.900) [-2093.153] (-2099.757) -- 0:03:05 391000 -- [-2094.593] (-2095.649) (-2090.731) (-2092.192) * (-2099.471) [-2089.491] (-2098.141) (-2100.036) -- 0:03:06 391500 -- (-2091.129) (-2095.757) [-2097.689] (-2093.736) * (-2098.314) [-2089.892] (-2098.522) (-2099.547) -- 0:03:06 392000 -- (-2095.713) (-2098.587) [-2098.984] (-2094.340) * (-2101.521) (-2099.339) (-2093.592) [-2091.556] -- 0:03:06 392500 -- (-2104.876) (-2106.368) [-2093.145] (-2090.461) * (-2098.617) (-2102.568) (-2093.859) [-2095.827] -- 0:03:05 393000 -- (-2096.680) (-2100.276) [-2105.746] (-2095.410) * [-2096.918] (-2093.937) (-2096.674) (-2100.585) -- 0:03:05 393500 -- (-2099.751) [-2091.398] (-2108.795) (-2096.014) * [-2100.555] (-2093.108) (-2097.802) (-2092.377) -- 0:03:04 394000 -- (-2101.495) (-2094.181) [-2097.826] (-2094.483) * (-2093.364) (-2095.992) [-2094.840] (-2094.295) -- 0:03:06 394500 -- [-2095.959] (-2095.337) (-2093.881) (-2095.655) * (-2102.294) (-2094.551) [-2092.947] (-2093.139) -- 0:03:05 395000 -- (-2100.624) (-2090.650) [-2093.947] (-2104.091) * [-2104.109] (-2096.611) (-2095.058) (-2096.949) -- 0:03:05 Average standard deviation of split frequencies: 0.004762 395500 -- (-2099.852) [-2096.195] (-2101.281) (-2106.646) * (-2102.587) [-2094.259] (-2089.818) (-2093.374) -- 0:03:04 396000 -- (-2092.107) (-2102.039) [-2098.108] (-2099.298) * (-2093.769) (-2102.155) (-2093.780) [-2091.730] -- 0:03:04 396500 -- (-2101.059) [-2089.308] (-2101.321) (-2094.222) * (-2099.712) [-2096.945] (-2096.612) (-2089.555) -- 0:03:04 397000 -- (-2104.177) (-2094.925) (-2090.354) [-2094.490] * (-2110.719) (-2099.187) [-2094.828] (-2099.642) -- 0:03:03 397500 -- (-2099.752) (-2092.963) [-2095.197] (-2094.416) * (-2097.588) (-2099.506) (-2093.411) [-2101.926] -- 0:03:04 398000 -- (-2105.157) [-2094.889] (-2095.393) (-2098.923) * (-2102.100) (-2098.734) (-2095.615) [-2094.560] -- 0:03:04 398500 -- (-2097.048) (-2095.846) [-2091.390] (-2095.382) * (-2096.048) (-2094.803) (-2105.251) [-2092.388] -- 0:03:04 399000 -- (-2096.821) (-2098.173) [-2089.865] (-2101.860) * (-2093.606) (-2097.515) [-2098.162] (-2107.932) -- 0:03:03 399500 -- (-2091.921) (-2094.145) [-2099.258] (-2098.789) * (-2098.223) (-2103.843) (-2102.907) [-2093.929] -- 0:03:03 400000 -- [-2094.118] (-2093.887) (-2101.931) (-2093.450) * [-2094.757] (-2099.792) (-2099.817) (-2097.161) -- 0:03:03 Average standard deviation of split frequencies: 0.004412 400500 -- (-2094.443) (-2091.880) (-2099.851) [-2100.200] * (-2094.550) (-2100.798) (-2102.077) [-2095.163] -- 0:03:02 401000 -- (-2097.551) (-2095.515) [-2099.646] (-2099.138) * (-2099.670) [-2095.648] (-2092.347) (-2092.999) -- 0:03:03 401500 -- (-2097.076) [-2093.687] (-2101.642) (-2095.073) * (-2091.589) (-2091.669) [-2102.255] (-2095.199) -- 0:03:03 402000 -- (-2095.212) (-2100.794) (-2108.349) [-2097.028] * (-2097.135) [-2093.310] (-2096.252) (-2092.731) -- 0:03:02 402500 -- (-2097.718) (-2097.625) (-2105.895) [-2095.840] * (-2091.812) (-2098.697) (-2096.671) [-2094.525] -- 0:03:02 403000 -- (-2092.416) (-2096.876) (-2102.164) [-2094.412] * (-2097.752) [-2091.958] (-2098.379) (-2100.192) -- 0:03:02 403500 -- (-2099.501) (-2092.963) [-2092.331] (-2098.370) * (-2091.559) (-2094.906) [-2100.586] (-2100.503) -- 0:03:01 404000 -- (-2096.875) (-2090.119) (-2093.671) [-2095.594] * [-2093.509] (-2100.592) (-2101.219) (-2092.179) -- 0:03:02 404500 -- (-2101.331) [-2097.545] (-2096.142) (-2100.492) * (-2096.719) [-2101.910] (-2100.972) (-2101.457) -- 0:03:02 405000 -- (-2095.020) [-2093.746] (-2098.751) (-2104.267) * [-2093.444] (-2093.201) (-2103.861) (-2100.176) -- 0:03:02 Average standard deviation of split frequencies: 0.004644 405500 -- (-2096.510) (-2104.820) [-2091.168] (-2099.955) * (-2099.334) [-2096.233] (-2096.015) (-2097.861) -- 0:03:01 406000 -- (-2097.442) (-2094.244) (-2100.693) [-2093.325] * [-2099.461] (-2107.842) (-2101.986) (-2098.707) -- 0:03:01 406500 -- [-2101.784] (-2094.342) (-2104.136) (-2099.325) * [-2090.944] (-2100.642) (-2099.698) (-2105.849) -- 0:03:01 407000 -- (-2098.429) [-2094.909] (-2094.407) (-2103.000) * (-2095.144) [-2095.576] (-2104.673) (-2104.230) -- 0:03:00 407500 -- [-2089.844] (-2094.975) (-2099.019) (-2099.117) * (-2097.652) [-2091.690] (-2099.236) (-2098.874) -- 0:03:01 408000 -- (-2099.941) (-2103.864) [-2095.794] (-2096.257) * (-2097.972) (-2093.813) (-2095.683) [-2094.426] -- 0:03:01 408500 -- (-2102.378) (-2099.018) [-2096.090] (-2096.814) * (-2096.118) (-2098.667) [-2100.071] (-2106.016) -- 0:03:00 409000 -- (-2105.199) (-2093.124) (-2092.538) [-2098.476] * [-2093.425] (-2094.611) (-2094.761) (-2089.589) -- 0:03:00 409500 -- [-2097.811] (-2105.303) (-2092.746) (-2089.828) * (-2099.097) (-2092.238) (-2096.081) [-2099.456] -- 0:03:00 410000 -- (-2094.078) (-2096.987) [-2096.328] (-2094.321) * (-2102.220) (-2092.022) (-2099.042) [-2093.259] -- 0:02:59 Average standard deviation of split frequencies: 0.003731 410500 -- (-2098.067) (-2095.087) [-2094.096] (-2092.901) * (-2096.222) (-2096.756) [-2100.540] (-2095.629) -- 0:02:59 411000 -- (-2103.549) (-2097.203) (-2099.186) [-2100.950] * (-2106.642) [-2095.082] (-2100.775) (-2102.559) -- 0:03:00 411500 -- (-2097.667) (-2096.891) [-2101.740] (-2092.669) * [-2102.091] (-2096.619) (-2109.271) (-2096.258) -- 0:03:00 412000 -- (-2095.336) (-2095.864) [-2100.304] (-2101.512) * (-2096.534) (-2096.537) [-2096.155] (-2100.540) -- 0:02:59 412500 -- (-2109.211) (-2098.618) [-2098.973] (-2104.321) * [-2096.126] (-2102.075) (-2095.556) (-2110.151) -- 0:02:59 413000 -- (-2098.899) (-2104.709) (-2089.247) [-2098.716] * (-2092.122) (-2096.916) [-2098.357] (-2103.201) -- 0:02:59 413500 -- (-2096.501) (-2104.839) [-2092.399] (-2094.210) * (-2095.599) (-2100.241) [-2100.444] (-2098.005) -- 0:02:58 414000 -- [-2093.828] (-2103.784) (-2097.842) (-2095.863) * (-2098.494) (-2098.114) [-2099.070] (-2104.061) -- 0:02:58 414500 -- (-2088.123) (-2098.595) [-2096.175] (-2094.749) * (-2096.535) [-2096.639] (-2101.404) (-2095.498) -- 0:02:59 415000 -- [-2096.323] (-2092.084) (-2100.867) (-2098.228) * (-2096.931) [-2090.766] (-2107.472) (-2093.092) -- 0:02:59 Average standard deviation of split frequencies: 0.002550 415500 -- (-2091.786) (-2100.611) [-2103.609] (-2097.593) * [-2095.543] (-2091.822) (-2108.891) (-2094.353) -- 0:02:58 416000 -- (-2099.892) [-2095.513] (-2098.976) (-2093.580) * [-2094.325] (-2102.150) (-2104.533) (-2101.697) -- 0:02:58 416500 -- (-2099.546) (-2098.848) (-2104.502) [-2094.887] * (-2095.303) [-2095.066] (-2097.192) (-2101.679) -- 0:02:57 417000 -- [-2096.902] (-2093.476) (-2101.980) (-2091.965) * (-2104.337) [-2090.047] (-2104.283) (-2094.590) -- 0:02:57 417500 -- (-2101.984) [-2092.427] (-2097.186) (-2094.312) * (-2098.272) (-2094.383) (-2102.352) [-2095.009] -- 0:02:58 418000 -- (-2107.121) (-2092.593) [-2098.992] (-2096.058) * (-2098.841) (-2094.309) (-2100.486) [-2094.366] -- 0:02:58 418500 -- (-2101.540) [-2095.926] (-2106.509) (-2097.292) * (-2100.047) (-2094.649) (-2097.682) [-2096.016] -- 0:02:57 419000 -- (-2100.626) (-2092.764) (-2109.858) [-2092.662] * (-2100.720) [-2092.515] (-2094.740) (-2095.061) -- 0:02:57 419500 -- (-2099.495) (-2092.153) [-2093.401] (-2101.936) * (-2100.681) (-2105.172) (-2106.722) [-2104.888] -- 0:02:57 420000 -- (-2103.685) (-2094.412) (-2091.151) [-2103.005] * (-2097.104) (-2092.513) (-2098.072) [-2097.346] -- 0:02:56 Average standard deviation of split frequencies: 0.001961 420500 -- (-2095.425) (-2103.430) [-2090.316] (-2100.383) * (-2095.902) (-2094.993) [-2095.272] (-2102.120) -- 0:02:56 421000 -- (-2095.518) [-2092.419] (-2098.201) (-2096.183) * (-2092.301) (-2095.244) (-2097.389) [-2097.012] -- 0:02:57 421500 -- [-2089.942] (-2089.596) (-2096.809) (-2096.323) * [-2090.628] (-2093.651) (-2102.790) (-2091.012) -- 0:02:57 422000 -- [-2096.470] (-2100.106) (-2090.987) (-2098.500) * (-2096.677) [-2094.337] (-2103.619) (-2098.683) -- 0:02:56 422500 -- [-2093.892] (-2091.916) (-2093.184) (-2097.467) * [-2105.446] (-2095.412) (-2099.372) (-2095.486) -- 0:02:56 423000 -- (-2095.002) (-2098.927) (-2097.007) [-2099.254] * (-2095.799) (-2097.504) [-2096.668] (-2099.776) -- 0:02:55 423500 -- [-2094.522] (-2096.562) (-2104.856) (-2102.328) * [-2100.389] (-2096.201) (-2099.758) (-2093.191) -- 0:02:55 424000 -- [-2101.507] (-2102.678) (-2101.720) (-2095.012) * (-2099.128) [-2091.954] (-2098.649) (-2097.891) -- 0:02:55 424500 -- [-2095.386] (-2093.014) (-2106.102) (-2098.976) * (-2097.632) (-2102.992) (-2098.964) [-2096.149] -- 0:02:56 425000 -- (-2094.946) (-2101.303) [-2094.537] (-2091.589) * (-2097.740) [-2091.282] (-2097.710) (-2101.474) -- 0:02:55 Average standard deviation of split frequencies: 0.001660 425500 -- (-2094.606) (-2099.618) (-2101.026) [-2096.694] * (-2089.766) (-2088.890) (-2099.691) [-2096.088] -- 0:02:55 426000 -- (-2103.700) (-2095.701) (-2100.967) [-2096.588] * (-2102.794) (-2095.602) (-2107.181) [-2095.262] -- 0:02:55 426500 -- (-2094.530) (-2100.126) [-2094.880] (-2100.870) * (-2100.129) (-2093.940) [-2100.447] (-2103.950) -- 0:02:54 427000 -- [-2091.672] (-2092.438) (-2093.374) (-2101.838) * (-2095.443) [-2093.720] (-2102.959) (-2093.400) -- 0:02:54 427500 -- [-2092.855] (-2101.193) (-2096.541) (-2107.650) * (-2100.141) [-2105.506] (-2093.243) (-2099.093) -- 0:02:55 428000 -- (-2103.901) [-2094.564] (-2104.491) (-2096.263) * [-2095.944] (-2109.266) (-2092.345) (-2100.104) -- 0:02:55 428500 -- [-2088.555] (-2098.812) (-2097.649) (-2097.099) * (-2106.730) (-2100.282) [-2096.457] (-2097.728) -- 0:02:54 429000 -- (-2099.664) (-2100.909) (-2094.572) [-2098.420] * [-2098.482] (-2095.843) (-2097.989) (-2096.171) -- 0:02:54 429500 -- (-2099.804) [-2100.131] (-2095.396) (-2095.877) * (-2095.453) (-2091.961) [-2093.508] (-2098.439) -- 0:02:54 430000 -- [-2096.082] (-2105.154) (-2104.497) (-2096.993) * (-2094.145) [-2094.025] (-2096.930) (-2094.497) -- 0:02:53 Average standard deviation of split frequencies: 0.002463 430500 -- (-2103.746) [-2092.731] (-2094.747) (-2103.739) * (-2107.161) (-2091.241) [-2091.775] (-2097.054) -- 0:02:53 431000 -- (-2093.072) [-2088.548] (-2096.755) (-2093.677) * (-2096.834) (-2100.851) (-2094.118) [-2097.847] -- 0:02:54 431500 -- (-2095.823) (-2094.428) (-2107.598) [-2091.213] * (-2105.075) (-2095.406) (-2093.734) [-2099.105] -- 0:02:53 432000 -- (-2103.455) (-2098.727) (-2105.223) [-2092.416] * (-2097.279) [-2094.426] (-2095.024) (-2096.440) -- 0:02:53 432500 -- (-2091.704) [-2097.864] (-2099.686) (-2101.644) * (-2094.488) (-2100.620) (-2095.429) [-2090.673] -- 0:02:53 433000 -- (-2102.639) (-2097.650) (-2103.103) [-2103.036] * (-2098.073) (-2088.013) (-2093.215) [-2091.536] -- 0:02:52 433500 -- (-2101.106) (-2106.370) [-2093.590] (-2103.783) * (-2097.854) (-2097.817) (-2100.580) [-2096.481] -- 0:02:52 434000 -- (-2096.008) (-2098.107) [-2091.873] (-2106.331) * [-2094.463] (-2101.952) (-2099.294) (-2100.855) -- 0:02:52 434500 -- (-2093.939) (-2098.964) (-2104.734) [-2098.820] * (-2093.597) (-2097.791) (-2096.519) [-2096.613] -- 0:02:53 435000 -- (-2105.865) (-2100.912) (-2097.706) [-2098.977] * [-2096.103] (-2096.176) (-2102.270) (-2097.387) -- 0:02:52 Average standard deviation of split frequencies: 0.002973 435500 -- (-2107.564) (-2099.858) (-2103.989) [-2092.921] * (-2095.311) (-2100.781) [-2097.098] (-2101.480) -- 0:02:52 436000 -- [-2100.697] (-2095.431) (-2091.410) (-2094.492) * (-2092.007) (-2097.759) [-2090.778] (-2096.263) -- 0:02:52 436500 -- [-2092.233] (-2100.077) (-2097.160) (-2090.687) * (-2097.496) (-2096.095) [-2089.389] (-2100.342) -- 0:02:51 437000 -- (-2094.429) (-2093.026) [-2103.039] (-2100.957) * (-2089.455) (-2099.255) (-2095.727) [-2099.900] -- 0:02:51 437500 -- [-2092.593] (-2099.476) (-2096.791) (-2098.062) * (-2098.737) [-2094.573] (-2095.115) (-2101.902) -- 0:02:51 438000 -- (-2097.771) (-2106.192) [-2092.877] (-2099.508) * (-2096.746) (-2099.736) [-2091.639] (-2100.978) -- 0:02:51 438500 -- (-2101.851) [-2095.600] (-2090.123) (-2090.838) * (-2100.482) (-2098.510) [-2094.161] (-2092.286) -- 0:02:51 439000 -- (-2105.218) (-2095.952) [-2095.882] (-2094.689) * (-2097.586) (-2098.527) [-2095.634] (-2093.723) -- 0:02:51 439500 -- (-2103.558) [-2095.879] (-2095.047) (-2103.626) * (-2091.439) (-2096.925) [-2096.140] (-2094.051) -- 0:02:50 440000 -- (-2110.893) [-2092.655] (-2093.923) (-2097.474) * [-2095.001] (-2097.086) (-2092.911) (-2094.280) -- 0:02:50 Average standard deviation of split frequencies: 0.002674 440500 -- (-2094.510) [-2093.191] (-2094.245) (-2097.996) * (-2098.881) [-2095.702] (-2092.304) (-2103.030) -- 0:02:50 441000 -- [-2089.778] (-2092.338) (-2097.103) (-2099.227) * (-2102.332) [-2099.020] (-2098.025) (-2094.630) -- 0:02:51 441500 -- [-2106.081] (-2099.041) (-2094.620) (-2099.525) * (-2102.989) [-2100.589] (-2095.514) (-2096.763) -- 0:02:50 442000 -- [-2093.613] (-2094.241) (-2093.136) (-2093.393) * [-2090.176] (-2096.575) (-2096.038) (-2095.626) -- 0:02:50 442500 -- (-2098.156) [-2094.681] (-2097.882) (-2101.537) * (-2096.863) (-2103.138) [-2094.642] (-2097.787) -- 0:02:50 443000 -- (-2095.630) (-2097.311) [-2101.567] (-2099.810) * (-2101.506) (-2092.463) (-2098.783) [-2093.143] -- 0:02:49 443500 -- (-2103.717) [-2092.177] (-2099.704) (-2104.043) * [-2095.429] (-2091.954) (-2097.882) (-2099.475) -- 0:02:49 444000 -- (-2100.061) (-2096.229) (-2092.918) [-2096.712] * (-2096.361) (-2100.396) (-2097.319) [-2097.349] -- 0:02:49 444500 -- [-2096.036] (-2098.627) (-2098.487) (-2097.222) * (-2102.685) (-2092.142) [-2098.900] (-2099.641) -- 0:02:49 445000 -- (-2100.002) [-2092.217] (-2099.158) (-2096.197) * (-2098.510) (-2102.948) (-2092.006) [-2099.424] -- 0:02:49 Average standard deviation of split frequencies: 0.002642 445500 -- (-2105.184) (-2093.895) (-2097.347) [-2095.207] * (-2096.071) [-2094.141] (-2101.213) (-2094.301) -- 0:02:49 446000 -- (-2094.981) (-2095.147) [-2093.216] (-2097.567) * (-2092.560) (-2092.851) (-2092.765) [-2096.364] -- 0:02:48 446500 -- (-2096.487) [-2101.128] (-2094.283) (-2105.179) * (-2100.210) (-2094.669) [-2095.767] (-2094.089) -- 0:02:48 447000 -- [-2097.378] (-2099.848) (-2099.853) (-2108.235) * (-2099.091) (-2089.343) (-2093.224) [-2101.221] -- 0:02:48 447500 -- (-2092.614) [-2102.706] (-2097.551) (-2110.207) * [-2100.411] (-2098.221) (-2097.003) (-2099.401) -- 0:02:47 448000 -- (-2093.728) (-2097.198) [-2089.505] (-2102.355) * [-2089.978] (-2095.208) (-2101.822) (-2103.401) -- 0:02:48 448500 -- (-2097.540) [-2097.251] (-2096.771) (-2097.521) * (-2099.415) (-2095.985) [-2098.876] (-2103.662) -- 0:02:48 449000 -- (-2094.127) [-2093.057] (-2096.991) (-2098.040) * (-2095.011) [-2095.478] (-2102.548) (-2091.777) -- 0:02:48 449500 -- [-2093.861] (-2099.710) (-2098.521) (-2099.009) * (-2089.624) (-2105.423) [-2095.324] (-2100.048) -- 0:02:47 450000 -- (-2090.641) (-2091.406) (-2092.876) [-2103.238] * [-2096.919] (-2095.269) (-2100.048) (-2090.936) -- 0:02:47 Average standard deviation of split frequencies: 0.002615 450500 -- (-2098.455) (-2096.747) (-2091.743) [-2098.075] * (-2101.238) (-2093.991) (-2103.889) [-2092.862] -- 0:02:47 451000 -- (-2099.454) [-2099.071] (-2099.857) (-2098.221) * (-2102.401) [-2099.061] (-2098.939) (-2095.352) -- 0:02:46 451500 -- (-2098.470) (-2098.307) (-2095.533) [-2094.559] * [-2092.084] (-2094.515) (-2100.031) (-2099.387) -- 0:02:47 452000 -- (-2101.263) (-2094.232) (-2091.642) [-2095.753] * [-2103.777] (-2095.368) (-2097.771) (-2098.315) -- 0:02:47 452500 -- (-2104.750) [-2095.664] (-2102.895) (-2093.472) * (-2098.650) (-2096.748) [-2091.808] (-2098.607) -- 0:02:46 453000 -- (-2101.298) (-2092.981) (-2094.729) [-2095.639] * (-2097.593) (-2104.425) [-2091.846] (-2096.684) -- 0:02:46 453500 -- (-2099.939) (-2097.623) (-2091.210) [-2095.190] * (-2096.627) (-2099.711) (-2097.936) [-2092.350] -- 0:02:46 454000 -- (-2100.311) (-2092.701) (-2100.613) [-2099.641] * [-2089.049] (-2098.420) (-2094.431) (-2095.156) -- 0:02:45 454500 -- (-2103.631) [-2102.436] (-2095.849) (-2100.134) * [-2097.714] (-2098.978) (-2106.112) (-2092.301) -- 0:02:46 455000 -- (-2100.211) [-2102.930] (-2100.959) (-2106.544) * (-2092.051) [-2097.231] (-2096.808) (-2097.014) -- 0:02:46 Average standard deviation of split frequencies: 0.002068 455500 -- (-2111.594) (-2097.950) [-2093.785] (-2094.380) * [-2098.621] (-2094.415) (-2099.012) (-2105.052) -- 0:02:46 456000 -- (-2095.921) (-2098.751) (-2097.610) [-2093.306] * [-2090.432] (-2092.812) (-2099.986) (-2104.720) -- 0:02:45 456500 -- [-2099.047] (-2100.774) (-2092.471) (-2098.129) * [-2093.534] (-2090.219) (-2092.659) (-2099.930) -- 0:02:45 457000 -- (-2100.625) (-2096.332) [-2090.911] (-2096.307) * (-2099.487) [-2092.543] (-2113.953) (-2092.873) -- 0:02:45 457500 -- (-2105.368) (-2098.716) (-2091.664) [-2089.689] * (-2097.255) (-2105.859) [-2093.414] (-2092.916) -- 0:02:44 458000 -- (-2103.676) (-2097.489) (-2093.041) [-2091.661] * (-2094.006) [-2098.618] (-2097.934) (-2095.124) -- 0:02:45 458500 -- (-2104.627) [-2098.767] (-2102.325) (-2092.835) * [-2093.243] (-2093.676) (-2104.123) (-2094.813) -- 0:02:45 459000 -- [-2093.934] (-2090.773) (-2093.423) (-2093.965) * (-2097.969) [-2092.546] (-2092.929) (-2096.624) -- 0:02:45 459500 -- (-2103.691) [-2090.128] (-2106.893) (-2092.232) * (-2101.152) (-2092.119) [-2092.832] (-2091.887) -- 0:02:44 460000 -- [-2093.254] (-2097.660) (-2104.153) (-2094.076) * (-2092.210) [-2094.813] (-2095.729) (-2097.304) -- 0:02:44 Average standard deviation of split frequencies: 0.002047 460500 -- (-2096.712) (-2095.860) [-2098.901] (-2097.636) * [-2091.200] (-2097.996) (-2096.863) (-2092.547) -- 0:02:44 461000 -- (-2095.729) (-2094.164) [-2101.903] (-2104.151) * (-2094.299) (-2095.916) (-2097.912) [-2090.944] -- 0:02:43 461500 -- (-2092.252) (-2105.677) [-2093.028] (-2100.876) * (-2107.779) (-2098.219) (-2095.824) [-2098.053] -- 0:02:44 462000 -- (-2091.316) [-2092.601] (-2097.568) (-2098.116) * (-2095.196) [-2097.470] (-2111.745) (-2091.214) -- 0:02:44 462500 -- (-2095.470) [-2097.898] (-2092.070) (-2098.373) * (-2091.123) (-2093.408) (-2096.008) [-2092.401] -- 0:02:43 463000 -- (-2093.028) (-2096.971) (-2095.611) [-2093.143] * (-2095.307) (-2096.033) (-2095.675) [-2093.381] -- 0:02:43 463500 -- (-2094.500) (-2095.786) (-2094.135) [-2097.113] * (-2094.430) (-2095.310) [-2097.286] (-2092.001) -- 0:02:43 464000 -- [-2089.544] (-2102.143) (-2104.176) (-2095.854) * (-2098.644) (-2097.012) (-2095.748) [-2089.740] -- 0:02:42 464500 -- (-2102.066) [-2091.117] (-2093.082) (-2090.403) * (-2098.977) (-2097.740) (-2096.132) [-2090.055] -- 0:02:42 465000 -- (-2095.919) (-2094.456) (-2099.094) [-2093.980] * [-2095.869] (-2094.151) (-2094.057) (-2098.119) -- 0:02:43 Average standard deviation of split frequencies: 0.001770 465500 -- (-2098.516) (-2106.194) (-2098.496) [-2095.600] * (-2096.199) [-2094.585] (-2102.576) (-2093.371) -- 0:02:43 466000 -- [-2097.172] (-2104.691) (-2102.121) (-2097.100) * (-2112.675) (-2093.704) (-2096.867) [-2105.299] -- 0:02:42 466500 -- (-2098.045) (-2095.498) [-2091.453] (-2094.215) * (-2109.103) [-2094.944] (-2100.326) (-2098.243) -- 0:02:42 467000 -- (-2106.841) (-2090.701) (-2102.090) [-2096.644] * (-2105.686) (-2088.566) [-2091.662] (-2097.855) -- 0:02:42 467500 -- [-2097.291] (-2098.950) (-2101.310) (-2103.888) * (-2103.130) [-2098.783] (-2099.908) (-2095.339) -- 0:02:41 468000 -- [-2089.974] (-2091.440) (-2103.894) (-2095.079) * (-2112.612) [-2099.388] (-2098.629) (-2097.147) -- 0:02:42 468500 -- (-2092.849) (-2093.073) (-2100.478) [-2093.552] * (-2107.908) (-2093.091) (-2098.593) [-2099.655] -- 0:02:42 469000 -- (-2097.514) (-2094.313) [-2099.606] (-2090.806) * (-2104.161) (-2098.217) [-2096.346] (-2090.627) -- 0:02:41 469500 -- (-2106.951) (-2095.298) (-2097.189) [-2099.801] * (-2096.610) (-2095.919) (-2093.796) [-2103.216] -- 0:02:41 470000 -- [-2102.319] (-2093.337) (-2098.477) (-2095.405) * (-2103.762) (-2095.176) [-2093.766] (-2098.486) -- 0:02:41 Average standard deviation of split frequencies: 0.003255 470500 -- [-2103.122] (-2097.974) (-2098.329) (-2095.770) * [-2090.934] (-2095.188) (-2101.023) (-2109.079) -- 0:02:40 471000 -- (-2101.582) [-2094.568] (-2092.434) (-2108.054) * (-2101.054) [-2096.495] (-2097.784) (-2095.576) -- 0:02:40 471500 -- [-2095.806] (-2093.552) (-2098.475) (-2104.843) * (-2095.663) (-2098.851) (-2094.879) [-2095.300] -- 0:02:41 472000 -- (-2099.976) (-2092.427) (-2093.332) [-2097.804] * [-2098.640] (-2106.616) (-2096.637) (-2101.900) -- 0:02:41 472500 -- (-2094.811) (-2095.493) (-2104.029) [-2095.032] * (-2092.177) (-2097.529) [-2095.957] (-2099.388) -- 0:02:40 473000 -- (-2096.795) (-2103.518) [-2089.691] (-2096.548) * (-2104.851) (-2103.471) (-2099.425) [-2099.422] -- 0:02:40 473500 -- [-2097.165] (-2094.447) (-2091.176) (-2100.952) * (-2099.723) (-2101.732) (-2101.231) [-2095.326] -- 0:02:40 474000 -- [-2103.852] (-2092.836) (-2095.726) (-2095.393) * (-2093.534) (-2099.740) [-2089.150] (-2095.315) -- 0:02:39 474500 -- (-2102.018) (-2095.553) (-2096.549) [-2094.755] * (-2102.993) (-2095.006) [-2094.221] (-2094.504) -- 0:02:39 475000 -- [-2095.796] (-2107.007) (-2095.791) (-2099.681) * (-2098.678) (-2103.818) [-2095.867] (-2093.012) -- 0:02:40 Average standard deviation of split frequencies: 0.002971 475500 -- [-2094.876] (-2098.960) (-2094.590) (-2098.581) * (-2101.178) (-2106.331) [-2095.874] (-2103.646) -- 0:02:39 476000 -- (-2095.060) [-2099.199] (-2105.434) (-2098.650) * (-2097.124) (-2099.982) (-2103.544) [-2095.432] -- 0:02:39 476500 -- (-2092.654) (-2111.775) (-2095.526) [-2102.922] * [-2093.392] (-2110.843) (-2096.255) (-2088.439) -- 0:02:39 477000 -- (-2092.293) (-2101.505) [-2088.728] (-2093.330) * (-2093.991) [-2095.397] (-2094.063) (-2089.104) -- 0:02:38 477500 -- (-2091.275) (-2096.565) (-2096.978) [-2090.976] * [-2096.328] (-2097.990) (-2096.972) (-2091.947) -- 0:02:38 478000 -- [-2089.810] (-2103.574) (-2091.090) (-2091.541) * (-2104.782) (-2109.552) [-2095.775] (-2098.017) -- 0:02:38 478500 -- (-2095.586) [-2093.883] (-2095.457) (-2098.661) * (-2113.741) (-2099.680) (-2103.148) [-2089.941] -- 0:02:39 479000 -- (-2098.454) (-2101.703) (-2095.061) [-2094.745] * (-2095.720) (-2096.979) [-2091.124] (-2096.710) -- 0:02:38 479500 -- (-2090.480) (-2094.023) (-2096.624) [-2099.004] * (-2099.188) (-2093.966) (-2103.100) [-2093.815] -- 0:02:38 480000 -- (-2098.598) (-2098.826) [-2094.337] (-2092.473) * (-2090.945) (-2095.690) (-2113.577) [-2093.357] -- 0:02:38 Average standard deviation of split frequencies: 0.002942 480500 -- (-2096.285) [-2097.103] (-2097.449) (-2092.156) * (-2107.707) (-2101.084) (-2100.731) [-2093.268] -- 0:02:37 481000 -- (-2093.244) (-2092.281) (-2093.254) [-2095.335] * (-2104.131) [-2096.418] (-2092.304) (-2094.931) -- 0:02:37 481500 -- (-2104.975) [-2093.307] (-2093.864) (-2097.061) * (-2093.201) [-2093.961] (-2089.045) (-2093.198) -- 0:02:38 482000 -- (-2108.930) (-2099.196) (-2098.102) [-2096.380] * [-2093.977] (-2094.437) (-2102.751) (-2095.856) -- 0:02:37 482500 -- (-2097.101) (-2099.580) (-2096.082) [-2097.496] * [-2096.007] (-2095.325) (-2095.322) (-2094.764) -- 0:02:37 483000 -- (-2099.809) (-2095.411) (-2095.216) [-2091.904] * (-2099.787) [-2092.949] (-2094.097) (-2094.714) -- 0:02:37 483500 -- (-2095.034) [-2092.849] (-2093.390) (-2100.016) * [-2097.795] (-2109.552) (-2099.984) (-2091.944) -- 0:02:37 484000 -- [-2090.736] (-2091.236) (-2100.078) (-2093.641) * (-2095.075) [-2096.008] (-2101.604) (-2093.399) -- 0:02:36 484500 -- (-2091.976) (-2095.425) (-2100.726) [-2106.788] * (-2095.438) (-2093.126) [-2098.191] (-2103.479) -- 0:02:36 485000 -- [-2094.101] (-2096.236) (-2095.961) (-2100.249) * [-2091.985] (-2092.224) (-2102.178) (-2102.337) -- 0:02:37 Average standard deviation of split frequencies: 0.002425 485500 -- (-2091.120) [-2096.036] (-2095.853) (-2112.560) * (-2101.439) [-2094.327] (-2097.714) (-2092.769) -- 0:02:36 486000 -- [-2097.174] (-2097.082) (-2097.633) (-2098.323) * (-2092.605) (-2100.007) (-2097.935) [-2093.818] -- 0:02:36 486500 -- (-2101.209) [-2104.528] (-2096.522) (-2096.667) * [-2093.983] (-2090.669) (-2092.475) (-2098.475) -- 0:02:36 487000 -- (-2095.315) (-2098.944) [-2095.619] (-2097.043) * (-2097.063) (-2091.664) [-2098.031] (-2098.050) -- 0:02:35 487500 -- (-2099.068) (-2095.777) [-2091.114] (-2103.525) * (-2093.199) [-2097.951] (-2095.319) (-2095.182) -- 0:02:35 488000 -- (-2093.066) [-2093.418] (-2099.980) (-2096.581) * (-2096.615) (-2102.446) (-2099.497) [-2094.947] -- 0:02:35 488500 -- (-2105.848) [-2094.832] (-2097.532) (-2093.307) * (-2094.145) (-2095.451) (-2092.607) [-2095.713] -- 0:02:36 489000 -- (-2099.105) [-2089.897] (-2100.247) (-2100.978) * (-2091.927) (-2095.998) (-2104.574) [-2097.349] -- 0:02:35 489500 -- [-2097.960] (-2104.798) (-2099.404) (-2089.626) * (-2095.455) [-2095.369] (-2100.353) (-2095.639) -- 0:02:35 490000 -- (-2094.678) [-2096.927] (-2095.447) (-2094.066) * [-2098.799] (-2095.935) (-2097.725) (-2096.227) -- 0:02:35 Average standard deviation of split frequencies: 0.002162 490500 -- (-2103.356) [-2092.492] (-2094.145) (-2097.349) * (-2102.489) [-2096.752] (-2103.144) (-2096.773) -- 0:02:34 491000 -- (-2102.351) (-2093.594) [-2097.416] (-2092.923) * (-2094.523) (-2103.172) (-2101.664) [-2091.768] -- 0:02:34 491500 -- (-2102.793) [-2095.911] (-2115.364) (-2093.570) * (-2093.439) (-2099.861) (-2095.497) [-2099.284] -- 0:02:35 492000 -- (-2096.877) [-2095.516] (-2099.964) (-2098.594) * (-2091.732) (-2103.375) [-2091.292] (-2093.129) -- 0:02:34 492500 -- (-2097.810) (-2107.366) (-2105.901) [-2098.922] * (-2095.106) (-2095.394) [-2091.118] (-2098.470) -- 0:02:34 493000 -- (-2096.148) (-2093.841) (-2097.003) [-2100.363] * (-2103.942) (-2093.446) (-2094.380) [-2096.936] -- 0:02:34 493500 -- (-2097.720) (-2093.514) [-2093.642] (-2100.672) * (-2098.467) (-2093.831) (-2094.745) [-2096.404] -- 0:02:33 494000 -- [-2093.654] (-2099.807) (-2099.197) (-2113.856) * [-2096.697] (-2100.550) (-2098.873) (-2099.594) -- 0:02:33 494500 -- (-2093.125) (-2093.688) (-2095.393) [-2093.333] * (-2095.583) (-2100.472) [-2093.883] (-2099.044) -- 0:02:33 495000 -- [-2094.559] (-2092.877) (-2098.108) (-2104.814) * (-2104.015) [-2097.121] (-2097.844) (-2096.929) -- 0:02:34 Average standard deviation of split frequencies: 0.002614 495500 -- [-2095.429] (-2093.866) (-2101.747) (-2099.523) * (-2094.292) (-2102.341) (-2099.967) [-2088.411] -- 0:02:33 496000 -- [-2091.373] (-2096.503) (-2100.781) (-2090.891) * [-2092.341] (-2097.676) (-2091.681) (-2101.307) -- 0:02:33 496500 -- [-2098.686] (-2097.308) (-2093.049) (-2097.554) * [-2093.195] (-2096.380) (-2092.853) (-2108.536) -- 0:02:33 497000 -- (-2099.275) (-2096.225) (-2101.590) [-2099.000] * (-2097.467) [-2098.789] (-2093.125) (-2098.729) -- 0:02:32 497500 -- [-2093.671] (-2101.094) (-2095.281) (-2094.490) * (-2106.890) (-2098.147) (-2098.052) [-2097.399] -- 0:02:32 498000 -- (-2109.514) (-2099.762) [-2092.191] (-2094.713) * (-2100.683) (-2103.310) [-2092.512] (-2096.849) -- 0:02:32 498500 -- (-2097.105) (-2105.841) (-2088.064) [-2093.400] * (-2100.451) [-2097.483] (-2095.456) (-2099.853) -- 0:02:32 499000 -- (-2101.449) (-2097.600) [-2104.121] (-2099.805) * [-2092.861] (-2096.207) (-2092.495) (-2097.727) -- 0:02:32 499500 -- [-2091.252] (-2091.415) (-2094.872) (-2091.320) * (-2097.465) [-2093.657] (-2100.313) (-2101.129) -- 0:02:32 500000 -- (-2095.861) (-2093.670) [-2100.098] (-2098.497) * (-2096.388) (-2091.617) [-2098.553] (-2097.884) -- 0:02:32 Average standard deviation of split frequencies: 0.002589 500500 -- (-2090.756) (-2092.071) [-2097.204] (-2101.417) * (-2095.550) (-2100.769) [-2098.132] (-2095.756) -- 0:02:31 501000 -- [-2104.049] (-2094.660) (-2097.302) (-2096.147) * (-2095.729) (-2097.598) (-2096.947) [-2096.892] -- 0:02:31 501500 -- (-2096.200) (-2105.648) (-2094.523) [-2095.187] * (-2092.869) (-2096.717) [-2096.587] (-2101.192) -- 0:02:32 502000 -- (-2096.463) [-2099.406] (-2093.405) (-2102.645) * (-2094.198) [-2099.584] (-2097.418) (-2096.061) -- 0:02:31 502500 -- [-2103.060] (-2098.312) (-2097.220) (-2101.776) * [-2096.015] (-2106.418) (-2097.301) (-2095.506) -- 0:02:31 503000 -- (-2095.221) [-2097.961] (-2097.732) (-2095.983) * (-2103.229) [-2103.847] (-2092.590) (-2095.796) -- 0:02:31 503500 -- (-2094.575) [-2093.528] (-2102.015) (-2098.524) * (-2099.400) [-2096.025] (-2098.589) (-2108.924) -- 0:02:30 504000 -- (-2095.542) (-2096.976) [-2101.585] (-2097.301) * (-2096.820) [-2088.277] (-2090.845) (-2093.057) -- 0:02:30 504500 -- (-2102.122) (-2100.499) [-2103.171] (-2090.085) * (-2104.232) [-2102.004] (-2101.917) (-2091.512) -- 0:02:30 505000 -- [-2090.190] (-2097.604) (-2098.537) (-2098.050) * (-2103.412) (-2097.945) [-2098.974] (-2096.418) -- 0:02:30 Average standard deviation of split frequencies: 0.002562 505500 -- (-2100.065) [-2096.059] (-2094.149) (-2094.386) * (-2101.303) (-2092.554) [-2092.925] (-2098.255) -- 0:02:30 506000 -- (-2092.495) (-2097.971) [-2095.234] (-2095.397) * [-2095.771] (-2103.090) (-2097.755) (-2099.893) -- 0:02:30 506500 -- (-2095.750) (-2098.272) [-2098.592] (-2093.443) * [-2096.935] (-2097.475) (-2093.382) (-2088.698) -- 0:02:30 507000 -- [-2092.297] (-2096.851) (-2098.222) (-2091.385) * (-2094.381) (-2094.577) (-2093.870) [-2097.543] -- 0:02:29 507500 -- (-2108.328) [-2096.515] (-2106.251) (-2098.206) * [-2099.048] (-2097.664) (-2094.742) (-2098.223) -- 0:02:29 508000 -- (-2100.598) [-2096.664] (-2094.254) (-2101.248) * (-2094.373) (-2095.970) [-2093.794] (-2096.877) -- 0:02:29 508500 -- (-2096.778) (-2092.639) [-2098.829] (-2097.351) * [-2094.798] (-2099.448) (-2090.622) (-2098.771) -- 0:02:29 509000 -- [-2097.429] (-2091.137) (-2093.140) (-2092.931) * (-2097.375) (-2095.819) (-2099.365) [-2103.172] -- 0:02:29 509500 -- [-2098.421] (-2096.849) (-2095.691) (-2095.936) * [-2105.142] (-2097.608) (-2095.271) (-2100.382) -- 0:02:29 510000 -- (-2099.351) (-2101.655) [-2094.886] (-2097.592) * (-2102.576) (-2101.055) [-2095.750] (-2093.533) -- 0:02:28 Average standard deviation of split frequencies: 0.003231 510500 -- [-2096.436] (-2102.623) (-2094.386) (-2092.567) * (-2095.533) (-2096.924) [-2100.321] (-2100.544) -- 0:02:28 511000 -- (-2094.332) (-2100.876) (-2089.398) [-2094.529] * (-2096.723) (-2102.002) [-2094.444] (-2101.424) -- 0:02:28 511500 -- [-2103.190] (-2092.855) (-2099.992) (-2097.980) * [-2101.629] (-2095.820) (-2102.929) (-2094.647) -- 0:02:28 512000 -- (-2100.067) (-2099.281) (-2099.172) [-2088.159] * (-2108.778) (-2102.025) (-2099.328) [-2095.443] -- 0:02:28 512500 -- (-2097.725) (-2107.246) [-2098.544] (-2095.100) * (-2097.710) (-2095.773) [-2091.686] (-2092.200) -- 0:02:28 513000 -- [-2102.111] (-2094.724) (-2093.803) (-2096.111) * (-2096.536) (-2100.990) (-2091.613) [-2093.936] -- 0:02:28 513500 -- (-2095.862) (-2091.410) (-2104.767) [-2093.007] * [-2095.523] (-2101.447) (-2095.239) (-2092.877) -- 0:02:27 514000 -- (-2095.358) [-2101.137] (-2095.361) (-2091.248) * (-2098.483) (-2093.149) (-2093.645) [-2099.463] -- 0:02:27 514500 -- (-2097.503) (-2103.149) (-2097.825) [-2093.095] * (-2092.885) (-2093.138) [-2093.457] (-2090.389) -- 0:02:27 515000 -- (-2093.691) (-2096.552) (-2092.415) [-2095.564] * [-2092.507] (-2094.242) (-2101.516) (-2096.309) -- 0:02:27 Average standard deviation of split frequencies: 0.003198 515500 -- (-2102.728) (-2095.075) [-2094.134] (-2093.257) * (-2095.882) (-2097.563) (-2094.477) [-2090.051] -- 0:02:27 516000 -- (-2104.660) (-2091.131) [-2095.666] (-2098.872) * (-2094.855) (-2092.310) (-2099.048) [-2095.341] -- 0:02:27 516500 -- (-2106.972) [-2093.440] (-2101.006) (-2099.257) * (-2098.313) (-2090.339) [-2092.452] (-2094.938) -- 0:02:26 517000 -- [-2096.866] (-2111.361) (-2095.430) (-2096.927) * (-2097.684) [-2088.397] (-2095.082) (-2099.598) -- 0:02:26 517500 -- (-2095.859) (-2093.404) [-2093.309] (-2094.300) * (-2095.908) (-2094.007) [-2092.679] (-2099.551) -- 0:02:26 518000 -- (-2096.142) [-2094.255] (-2092.896) (-2094.756) * (-2105.392) (-2106.966) [-2100.769] (-2097.408) -- 0:02:26 518500 -- (-2097.542) (-2102.401) (-2094.749) [-2097.576] * (-2098.586) (-2105.090) [-2097.388] (-2100.196) -- 0:02:26 519000 -- [-2099.231] (-2100.774) (-2097.222) (-2092.389) * (-2108.505) (-2097.362) [-2099.073] (-2105.507) -- 0:02:26 519500 -- (-2098.278) [-2096.523] (-2089.440) (-2098.876) * (-2100.413) [-2099.526] (-2101.045) (-2095.942) -- 0:02:26 520000 -- (-2103.314) [-2097.011] (-2095.699) (-2105.009) * (-2102.334) (-2102.920) (-2098.371) [-2092.545] -- 0:02:25 Average standard deviation of split frequencies: 0.002490 520500 -- (-2094.896) (-2094.053) [-2092.676] (-2092.263) * (-2101.067) [-2101.020] (-2094.711) (-2094.296) -- 0:02:25 521000 -- [-2098.961] (-2098.412) (-2104.007) (-2089.712) * (-2092.316) (-2097.170) (-2088.478) [-2100.307] -- 0:02:25 521500 -- (-2095.048) (-2095.254) [-2091.487] (-2091.919) * (-2093.414) (-2096.036) (-2092.769) [-2094.514] -- 0:02:24 522000 -- (-2098.153) (-2098.727) [-2100.127] (-2099.055) * (-2096.385) (-2099.204) [-2095.623] (-2092.587) -- 0:02:25 522500 -- (-2104.311) [-2088.847] (-2098.008) (-2109.607) * (-2091.857) (-2094.352) (-2095.875) [-2095.409] -- 0:02:25 523000 -- [-2092.749] (-2095.102) (-2099.104) (-2096.853) * [-2098.293] (-2092.466) (-2090.362) (-2092.040) -- 0:02:25 523500 -- (-2091.789) (-2094.809) [-2096.798] (-2100.035) * (-2104.301) (-2102.854) [-2099.389] (-2093.103) -- 0:02:24 524000 -- (-2101.807) (-2090.340) [-2093.061] (-2097.252) * (-2098.666) [-2092.851] (-2099.864) (-2096.567) -- 0:02:24 524500 -- (-2103.340) [-2095.399] (-2093.189) (-2099.467) * (-2110.713) [-2098.895] (-2101.934) (-2095.149) -- 0:02:24 525000 -- [-2095.621] (-2089.469) (-2090.056) (-2098.694) * (-2102.158) (-2101.924) [-2095.354] (-2094.906) -- 0:02:23 Average standard deviation of split frequencies: 0.002465 525500 -- (-2092.577) (-2093.058) (-2094.681) [-2101.343] * [-2093.959] (-2093.983) (-2102.614) (-2099.139) -- 0:02:24 526000 -- (-2091.941) [-2092.520] (-2095.197) (-2094.134) * [-2096.710] (-2101.126) (-2100.437) (-2106.675) -- 0:02:24 526500 -- (-2091.016) [-2095.989] (-2102.755) (-2090.336) * (-2094.884) (-2099.081) [-2095.523] (-2093.404) -- 0:02:23 527000 -- (-2100.267) (-2098.429) (-2095.715) [-2097.636] * [-2092.560] (-2100.569) (-2087.875) (-2090.154) -- 0:02:23 527500 -- (-2093.838) (-2094.555) [-2097.045] (-2104.405) * [-2093.578] (-2095.108) (-2104.956) (-2090.693) -- 0:02:23 528000 -- (-2094.752) (-2096.514) [-2095.514] (-2101.935) * (-2094.568) (-2101.494) (-2093.838) [-2095.332] -- 0:02:23 528500 -- (-2105.163) (-2098.887) [-2098.945] (-2106.398) * (-2090.742) (-2099.119) (-2096.090) [-2102.504] -- 0:02:23 529000 -- (-2098.745) (-2090.559) [-2104.077] (-2096.212) * (-2111.249) [-2098.733] (-2093.118) (-2095.123) -- 0:02:23 529500 -- (-2094.436) (-2099.168) (-2104.563) [-2092.385] * (-2095.404) (-2098.082) (-2091.526) [-2095.538] -- 0:02:23 530000 -- (-2095.818) (-2096.976) (-2104.895) [-2099.052] * [-2097.770] (-2098.639) (-2095.065) (-2096.745) -- 0:02:22 Average standard deviation of split frequencies: 0.001777 530500 -- [-2096.936] (-2105.238) (-2100.747) (-2097.446) * [-2096.352] (-2100.931) (-2092.928) (-2099.445) -- 0:02:22 531000 -- (-2093.812) (-2098.307) (-2102.548) [-2093.416] * (-2100.919) (-2101.056) [-2092.686] (-2088.945) -- 0:02:22 531500 -- (-2099.960) (-2096.042) [-2105.982] (-2094.618) * [-2097.984] (-2099.617) (-2101.994) (-2096.653) -- 0:02:21 532000 -- (-2101.396) [-2094.360] (-2091.734) (-2109.072) * (-2092.265) [-2093.784] (-2100.640) (-2097.707) -- 0:02:22 532500 -- (-2106.447) (-2093.733) (-2105.548) [-2101.298] * (-2100.854) [-2098.895] (-2104.867) (-2096.448) -- 0:02:22 533000 -- [-2102.432] (-2092.424) (-2092.203) (-2100.187) * (-2097.879) [-2094.815] (-2106.438) (-2106.956) -- 0:02:21 533500 -- (-2098.024) (-2100.591) [-2101.944] (-2097.127) * (-2102.010) (-2094.934) [-2095.980] (-2100.692) -- 0:02:21 534000 -- (-2108.044) (-2099.534) [-2097.930] (-2092.039) * (-2094.966) (-2097.084) (-2089.285) [-2102.506] -- 0:02:21 534500 -- (-2095.598) [-2102.043] (-2095.908) (-2092.899) * (-2100.299) (-2097.039) [-2094.615] (-2095.169) -- 0:02:21 535000 -- (-2092.784) (-2098.754) (-2094.798) [-2093.025] * (-2094.577) (-2099.858) [-2091.289] (-2097.379) -- 0:02:20 Average standard deviation of split frequencies: 0.001319 535500 -- (-2104.241) (-2106.184) (-2097.711) [-2096.539] * [-2098.487] (-2096.167) (-2093.287) (-2100.016) -- 0:02:21 536000 -- (-2095.996) [-2098.332] (-2102.019) (-2098.661) * (-2095.526) (-2099.893) [-2087.481] (-2091.857) -- 0:02:21 536500 -- (-2099.346) (-2095.919) [-2098.993] (-2097.475) * (-2098.081) [-2095.748] (-2092.699) (-2094.621) -- 0:02:20 537000 -- (-2090.980) (-2093.297) (-2097.851) [-2092.591] * (-2098.619) [-2094.189] (-2100.606) (-2102.682) -- 0:02:20 537500 -- (-2105.363) (-2090.875) (-2095.044) [-2093.729] * [-2098.671] (-2095.038) (-2093.788) (-2093.976) -- 0:02:20 538000 -- (-2103.167) [-2093.295] (-2097.933) (-2101.199) * (-2097.045) [-2092.036] (-2094.965) (-2098.165) -- 0:02:19 538500 -- (-2091.317) [-2094.134] (-2096.861) (-2106.367) * [-2093.586] (-2100.012) (-2101.058) (-2094.845) -- 0:02:20 539000 -- (-2093.623) (-2097.821) [-2095.952] (-2095.702) * (-2099.855) (-2096.584) [-2101.377] (-2098.699) -- 0:02:20 539500 -- (-2100.468) [-2095.964] (-2096.873) (-2092.366) * (-2100.007) [-2093.129] (-2110.894) (-2106.239) -- 0:02:19 540000 -- (-2101.978) [-2101.250] (-2099.184) (-2097.214) * (-2106.379) [-2094.885] (-2100.744) (-2102.006) -- 0:02:19 Average standard deviation of split frequencies: 0.001744 540500 -- (-2097.331) (-2101.788) [-2100.175] (-2109.696) * (-2096.176) (-2102.196) [-2094.113] (-2095.800) -- 0:02:19 541000 -- [-2093.148] (-2098.338) (-2093.809) (-2097.432) * (-2099.301) [-2094.935] (-2095.875) (-2097.227) -- 0:02:19 541500 -- (-2094.746) [-2090.261] (-2100.576) (-2101.092) * (-2089.981) [-2095.523] (-2091.589) (-2093.242) -- 0:02:18 542000 -- (-2100.327) [-2090.163] (-2094.151) (-2103.609) * [-2093.450] (-2099.943) (-2091.712) (-2098.718) -- 0:02:19 542500 -- (-2097.799) [-2095.394] (-2101.118) (-2090.367) * (-2092.444) (-2098.006) [-2095.569] (-2093.389) -- 0:02:19 543000 -- (-2094.920) [-2097.272] (-2104.175) (-2099.050) * (-2100.537) (-2091.484) [-2102.841] (-2091.224) -- 0:02:18 543500 -- (-2102.387) [-2097.314] (-2106.266) (-2096.886) * (-2091.006) (-2089.994) (-2092.018) [-2094.655] -- 0:02:18 544000 -- (-2103.814) (-2094.562) [-2102.044] (-2095.661) * (-2099.123) [-2090.327] (-2093.553) (-2104.965) -- 0:02:18 544500 -- (-2107.326) (-2096.469) (-2095.709) [-2094.347] * [-2092.387] (-2091.979) (-2103.830) (-2099.767) -- 0:02:18 545000 -- (-2098.098) (-2098.149) (-2095.046) [-2095.662] * (-2104.739) (-2099.004) [-2101.598] (-2095.407) -- 0:02:17 Average standard deviation of split frequencies: 0.001727 545500 -- [-2090.198] (-2097.821) (-2106.726) (-2107.551) * (-2099.911) [-2096.564] (-2100.894) (-2101.653) -- 0:02:18 546000 -- (-2103.414) (-2097.726) (-2104.344) [-2099.151] * (-2101.692) (-2099.556) [-2097.893] (-2094.199) -- 0:02:18 546500 -- (-2091.999) (-2106.576) [-2094.582] (-2095.450) * (-2095.945) [-2094.651] (-2095.605) (-2090.651) -- 0:02:17 547000 -- (-2093.549) (-2097.852) (-2091.799) [-2099.383] * (-2098.704) (-2100.050) (-2107.477) [-2096.215] -- 0:02:17 547500 -- (-2092.671) (-2097.133) [-2101.105] (-2099.591) * (-2100.294) (-2091.205) [-2093.816] (-2099.403) -- 0:02:17 548000 -- [-2098.819] (-2094.722) (-2095.863) (-2104.349) * (-2109.228) (-2091.489) (-2102.267) [-2092.258] -- 0:02:16 548500 -- [-2096.257] (-2094.630) (-2097.207) (-2101.842) * (-2106.929) (-2093.869) (-2098.278) [-2096.245] -- 0:02:17 549000 -- (-2098.795) (-2094.407) [-2094.512] (-2094.982) * [-2103.111] (-2097.632) (-2097.610) (-2100.486) -- 0:02:17 549500 -- (-2092.956) [-2098.653] (-2094.410) (-2090.889) * (-2104.134) [-2094.313] (-2099.947) (-2105.556) -- 0:02:16 550000 -- (-2097.071) [-2097.677] (-2098.892) (-2101.668) * (-2102.245) (-2096.974) (-2107.007) [-2097.121] -- 0:02:16 Average standard deviation of split frequencies: 0.001498 550500 -- (-2095.195) (-2101.337) [-2095.998] (-2098.828) * (-2101.145) (-2093.447) (-2104.873) [-2094.390] -- 0:02:16 551000 -- (-2097.234) (-2100.692) (-2100.451) [-2092.825] * (-2110.422) (-2091.282) [-2101.270] (-2096.836) -- 0:02:16 551500 -- (-2099.358) [-2095.546] (-2098.141) (-2100.728) * (-2103.164) (-2090.536) (-2096.421) [-2090.773] -- 0:02:15 552000 -- (-2102.957) [-2091.633] (-2095.388) (-2100.236) * (-2092.771) (-2100.291) [-2095.510] (-2091.293) -- 0:02:16 552500 -- (-2099.661) [-2096.108] (-2091.552) (-2101.613) * (-2093.709) (-2097.107) [-2094.498] (-2104.257) -- 0:02:16 553000 -- [-2095.512] (-2098.663) (-2094.461) (-2110.580) * (-2097.886) [-2090.780] (-2094.638) (-2099.438) -- 0:02:15 553500 -- (-2106.913) (-2094.097) [-2092.740] (-2102.398) * (-2097.216) (-2095.439) (-2093.799) [-2093.256] -- 0:02:15 554000 -- (-2100.148) (-2093.067) (-2092.294) [-2099.828] * [-2095.214] (-2093.876) (-2096.239) (-2097.528) -- 0:02:15 554500 -- (-2099.646) (-2089.535) [-2102.820] (-2104.922) * (-2096.131) (-2098.596) (-2097.841) [-2101.518] -- 0:02:14 555000 -- [-2099.396] (-2105.446) (-2096.696) (-2096.640) * (-2098.740) [-2101.561] (-2095.925) (-2097.511) -- 0:02:14 Average standard deviation of split frequencies: 0.001272 555500 -- [-2090.068] (-2094.707) (-2089.876) (-2099.891) * (-2105.664) (-2099.150) (-2101.577) [-2099.928] -- 0:02:15 556000 -- (-2095.294) (-2090.839) [-2096.499] (-2107.438) * (-2100.192) (-2100.759) [-2092.885] (-2094.839) -- 0:02:14 556500 -- (-2106.131) (-2101.331) [-2090.076] (-2099.111) * (-2102.069) (-2099.008) (-2098.076) [-2096.048] -- 0:02:14 557000 -- (-2090.751) (-2095.830) [-2097.278] (-2104.537) * (-2100.048) (-2100.546) [-2093.132] (-2100.722) -- 0:02:14 557500 -- (-2098.059) [-2097.217] (-2101.894) (-2097.569) * (-2102.116) (-2089.623) (-2094.580) [-2097.751] -- 0:02:14 558000 -- [-2092.871] (-2097.319) (-2094.974) (-2105.461) * (-2098.088) [-2100.197] (-2097.987) (-2106.387) -- 0:02:13 558500 -- (-2101.172) (-2102.960) [-2093.157] (-2093.897) * (-2099.597) [-2094.555] (-2094.719) (-2099.670) -- 0:02:14 559000 -- (-2102.176) [-2097.164] (-2094.077) (-2096.141) * (-2100.167) [-2090.169] (-2094.714) (-2095.626) -- 0:02:14 559500 -- [-2095.910] (-2096.557) (-2097.700) (-2098.638) * (-2094.076) (-2093.533) (-2099.332) [-2096.802] -- 0:02:13 560000 -- (-2100.157) (-2101.648) [-2096.908] (-2097.791) * (-2097.698) [-2092.204] (-2105.520) (-2094.348) -- 0:02:13 Average standard deviation of split frequencies: 0.001682 560500 -- (-2098.816) [-2100.455] (-2097.598) (-2092.312) * [-2095.621] (-2094.712) (-2109.626) (-2104.643) -- 0:02:13 561000 -- (-2099.274) (-2094.328) [-2096.527] (-2100.045) * (-2098.071) [-2090.196] (-2101.548) (-2101.904) -- 0:02:13 561500 -- (-2099.153) [-2092.915] (-2098.646) (-2098.674) * (-2095.209) [-2095.214] (-2102.078) (-2095.046) -- 0:02:12 562000 -- (-2102.103) (-2098.145) [-2090.937] (-2092.116) * (-2093.513) [-2096.245] (-2099.627) (-2093.733) -- 0:02:13 562500 -- (-2095.720) (-2104.228) (-2089.666) [-2091.027] * (-2093.881) [-2094.980] (-2100.379) (-2091.595) -- 0:02:13 563000 -- [-2098.506] (-2093.818) (-2090.344) (-2096.491) * [-2095.394] (-2101.177) (-2106.513) (-2097.427) -- 0:02:12 563500 -- [-2099.526] (-2093.629) (-2102.522) (-2099.122) * (-2099.542) (-2097.652) (-2095.505) [-2096.386] -- 0:02:12 564000 -- [-2104.996] (-2101.160) (-2102.282) (-2099.929) * [-2094.039] (-2095.811) (-2096.180) (-2093.397) -- 0:02:12 564500 -- [-2100.483] (-2099.019) (-2102.172) (-2095.358) * (-2091.158) [-2104.199] (-2101.863) (-2095.857) -- 0:02:11 565000 -- (-2099.807) (-2106.494) (-2103.075) [-2096.856] * [-2094.285] (-2099.954) (-2101.180) (-2091.126) -- 0:02:11 Average standard deviation of split frequencies: 0.001666 565500 -- (-2097.183) (-2095.190) (-2101.221) [-2094.943] * (-2093.446) [-2092.973] (-2095.961) (-2093.649) -- 0:02:12 566000 -- (-2089.422) (-2090.213) (-2097.091) [-2093.382] * [-2094.975] (-2098.766) (-2093.029) (-2095.982) -- 0:02:11 566500 -- (-2093.664) (-2093.167) [-2092.532] (-2093.026) * (-2096.264) (-2102.022) (-2096.216) [-2096.956] -- 0:02:11 567000 -- [-2095.992] (-2099.974) (-2105.808) (-2098.829) * [-2099.302] (-2095.856) (-2094.603) (-2103.458) -- 0:02:11 567500 -- (-2095.297) [-2091.218] (-2095.916) (-2100.283) * (-2099.572) [-2090.826] (-2104.103) (-2105.524) -- 0:02:11 568000 -- (-2102.314) (-2095.084) (-2093.514) [-2101.915] * (-2102.491) (-2093.593) [-2090.640] (-2097.194) -- 0:02:10 568500 -- (-2093.981) (-2096.332) [-2100.946] (-2098.825) * (-2097.423) (-2101.752) [-2091.801] (-2102.963) -- 0:02:10 569000 -- (-2100.430) [-2093.740] (-2096.345) (-2099.521) * (-2102.215) [-2095.323] (-2095.967) (-2095.523) -- 0:02:11 569500 -- (-2092.175) [-2093.959] (-2092.470) (-2096.610) * (-2089.839) [-2102.178] (-2099.502) (-2092.270) -- 0:02:10 570000 -- (-2100.922) (-2096.309) [-2096.971] (-2095.332) * (-2090.944) (-2099.516) (-2093.379) [-2090.601] -- 0:02:10 Average standard deviation of split frequencies: 0.000826 570500 -- (-2102.769) (-2093.509) [-2096.291] (-2091.138) * (-2100.365) [-2111.153] (-2099.494) (-2094.666) -- 0:02:10 571000 -- [-2095.704] (-2095.514) (-2093.609) (-2108.343) * (-2100.244) [-2099.057] (-2103.677) (-2092.712) -- 0:02:09 571500 -- (-2094.546) [-2096.592] (-2099.066) (-2096.283) * [-2097.665] (-2097.591) (-2105.419) (-2097.528) -- 0:02:09 572000 -- [-2097.178] (-2098.458) (-2101.855) (-2094.468) * (-2097.354) (-2102.858) (-2097.390) [-2091.747] -- 0:02:10 572500 -- (-2095.938) (-2094.091) [-2100.766] (-2092.597) * (-2101.236) [-2091.487] (-2103.816) (-2103.227) -- 0:02:09 573000 -- (-2096.186) (-2094.542) (-2099.183) [-2094.817] * (-2112.120) [-2094.465] (-2101.756) (-2091.356) -- 0:02:09 573500 -- (-2095.907) (-2099.157) [-2098.123] (-2093.543) * (-2097.452) (-2098.711) [-2090.180] (-2091.565) -- 0:02:09 574000 -- (-2090.470) (-2095.824) (-2102.352) [-2101.499] * (-2101.823) [-2096.655] (-2096.835) (-2096.004) -- 0:02:09 574500 -- (-2092.637) [-2097.953] (-2104.291) (-2094.751) * (-2092.907) (-2094.326) [-2096.919] (-2094.963) -- 0:02:08 575000 -- [-2091.075] (-2098.297) (-2091.968) (-2097.952) * (-2096.693) [-2092.694] (-2096.360) (-2098.336) -- 0:02:08 Average standard deviation of split frequencies: 0.001023 575500 -- [-2097.725] (-2096.074) (-2092.018) (-2096.238) * (-2093.081) [-2093.481] (-2108.453) (-2094.091) -- 0:02:09 576000 -- [-2094.298] (-2103.652) (-2092.549) (-2091.998) * [-2097.711] (-2098.386) (-2102.244) (-2109.213) -- 0:02:08 576500 -- (-2096.610) (-2105.339) [-2098.919] (-2094.123) * (-2106.507) (-2098.850) [-2102.692] (-2092.973) -- 0:02:08 577000 -- (-2098.629) [-2098.545] (-2099.693) (-2096.952) * (-2098.883) (-2102.071) (-2109.933) [-2097.363] -- 0:02:08 577500 -- (-2100.835) (-2091.523) [-2096.114] (-2103.158) * (-2089.404) [-2091.656] (-2102.084) (-2100.394) -- 0:02:08 578000 -- (-2096.336) (-2099.198) (-2095.549) [-2100.984] * [-2092.494] (-2106.106) (-2099.468) (-2101.596) -- 0:02:07 578500 -- [-2100.971] (-2104.843) (-2096.415) (-2096.368) * (-2099.310) [-2094.361] (-2098.879) (-2096.415) -- 0:02:07 579000 -- (-2095.856) (-2103.341) [-2096.356] (-2095.217) * (-2095.542) (-2091.208) (-2102.845) [-2098.386] -- 0:02:07 579500 -- (-2095.900) (-2105.428) (-2104.434) [-2093.121] * (-2092.894) (-2094.022) [-2101.695] (-2098.194) -- 0:02:07 580000 -- (-2093.687) (-2099.561) (-2103.239) [-2093.030] * (-2096.998) (-2100.207) [-2089.710] (-2094.519) -- 0:02:07 Average standard deviation of split frequencies: 0.001015 580500 -- (-2087.333) (-2097.830) [-2097.453] (-2091.785) * (-2095.505) (-2103.662) (-2101.735) [-2099.037] -- 0:02:07 581000 -- (-2100.263) [-2104.166] (-2100.127) (-2098.351) * (-2102.687) [-2099.310] (-2099.816) (-2101.788) -- 0:02:06 581500 -- (-2094.237) (-2106.451) [-2093.051] (-2107.070) * (-2097.315) (-2097.410) (-2100.087) [-2090.551] -- 0:02:06 582000 -- [-2095.629] (-2116.447) (-2101.387) (-2102.741) * [-2091.860] (-2098.087) (-2100.398) (-2096.382) -- 0:02:07 582500 -- (-2092.678) (-2102.949) [-2097.673] (-2097.827) * [-2107.728] (-2100.403) (-2095.873) (-2095.091) -- 0:02:06 583000 -- (-2100.648) (-2097.562) [-2093.012] (-2104.166) * (-2101.523) [-2100.381] (-2096.494) (-2096.650) -- 0:02:06 583500 -- [-2097.044] (-2102.104) (-2097.375) (-2105.152) * [-2096.547] (-2099.633) (-2099.526) (-2098.708) -- 0:02:06 584000 -- (-2094.319) (-2102.785) (-2103.602) [-2097.501] * (-2097.913) [-2090.787] (-2107.821) (-2095.925) -- 0:02:06 584500 -- (-2104.150) (-2099.645) (-2096.492) [-2092.167] * (-2105.618) (-2096.927) [-2098.733] (-2095.564) -- 0:02:05 585000 -- (-2092.037) [-2096.765] (-2095.280) (-2097.312) * [-2101.582] (-2097.908) (-2102.029) (-2094.375) -- 0:02:05 Average standard deviation of split frequencies: 0.001006 585500 -- (-2095.136) (-2095.629) [-2093.526] (-2100.463) * [-2095.858] (-2095.458) (-2101.697) (-2099.541) -- 0:02:06 586000 -- (-2095.021) (-2096.824) (-2099.896) [-2096.345] * (-2098.284) (-2094.994) (-2106.509) [-2102.356] -- 0:02:05 586500 -- (-2095.133) (-2091.523) [-2097.500] (-2096.140) * (-2095.745) (-2101.979) [-2096.654] (-2107.290) -- 0:02:05 587000 -- (-2099.025) (-2103.099) [-2094.813] (-2101.570) * [-2096.572] (-2091.716) (-2104.732) (-2096.756) -- 0:02:05 587500 -- [-2099.436] (-2101.763) (-2098.914) (-2098.436) * (-2100.054) (-2097.598) [-2096.382] (-2093.743) -- 0:02:04 588000 -- (-2100.117) [-2098.600] (-2102.280) (-2095.820) * (-2101.079) [-2091.158] (-2103.189) (-2106.182) -- 0:02:04 588500 -- (-2099.854) (-2095.107) [-2094.810] (-2099.756) * [-2095.324] (-2097.993) (-2097.962) (-2099.949) -- 0:02:04 589000 -- (-2097.961) [-2093.373] (-2102.686) (-2098.872) * [-2103.551] (-2104.893) (-2091.229) (-2097.927) -- 0:02:04 589500 -- (-2104.123) (-2097.415) (-2101.213) [-2093.760] * [-2090.040] (-2103.951) (-2102.093) (-2101.743) -- 0:02:04 590000 -- (-2098.398) (-2101.343) (-2103.974) [-2096.418] * [-2097.645] (-2100.701) (-2097.641) (-2094.767) -- 0:02:04 Average standard deviation of split frequencies: 0.000798 590500 -- (-2100.424) [-2099.705] (-2094.836) (-2095.120) * [-2093.354] (-2095.919) (-2108.448) (-2104.694) -- 0:02:04 591000 -- (-2095.734) (-2096.728) [-2091.035] (-2095.068) * (-2097.638) [-2095.445] (-2103.507) (-2097.676) -- 0:02:03 591500 -- (-2105.543) (-2103.272) [-2092.648] (-2100.881) * [-2096.967] (-2097.383) (-2107.681) (-2116.079) -- 0:02:03 592000 -- (-2096.679) (-2093.219) (-2095.245) [-2091.584] * (-2098.144) (-2096.174) (-2100.518) [-2109.448] -- 0:02:03 592500 -- (-2098.621) (-2098.299) (-2101.784) [-2094.618] * (-2095.601) [-2095.290] (-2100.471) (-2109.478) -- 0:02:03 593000 -- (-2098.966) [-2094.397] (-2104.654) (-2094.288) * [-2096.278] (-2099.089) (-2095.162) (-2098.563) -- 0:02:03 593500 -- (-2093.310) [-2089.927] (-2095.945) (-2094.346) * (-2098.074) (-2093.752) (-2094.030) [-2100.498] -- 0:02:03 594000 -- (-2102.236) [-2094.940] (-2092.291) (-2103.894) * [-2096.290] (-2097.173) (-2093.206) (-2097.761) -- 0:02:03 594500 -- (-2101.032) (-2100.424) [-2094.296] (-2093.252) * (-2099.203) (-2101.369) (-2097.721) [-2096.078] -- 0:02:02 595000 -- [-2097.053] (-2101.492) (-2096.602) (-2101.228) * (-2099.469) (-2104.902) (-2094.068) [-2095.322] -- 0:02:02 Average standard deviation of split frequencies: 0.000791 595500 -- [-2091.479] (-2096.740) (-2095.259) (-2098.904) * [-2090.971] (-2091.003) (-2096.632) (-2099.697) -- 0:02:02 596000 -- (-2105.794) (-2092.284) (-2096.308) [-2090.327] * (-2094.483) (-2095.481) (-2095.078) [-2091.339] -- 0:02:02 596500 -- (-2099.660) (-2099.701) (-2096.740) [-2097.169] * (-2095.432) (-2089.389) [-2099.079] (-2093.284) -- 0:02:02 597000 -- [-2095.036] (-2092.490) (-2091.416) (-2097.035) * [-2092.350] (-2090.621) (-2096.601) (-2093.424) -- 0:02:02 597500 -- (-2096.935) (-2101.557) [-2094.174] (-2096.751) * (-2101.110) (-2100.636) (-2096.326) [-2092.911] -- 0:02:01 598000 -- [-2102.701] (-2095.849) (-2097.293) (-2097.303) * (-2097.994) [-2095.480] (-2097.009) (-2100.232) -- 0:02:01 598500 -- (-2097.775) [-2094.762] (-2102.154) (-2094.276) * (-2106.152) [-2092.731] (-2101.666) (-2095.387) -- 0:02:01 599000 -- [-2094.359] (-2098.498) (-2098.103) (-2098.158) * (-2090.388) [-2093.100] (-2097.682) (-2094.179) -- 0:02:01 599500 -- [-2099.273] (-2097.013) (-2098.212) (-2092.244) * (-2097.184) [-2097.153] (-2095.180) (-2101.732) -- 0:02:01 600000 -- (-2089.967) [-2092.422] (-2097.501) (-2102.133) * (-2094.010) [-2092.577] (-2100.414) (-2096.439) -- 0:02:01 Average standard deviation of split frequencies: 0.001177 600500 -- [-2093.535] (-2095.322) (-2096.947) (-2095.110) * (-2104.085) (-2101.778) (-2091.743) [-2097.393] -- 0:02:01 601000 -- (-2097.259) (-2092.922) [-2093.757] (-2093.839) * [-2096.715] (-2097.108) (-2092.193) (-2097.339) -- 0:02:00 601500 -- (-2093.071) (-2099.699) [-2088.039] (-2091.632) * (-2100.512) [-2094.655] (-2100.087) (-2092.594) -- 0:02:00 602000 -- (-2092.241) (-2108.216) (-2091.773) [-2094.107] * (-2104.596) (-2093.871) [-2094.048] (-2098.114) -- 0:02:00 602500 -- (-2095.434) (-2101.701) [-2098.128] (-2099.282) * [-2103.518] (-2099.444) (-2101.548) (-2097.919) -- 0:02:00 603000 -- [-2094.380] (-2094.458) (-2094.725) (-2097.631) * [-2091.769] (-2094.828) (-2093.714) (-2098.024) -- 0:02:00 603500 -- [-2096.104] (-2099.936) (-2093.681) (-2101.340) * (-2096.871) [-2096.247] (-2097.402) (-2098.947) -- 0:02:00 604000 -- (-2097.420) (-2098.033) (-2108.140) [-2091.263] * (-2103.859) [-2093.519] (-2100.357) (-2097.394) -- 0:01:59 604500 -- (-2094.413) (-2095.766) (-2098.599) [-2093.702] * [-2094.002] (-2090.968) (-2096.270) (-2103.027) -- 0:01:59 605000 -- (-2094.063) (-2094.714) [-2092.135] (-2097.397) * (-2092.620) [-2101.261] (-2092.625) (-2102.414) -- 0:01:59 Average standard deviation of split frequencies: 0.001167 605500 -- (-2097.332) (-2094.616) [-2096.509] (-2098.619) * (-2102.205) (-2099.470) [-2093.290] (-2098.477) -- 0:01:59 606000 -- (-2100.057) (-2096.092) [-2097.110] (-2107.206) * (-2103.975) (-2100.897) [-2104.954] (-2097.462) -- 0:01:59 606500 -- (-2097.637) (-2107.224) (-2109.885) [-2102.846] * (-2097.893) (-2092.012) [-2095.126] (-2097.628) -- 0:01:59 607000 -- [-2095.227] (-2096.707) (-2100.267) (-2097.750) * [-2093.829] (-2096.277) (-2091.210) (-2098.326) -- 0:01:59 607500 -- (-2097.288) (-2095.975) [-2092.494] (-2099.841) * (-2094.925) [-2092.569] (-2098.909) (-2104.097) -- 0:01:58 608000 -- (-2097.022) (-2100.990) [-2098.374] (-2101.673) * [-2095.670] (-2090.480) (-2101.547) (-2096.354) -- 0:01:58 608500 -- (-2100.597) (-2094.377) (-2105.545) [-2089.187] * [-2096.935] (-2092.536) (-2103.013) (-2095.806) -- 0:01:58 609000 -- (-2091.649) (-2097.351) (-2096.886) [-2103.351] * [-2090.965] (-2091.335) (-2092.507) (-2096.267) -- 0:01:58 609500 -- (-2101.784) (-2107.203) (-2097.890) [-2098.416] * [-2095.687] (-2101.147) (-2109.191) (-2094.481) -- 0:01:58 610000 -- [-2095.921] (-2102.375) (-2091.733) (-2101.027) * (-2098.512) (-2090.721) (-2097.629) [-2093.616] -- 0:01:58 Average standard deviation of split frequencies: 0.000772 610500 -- (-2098.774) [-2097.133] (-2098.244) (-2102.986) * (-2104.927) [-2097.051] (-2090.475) (-2096.975) -- 0:01:58 611000 -- (-2112.600) [-2094.693] (-2101.251) (-2093.897) * (-2098.345) (-2092.229) (-2094.719) [-2093.930] -- 0:01:57 611500 -- (-2104.137) (-2090.968) (-2096.566) [-2095.630] * [-2097.078] (-2097.838) (-2094.140) (-2092.696) -- 0:01:57 612000 -- (-2099.787) [-2109.078] (-2097.371) (-2091.263) * (-2097.872) (-2104.203) (-2091.925) [-2099.156] -- 0:01:57 612500 -- (-2094.968) [-2097.881] (-2090.803) (-2105.857) * (-2099.585) (-2096.165) [-2090.101] (-2096.552) -- 0:01:57 613000 -- (-2094.405) [-2093.971] (-2095.298) (-2099.843) * [-2092.668] (-2105.687) (-2091.068) (-2097.829) -- 0:01:57 613500 -- (-2100.360) (-2102.429) (-2098.492) [-2100.795] * (-2095.261) (-2095.245) [-2094.070] (-2094.135) -- 0:01:57 614000 -- (-2103.153) (-2094.400) (-2096.296) [-2095.157] * (-2098.432) (-2094.918) (-2102.668) [-2095.740] -- 0:01:56 614500 -- (-2096.209) [-2093.211] (-2097.986) (-2092.588) * (-2100.990) (-2092.129) (-2101.556) [-2093.321] -- 0:01:56 615000 -- (-2097.139) [-2094.593] (-2094.140) (-2092.523) * (-2094.697) (-2099.776) [-2091.441] (-2093.466) -- 0:01:56 Average standard deviation of split frequencies: 0.001148 615500 -- (-2092.519) (-2093.857) [-2108.849] (-2095.126) * [-2095.469] (-2104.060) (-2095.922) (-2098.614) -- 0:01:56 616000 -- [-2095.028] (-2101.288) (-2095.203) (-2093.314) * (-2105.588) [-2096.951] (-2100.106) (-2103.984) -- 0:01:56 616500 -- (-2091.586) (-2097.653) (-2096.697) [-2102.998] * (-2100.035) (-2096.707) (-2100.387) [-2103.336] -- 0:01:56 617000 -- (-2096.523) [-2094.067] (-2098.503) (-2096.997) * (-2097.268) (-2098.459) (-2087.598) [-2101.019] -- 0:01:56 617500 -- [-2089.730] (-2094.949) (-2092.423) (-2097.311) * (-2101.390) (-2100.148) [-2095.939] (-2093.084) -- 0:01:55 618000 -- (-2095.115) (-2094.989) (-2094.181) [-2090.006] * [-2097.886] (-2095.663) (-2089.934) (-2099.930) -- 0:01:55 618500 -- [-2095.944] (-2101.425) (-2097.662) (-2100.971) * (-2103.590) [-2095.587] (-2100.089) (-2110.583) -- 0:01:55 619000 -- (-2093.924) [-2101.879] (-2093.114) (-2097.475) * (-2101.029) [-2093.724] (-2098.258) (-2102.826) -- 0:01:55 619500 -- (-2090.731) (-2093.599) [-2093.800] (-2100.871) * (-2094.784) (-2096.268) [-2105.342] (-2098.216) -- 0:01:55 620000 -- [-2102.852] (-2091.445) (-2098.677) (-2094.269) * (-2097.970) (-2095.291) [-2098.076] (-2099.546) -- 0:01:55 Average standard deviation of split frequencies: 0.000949 620500 -- (-2101.397) (-2095.452) (-2102.209) [-2098.402] * (-2101.376) (-2095.403) (-2101.239) [-2094.784] -- 0:01:54 621000 -- [-2092.351] (-2094.435) (-2101.522) (-2095.769) * (-2098.074) (-2104.936) [-2095.069] (-2098.920) -- 0:01:54 621500 -- (-2101.403) [-2092.868] (-2095.618) (-2095.959) * (-2089.943) [-2092.585] (-2100.064) (-2101.225) -- 0:01:54 622000 -- (-2098.090) (-2096.510) (-2103.089) [-2094.065] * (-2099.377) [-2100.452] (-2093.005) (-2093.788) -- 0:01:54 622500 -- (-2095.210) (-2096.871) (-2107.468) [-2095.388] * (-2102.057) (-2092.692) (-2104.674) [-2096.097] -- 0:01:54 623000 -- (-2103.795) (-2089.744) [-2093.007] (-2094.527) * (-2098.685) (-2096.282) (-2101.813) [-2091.242] -- 0:01:54 623500 -- (-2098.537) (-2099.506) (-2093.820) [-2093.743] * (-2101.009) (-2096.946) (-2101.887) [-2094.380] -- 0:01:54 624000 -- (-2095.842) (-2104.237) (-2100.013) [-2094.080] * (-2100.024) (-2101.113) [-2099.320] (-2110.755) -- 0:01:53 624500 -- (-2097.557) (-2102.038) [-2094.530] (-2097.651) * [-2101.751] (-2094.215) (-2098.437) (-2098.311) -- 0:01:53 625000 -- [-2090.917] (-2106.571) (-2097.138) (-2099.783) * (-2099.612) [-2096.137] (-2094.924) (-2101.938) -- 0:01:53 Average standard deviation of split frequencies: 0.000941 625500 -- (-2098.105) (-2094.545) [-2096.744] (-2099.983) * (-2095.845) (-2095.680) (-2100.917) [-2089.355] -- 0:01:53 626000 -- [-2094.917] (-2098.514) (-2096.961) (-2097.702) * (-2095.473) (-2097.056) [-2092.910] (-2091.396) -- 0:01:53 626500 -- (-2099.045) [-2096.784] (-2092.070) (-2093.328) * (-2101.799) [-2097.345] (-2100.544) (-2096.888) -- 0:01:53 627000 -- [-2100.097] (-2096.239) (-2098.078) (-2093.143) * (-2100.572) (-2101.066) (-2102.385) [-2101.270] -- 0:01:53 627500 -- (-2095.215) (-2095.555) (-2100.606) [-2093.913] * (-2100.117) [-2093.678] (-2095.121) (-2090.458) -- 0:01:52 628000 -- (-2098.563) (-2092.596) (-2095.310) [-2097.021] * (-2103.526) (-2092.573) [-2090.632] (-2097.451) -- 0:01:52 628500 -- (-2100.743) (-2100.852) (-2095.909) [-2102.795] * (-2107.805) (-2094.391) (-2097.109) [-2099.951] -- 0:01:52 629000 -- (-2103.761) [-2091.354] (-2096.041) (-2096.195) * (-2097.948) (-2097.184) (-2097.880) [-2095.035] -- 0:01:52 629500 -- (-2098.837) (-2095.984) (-2090.840) [-2094.699] * (-2101.453) (-2094.867) (-2101.810) [-2102.534] -- 0:01:52 630000 -- [-2099.603] (-2097.695) (-2095.805) (-2095.366) * [-2094.764] (-2098.997) (-2104.528) (-2098.329) -- 0:01:52 Average standard deviation of split frequencies: 0.001682 630500 -- [-2093.484] (-2092.651) (-2098.019) (-2096.789) * [-2090.825] (-2099.408) (-2093.241) (-2091.083) -- 0:01:51 631000 -- (-2093.098) [-2093.236] (-2102.812) (-2099.344) * (-2099.061) [-2095.552] (-2097.481) (-2091.544) -- 0:01:51 631500 -- (-2099.992) [-2093.753] (-2101.253) (-2095.385) * (-2100.150) (-2098.096) [-2093.163] (-2096.862) -- 0:01:51 632000 -- [-2097.067] (-2098.732) (-2093.783) (-2098.590) * (-2095.113) [-2096.832] (-2103.159) (-2099.776) -- 0:01:51 632500 -- [-2092.108] (-2100.791) (-2104.932) (-2092.460) * (-2092.282) (-2094.556) [-2095.648] (-2099.852) -- 0:01:50 633000 -- (-2098.407) (-2094.141) (-2092.020) [-2093.172] * (-2094.912) (-2096.570) (-2091.691) [-2092.031] -- 0:01:51 633500 -- (-2098.117) (-2093.644) (-2105.395) [-2093.817] * (-2099.277) (-2097.408) (-2109.394) [-2089.417] -- 0:01:51 634000 -- (-2097.565) [-2100.200] (-2094.318) (-2094.957) * (-2101.246) (-2094.466) (-2095.041) [-2088.965] -- 0:01:50 634500 -- (-2099.862) (-2104.706) (-2094.564) [-2096.806] * (-2103.153) (-2091.834) (-2095.938) [-2092.545] -- 0:01:50 635000 -- (-2099.225) (-2095.959) [-2096.765] (-2102.440) * (-2098.786) (-2097.727) (-2100.828) [-2099.098] -- 0:01:50 Average standard deviation of split frequencies: 0.001668 635500 -- (-2097.948) [-2097.367] (-2101.488) (-2105.604) * (-2106.223) [-2099.340] (-2101.589) (-2098.711) -- 0:01:50 636000 -- (-2093.088) (-2100.652) [-2096.676] (-2107.820) * (-2102.670) [-2090.575] (-2100.399) (-2103.765) -- 0:01:50 636500 -- [-2090.180] (-2089.272) (-2099.794) (-2094.234) * (-2092.218) (-2094.183) (-2093.430) [-2099.512] -- 0:01:50 637000 -- (-2092.979) (-2093.448) [-2094.683] (-2102.667) * [-2094.660] (-2097.605) (-2094.345) (-2101.548) -- 0:01:49 637500 -- [-2100.501] (-2097.554) (-2095.842) (-2100.706) * [-2101.118] (-2099.273) (-2099.430) (-2101.019) -- 0:01:49 638000 -- [-2099.183] (-2102.019) (-2100.884) (-2096.077) * (-2108.315) (-2101.307) (-2099.132) [-2101.540] -- 0:01:49 638500 -- (-2107.564) [-2101.162] (-2094.778) (-2098.848) * (-2100.843) [-2097.831] (-2094.123) (-2089.253) -- 0:01:49 639000 -- [-2094.954] (-2096.327) (-2095.486) (-2102.124) * (-2097.009) (-2090.253) (-2096.967) [-2097.803] -- 0:01:49 639500 -- (-2100.851) [-2092.459] (-2100.126) (-2100.105) * [-2092.927] (-2096.785) (-2097.761) (-2105.199) -- 0:01:49 640000 -- (-2103.291) (-2096.126) (-2099.230) [-2097.384] * (-2100.372) [-2099.794] (-2099.517) (-2094.949) -- 0:01:49 Average standard deviation of split frequencies: 0.001472 640500 -- (-2104.270) (-2099.184) [-2098.646] (-2096.481) * (-2095.666) [-2099.853] (-2100.080) (-2101.145) -- 0:01:48 641000 -- (-2101.132) (-2102.950) [-2095.229] (-2101.248) * [-2092.430] (-2100.337) (-2100.701) (-2100.415) -- 0:01:48 641500 -- (-2098.304) (-2100.774) (-2098.160) [-2093.880] * [-2093.312] (-2097.244) (-2093.686) (-2098.112) -- 0:01:48 642000 -- (-2098.831) (-2099.880) (-2100.169) [-2090.690] * [-2090.637] (-2113.023) (-2098.031) (-2099.661) -- 0:01:48 642500 -- (-2095.204) (-2096.366) (-2097.599) [-2095.352] * [-2098.065] (-2096.709) (-2096.331) (-2098.275) -- 0:01:47 643000 -- [-2089.870] (-2100.897) (-2091.940) (-2100.627) * (-2096.871) [-2097.568] (-2096.865) (-2099.535) -- 0:01:48 643500 -- (-2093.737) [-2101.893] (-2094.009) (-2088.848) * (-2098.307) (-2097.817) (-2102.156) [-2092.644] -- 0:01:48 644000 -- (-2091.184) (-2091.508) [-2093.548] (-2099.850) * (-2100.156) [-2098.918] (-2089.596) (-2100.486) -- 0:01:47 644500 -- (-2098.865) (-2100.230) [-2097.529] (-2099.710) * (-2100.861) [-2098.613] (-2101.703) (-2089.678) -- 0:01:47 645000 -- [-2095.545] (-2093.855) (-2106.672) (-2101.988) * (-2103.885) [-2097.119] (-2101.641) (-2095.132) -- 0:01:47 Average standard deviation of split frequencies: 0.001824 645500 -- [-2094.826] (-2095.300) (-2103.436) (-2101.762) * [-2095.579] (-2098.587) (-2102.826) (-2094.242) -- 0:01:47 646000 -- (-2107.135) (-2099.868) [-2097.784] (-2096.275) * [-2094.717] (-2102.656) (-2101.288) (-2090.723) -- 0:01:47 646500 -- [-2097.476] (-2107.401) (-2094.250) (-2097.830) * (-2099.742) [-2097.220] (-2095.172) (-2091.835) -- 0:01:47 647000 -- [-2092.541] (-2098.244) (-2104.301) (-2101.190) * (-2097.935) (-2098.160) (-2094.452) [-2098.132] -- 0:01:46 647500 -- (-2101.210) [-2095.233] (-2096.031) (-2096.722) * (-2100.011) (-2096.600) [-2105.565] (-2092.685) -- 0:01:46 648000 -- (-2094.564) [-2099.772] (-2096.451) (-2099.440) * (-2095.478) [-2091.770] (-2095.668) (-2102.402) -- 0:01:46 648500 -- [-2089.244] (-2097.965) (-2101.756) (-2093.195) * [-2090.962] (-2094.886) (-2099.177) (-2101.485) -- 0:01:46 649000 -- (-2098.070) (-2099.201) (-2097.266) [-2091.165] * [-2095.121] (-2093.154) (-2098.419) (-2097.012) -- 0:01:46 649500 -- (-2096.741) (-2095.721) (-2100.900) [-2091.402] * (-2100.424) (-2094.340) (-2097.008) [-2094.764] -- 0:01:46 650000 -- (-2099.830) (-2101.839) (-2096.606) [-2092.642] * (-2092.272) [-2093.769] (-2095.542) (-2101.434) -- 0:01:46 Average standard deviation of split frequencies: 0.001449 650500 -- (-2090.136) (-2097.569) (-2101.175) [-2093.923] * (-2102.315) (-2095.754) [-2093.758] (-2101.559) -- 0:01:45 651000 -- (-2097.426) (-2097.893) [-2095.662] (-2094.690) * (-2099.499) [-2090.362] (-2100.372) (-2102.930) -- 0:01:45 651500 -- (-2096.737) (-2095.971) [-2091.376] (-2102.853) * [-2096.238] (-2095.627) (-2098.428) (-2111.951) -- 0:01:45 652000 -- (-2094.951) (-2100.144) [-2092.036] (-2099.302) * (-2097.674) (-2088.972) [-2102.166] (-2097.579) -- 0:01:45 652500 -- [-2091.005] (-2093.163) (-2097.327) (-2103.112) * (-2101.501) [-2091.467] (-2096.476) (-2095.603) -- 0:01:44 653000 -- [-2095.467] (-2094.458) (-2095.724) (-2101.490) * (-2093.989) [-2094.563] (-2097.582) (-2100.972) -- 0:01:45 653500 -- (-2097.087) (-2096.135) (-2090.793) [-2092.384] * [-2098.205] (-2095.977) (-2097.217) (-2091.253) -- 0:01:44 654000 -- (-2099.536) (-2092.964) [-2089.216] (-2104.216) * (-2097.260) [-2094.323] (-2102.286) (-2098.400) -- 0:01:44 654500 -- [-2100.454] (-2092.620) (-2108.775) (-2090.305) * [-2093.010] (-2093.084) (-2115.455) (-2095.846) -- 0:01:44 655000 -- (-2096.197) (-2099.263) (-2105.028) [-2092.900] * (-2092.719) (-2099.005) [-2095.388] (-2096.091) -- 0:01:44 Average standard deviation of split frequencies: 0.001617 655500 -- (-2092.502) (-2103.980) [-2098.888] (-2105.213) * (-2097.473) (-2092.901) (-2102.297) [-2092.918] -- 0:01:44 656000 -- (-2098.314) (-2100.705) (-2097.339) [-2093.632] * (-2095.948) (-2101.672) [-2092.213] (-2095.997) -- 0:01:44 656500 -- [-2099.067] (-2094.674) (-2094.126) (-2098.049) * [-2095.144] (-2103.735) (-2111.458) (-2096.666) -- 0:01:44 657000 -- (-2104.256) (-2095.255) (-2100.750) [-2092.356] * (-2093.214) [-2094.374] (-2103.092) (-2092.288) -- 0:01:43 657500 -- [-2094.679] (-2097.143) (-2092.469) (-2102.293) * [-2091.556] (-2098.379) (-2097.409) (-2089.708) -- 0:01:43 658000 -- (-2098.420) (-2098.452) (-2104.398) [-2102.016] * [-2092.498] (-2094.908) (-2101.689) (-2091.224) -- 0:01:43 658500 -- (-2104.515) (-2094.458) [-2094.573] (-2099.067) * [-2092.873] (-2089.204) (-2095.331) (-2103.558) -- 0:01:43 659000 -- (-2116.894) (-2102.211) (-2089.703) [-2100.899] * [-2091.562] (-2092.868) (-2100.743) (-2090.752) -- 0:01:42 659500 -- (-2110.720) [-2102.434] (-2090.991) (-2103.957) * (-2094.340) (-2094.017) (-2094.173) [-2097.417] -- 0:01:43 660000 -- (-2121.792) (-2099.349) (-2095.553) [-2097.898] * (-2092.005) [-2097.307] (-2102.271) (-2098.527) -- 0:01:43 Average standard deviation of split frequencies: 0.001070 660500 -- (-2107.136) (-2094.356) [-2101.166] (-2093.614) * (-2091.737) [-2092.109] (-2098.453) (-2099.584) -- 0:01:42 661000 -- (-2100.049) (-2093.378) (-2103.858) [-2101.986] * (-2101.842) [-2094.804] (-2098.672) (-2108.675) -- 0:01:42 661500 -- (-2099.968) [-2093.622] (-2095.625) (-2096.487) * (-2096.291) (-2101.707) [-2095.310] (-2095.101) -- 0:01:42 662000 -- (-2098.631) (-2098.472) [-2098.446] (-2093.350) * [-2100.277] (-2106.119) (-2106.539) (-2100.184) -- 0:01:42 662500 -- (-2095.947) (-2094.558) [-2093.361] (-2092.021) * (-2103.267) (-2095.333) (-2096.757) [-2102.338] -- 0:01:41 663000 -- (-2094.233) [-2103.668] (-2092.664) (-2090.993) * [-2097.527] (-2096.551) (-2095.836) (-2093.830) -- 0:01:42 663500 -- (-2102.952) (-2099.102) [-2097.396] (-2103.796) * [-2093.342] (-2095.480) (-2097.327) (-2092.346) -- 0:01:41 664000 -- (-2091.801) (-2098.850) (-2091.022) [-2095.230] * (-2099.610) (-2101.771) [-2098.389] (-2113.235) -- 0:01:41 664500 -- (-2091.511) (-2096.603) [-2099.848] (-2102.324) * (-2098.261) (-2100.331) [-2094.929] (-2099.366) -- 0:01:41 665000 -- [-2101.644] (-2105.269) (-2095.964) (-2098.338) * [-2097.737] (-2103.123) (-2114.042) (-2098.804) -- 0:01:41 Average standard deviation of split frequencies: 0.001416 665500 -- (-2092.927) (-2093.238) [-2092.835] (-2097.452) * [-2103.241] (-2101.506) (-2095.642) (-2105.311) -- 0:01:41 666000 -- [-2092.003] (-2102.269) (-2099.858) (-2098.841) * (-2103.711) [-2101.530] (-2095.282) (-2095.166) -- 0:01:40 666500 -- (-2104.553) (-2099.347) [-2096.159] (-2098.205) * (-2096.040) (-2103.776) [-2094.020] (-2095.801) -- 0:01:41 667000 -- (-2091.761) (-2093.400) [-2092.999] (-2097.560) * [-2095.652] (-2102.723) (-2109.552) (-2099.451) -- 0:01:40 667500 -- (-2093.584) (-2091.233) [-2096.942] (-2104.148) * (-2093.510) [-2089.226] (-2099.095) (-2098.099) -- 0:01:40 668000 -- (-2095.127) (-2096.539) (-2095.883) [-2098.108] * [-2095.454] (-2096.584) (-2094.309) (-2092.822) -- 0:01:40 668500 -- [-2098.310] (-2096.182) (-2095.395) (-2097.224) * (-2111.026) (-2105.309) (-2098.949) [-2093.951] -- 0:01:40 669000 -- (-2094.065) (-2092.480) (-2091.037) [-2091.821] * (-2100.847) (-2103.800) [-2104.098] (-2096.929) -- 0:01:39 669500 -- (-2098.471) [-2095.745] (-2107.064) (-2095.673) * [-2101.085] (-2100.950) (-2097.598) (-2102.393) -- 0:01:40 670000 -- (-2095.680) (-2094.413) (-2101.432) [-2100.758] * (-2107.280) (-2093.964) (-2101.080) [-2096.472] -- 0:01:39 Average standard deviation of split frequencies: 0.001230 670500 -- [-2092.726] (-2096.327) (-2100.015) (-2112.740) * (-2094.220) (-2096.863) (-2097.997) [-2098.619] -- 0:01:39 671000 -- (-2092.701) [-2090.173] (-2098.629) (-2099.569) * (-2095.454) [-2092.252] (-2096.085) (-2098.489) -- 0:01:39 671500 -- (-2093.942) [-2097.288] (-2104.269) (-2098.978) * [-2098.242] (-2091.048) (-2102.500) (-2099.963) -- 0:01:39 672000 -- [-2093.136] (-2094.225) (-2099.650) (-2105.262) * [-2095.291] (-2103.880) (-2094.616) (-2097.262) -- 0:01:39 672500 -- (-2094.381) [-2099.541] (-2103.663) (-2093.480) * [-2094.859] (-2100.772) (-2094.735) (-2093.077) -- 0:01:38 673000 -- [-2090.323] (-2093.719) (-2098.935) (-2095.771) * (-2100.618) [-2098.321] (-2095.279) (-2098.919) -- 0:01:39 673500 -- [-2094.000] (-2094.442) (-2100.695) (-2105.686) * (-2094.204) (-2100.372) (-2092.082) [-2097.067] -- 0:01:38 674000 -- (-2097.027) (-2098.065) (-2102.936) [-2099.693] * (-2096.466) (-2097.244) (-2094.857) [-2091.042] -- 0:01:38 674500 -- (-2092.008) [-2096.643] (-2090.068) (-2101.383) * [-2097.724] (-2097.392) (-2089.776) (-2102.476) -- 0:01:38 675000 -- (-2093.109) [-2095.961] (-2096.744) (-2096.518) * (-2097.835) (-2099.701) [-2093.202] (-2094.825) -- 0:01:38 Average standard deviation of split frequencies: 0.001220 675500 -- [-2090.541] (-2104.720) (-2101.853) (-2097.283) * (-2094.385) (-2094.867) (-2091.086) [-2099.915] -- 0:01:37 676000 -- (-2099.122) (-2100.583) [-2104.864] (-2100.875) * (-2096.223) (-2090.730) (-2092.994) [-2092.325] -- 0:01:37 676500 -- (-2098.848) [-2097.387] (-2101.337) (-2105.191) * (-2108.710) (-2104.322) (-2094.317) [-2096.025] -- 0:01:38 677000 -- [-2095.610] (-2099.994) (-2095.026) (-2104.620) * [-2092.943] (-2099.340) (-2107.961) (-2106.548) -- 0:01:37 677500 -- (-2096.706) (-2099.403) (-2095.947) [-2096.842] * (-2103.084) (-2102.373) [-2099.199] (-2095.851) -- 0:01:37 678000 -- (-2094.267) (-2100.713) (-2095.016) [-2099.716] * (-2106.385) [-2096.629] (-2096.202) (-2096.346) -- 0:01:37 678500 -- [-2093.508] (-2106.166) (-2093.349) (-2097.920) * (-2102.343) (-2096.378) [-2093.929] (-2095.816) -- 0:01:37 679000 -- (-2110.456) [-2097.571] (-2092.569) (-2094.692) * [-2091.850] (-2101.389) (-2102.509) (-2104.685) -- 0:01:36 679500 -- (-2110.245) (-2094.438) (-2102.503) [-2096.018] * (-2097.515) [-2091.859] (-2092.725) (-2098.419) -- 0:01:37 680000 -- [-2104.608] (-2092.940) (-2092.338) (-2092.737) * (-2103.428) [-2096.778] (-2092.500) (-2098.861) -- 0:01:36 Average standard deviation of split frequencies: 0.001212 680500 -- (-2099.021) (-2092.924) [-2093.152] (-2102.217) * (-2096.216) (-2093.541) [-2094.856] (-2094.588) -- 0:01:36 681000 -- [-2097.333] (-2101.015) (-2092.821) (-2098.847) * (-2097.092) [-2095.880] (-2102.404) (-2093.367) -- 0:01:36 681500 -- (-2099.195) (-2099.806) [-2090.048] (-2096.581) * (-2094.794) (-2092.721) (-2095.576) [-2089.286] -- 0:01:36 682000 -- [-2093.901] (-2101.083) (-2095.243) (-2096.063) * [-2095.932] (-2096.256) (-2097.322) (-2094.787) -- 0:01:36 682500 -- (-2098.517) [-2088.889] (-2100.013) (-2097.829) * (-2104.751) (-2099.309) (-2095.366) [-2097.780] -- 0:01:35 683000 -- (-2094.982) (-2101.143) (-2105.179) [-2096.244] * (-2110.394) (-2095.343) [-2104.479] (-2101.646) -- 0:01:36 683500 -- [-2093.983] (-2100.539) (-2100.453) (-2098.847) * (-2108.367) (-2097.677) (-2098.698) [-2090.803] -- 0:01:35 684000 -- [-2096.328] (-2103.213) (-2099.826) (-2094.921) * (-2106.382) (-2094.823) [-2097.970] (-2093.071) -- 0:01:35 684500 -- (-2098.194) [-2092.423] (-2093.059) (-2093.681) * (-2109.516) (-2100.876) (-2099.163) [-2093.880] -- 0:01:35 685000 -- [-2096.477] (-2104.716) (-2090.931) (-2097.934) * (-2103.858) [-2092.495] (-2091.900) (-2091.427) -- 0:01:35 Average standard deviation of split frequencies: 0.001374 685500 -- (-2098.975) (-2095.561) [-2095.260] (-2094.411) * (-2098.420) (-2093.947) (-2096.895) [-2100.941] -- 0:01:34 686000 -- (-2097.088) (-2101.642) (-2091.795) [-2100.400] * (-2098.248) (-2103.069) [-2096.094] (-2095.534) -- 0:01:34 686500 -- (-2097.647) (-2095.306) (-2103.713) [-2101.283] * (-2101.675) (-2098.875) [-2094.832] (-2094.455) -- 0:01:34 687000 -- (-2098.377) (-2093.691) [-2096.111] (-2100.438) * (-2096.450) (-2109.212) [-2097.024] (-2094.465) -- 0:01:34 687500 -- (-2098.201) (-2101.748) [-2094.205] (-2093.932) * (-2095.554) (-2095.494) (-2097.226) [-2098.076] -- 0:01:34 688000 -- (-2099.821) (-2098.876) [-2092.063] (-2101.018) * (-2096.770) (-2097.273) (-2092.944) [-2099.514] -- 0:01:34 688500 -- (-2094.692) (-2095.823) [-2097.439] (-2103.379) * [-2097.083] (-2093.262) (-2093.870) (-2098.652) -- 0:01:34 689000 -- (-2100.709) [-2094.614] (-2105.390) (-2094.151) * [-2092.031] (-2094.041) (-2093.612) (-2103.920) -- 0:01:33 689500 -- (-2107.973) (-2092.486) [-2094.192] (-2092.265) * (-2099.104) (-2093.060) [-2094.212] (-2097.083) -- 0:01:33 690000 -- (-2101.977) [-2091.046] (-2098.589) (-2092.778) * [-2091.473] (-2092.894) (-2096.490) (-2102.692) -- 0:01:33 Average standard deviation of split frequencies: 0.001536 690500 -- (-2095.285) (-2095.942) [-2093.327] (-2095.781) * [-2101.054] (-2096.825) (-2098.708) (-2096.985) -- 0:01:33 691000 -- (-2099.106) (-2096.412) (-2097.661) [-2092.102] * [-2094.789] (-2093.604) (-2091.568) (-2096.289) -- 0:01:33 691500 -- (-2106.998) (-2089.641) (-2093.478) [-2103.441] * (-2094.214) (-2092.724) (-2096.047) [-2091.890] -- 0:01:33 692000 -- (-2098.092) (-2103.505) [-2096.421] (-2100.014) * (-2092.746) (-2095.305) [-2092.125] (-2094.609) -- 0:01:33 692500 -- (-2104.300) (-2097.443) (-2097.559) [-2093.975] * [-2091.944] (-2095.040) (-2099.176) (-2097.791) -- 0:01:32 693000 -- (-2095.921) (-2099.380) (-2102.124) [-2091.672] * (-2091.624) (-2099.658) [-2094.713] (-2104.435) -- 0:01:33 693500 -- (-2099.281) (-2102.882) (-2099.326) [-2092.973] * (-2101.660) (-2099.674) [-2100.255] (-2100.871) -- 0:01:32 694000 -- (-2099.857) [-2094.981] (-2100.397) (-2101.738) * [-2093.151] (-2107.918) (-2106.553) (-2093.763) -- 0:01:32 694500 -- (-2093.180) (-2105.268) (-2103.882) [-2092.160] * (-2099.589) [-2098.082] (-2101.796) (-2101.951) -- 0:01:32 695000 -- [-2091.302] (-2095.636) (-2098.156) (-2094.713) * (-2091.433) (-2096.314) (-2101.920) [-2098.926] -- 0:01:32 Average standard deviation of split frequencies: 0.002032 695500 -- (-2096.588) (-2096.566) (-2104.332) [-2093.763] * [-2098.004] (-2104.173) (-2095.671) (-2094.433) -- 0:01:31 696000 -- (-2093.503) [-2096.551] (-2100.940) (-2100.531) * (-2096.080) (-2108.422) [-2092.618] (-2099.404) -- 0:01:31 696500 -- (-2090.288) [-2097.401] (-2100.465) (-2090.602) * (-2098.700) (-2093.925) [-2093.700] (-2097.622) -- 0:01:31 697000 -- [-2097.859] (-2099.325) (-2103.087) (-2093.165) * (-2095.393) (-2098.307) (-2098.867) [-2096.602] -- 0:01:31 697500 -- (-2103.048) (-2106.926) (-2098.022) [-2095.177] * (-2094.751) [-2091.887] (-2098.938) (-2100.376) -- 0:01:31 698000 -- [-2095.190] (-2092.736) (-2097.916) (-2095.912) * (-2094.147) (-2098.732) [-2092.112] (-2096.571) -- 0:01:31 698500 -- (-2091.108) [-2094.622] (-2097.811) (-2102.981) * [-2093.466] (-2095.975) (-2092.951) (-2101.585) -- 0:01:31 699000 -- (-2094.060) (-2095.019) (-2098.854) [-2099.727] * (-2098.021) (-2101.279) (-2106.455) [-2090.107] -- 0:01:30 699500 -- (-2100.291) [-2095.002] (-2098.276) (-2098.446) * [-2091.318] (-2092.392) (-2098.204) (-2095.291) -- 0:01:30 700000 -- (-2094.230) [-2091.269] (-2103.873) (-2099.853) * [-2095.981] (-2094.118) (-2096.229) (-2096.202) -- 0:01:30 Average standard deviation of split frequencies: 0.002187 700500 -- (-2090.606) (-2095.102) [-2094.686] (-2101.377) * (-2095.631) (-2100.266) (-2097.216) [-2095.063] -- 0:01:30 701000 -- (-2092.459) (-2099.466) [-2099.942] (-2104.218) * (-2105.010) (-2100.063) [-2096.508] (-2094.343) -- 0:01:30 701500 -- [-2098.084] (-2092.928) (-2102.667) (-2102.426) * (-2094.987) (-2093.238) [-2096.994] (-2092.775) -- 0:01:30 702000 -- (-2105.937) [-2095.484] (-2097.682) (-2095.736) * (-2106.891) (-2095.508) [-2098.202] (-2095.330) -- 0:01:29 702500 -- [-2093.648] (-2100.258) (-2101.485) (-2101.954) * [-2097.194] (-2092.717) (-2101.230) (-2098.589) -- 0:01:29 703000 -- (-2103.953) (-2108.054) [-2095.612] (-2096.510) * (-2096.326) (-2099.144) [-2095.557] (-2092.950) -- 0:01:29 703500 -- (-2114.443) [-2094.804] (-2107.095) (-2098.147) * [-2101.364] (-2105.985) (-2092.473) (-2103.649) -- 0:01:29 704000 -- (-2103.510) (-2089.136) [-2097.011] (-2100.203) * (-2098.977) [-2095.907] (-2099.886) (-2099.285) -- 0:01:29 704500 -- [-2096.535] (-2100.214) (-2101.590) (-2090.282) * [-2092.441] (-2097.212) (-2100.328) (-2096.226) -- 0:01:29 705000 -- (-2092.595) (-2100.511) (-2102.149) [-2096.415] * (-2089.695) (-2101.782) [-2092.786] (-2098.537) -- 0:01:29 Average standard deviation of split frequencies: 0.002170 705500 -- (-2089.512) [-2092.704] (-2108.233) (-2102.794) * (-2091.820) (-2092.295) [-2089.070] (-2091.726) -- 0:01:28 706000 -- [-2090.423] (-2099.609) (-2098.171) (-2096.014) * (-2090.206) [-2093.531] (-2099.372) (-2096.865) -- 0:01:28 706500 -- [-2092.144] (-2098.170) (-2100.652) (-2097.874) * (-2099.571) (-2093.622) [-2096.012] (-2101.525) -- 0:01:28 707000 -- (-2093.415) (-2101.393) (-2100.324) [-2094.937] * (-2105.665) (-2095.799) (-2101.346) [-2093.033] -- 0:01:28 707500 -- (-2094.079) [-2091.567] (-2102.975) (-2095.589) * (-2106.196) (-2096.257) (-2095.487) [-2098.813] -- 0:01:28 708000 -- (-2098.808) (-2098.115) [-2094.597] (-2091.932) * [-2093.071] (-2090.618) (-2099.256) (-2097.158) -- 0:01:28 708500 -- (-2094.547) (-2106.906) [-2091.729] (-2098.657) * (-2097.342) [-2094.198] (-2101.903) (-2108.503) -- 0:01:28 709000 -- (-2093.534) (-2094.609) (-2093.497) [-2098.683] * (-2093.362) (-2094.839) [-2095.255] (-2096.585) -- 0:01:27 709500 -- [-2103.329] (-2100.436) (-2103.267) (-2106.617) * [-2098.108] (-2103.941) (-2107.686) (-2099.946) -- 0:01:27 710000 -- (-2110.925) (-2100.240) [-2090.269] (-2098.753) * (-2097.138) [-2100.453] (-2103.160) (-2098.227) -- 0:01:27 Average standard deviation of split frequencies: 0.002322 710500 -- (-2103.228) (-2097.543) [-2099.626] (-2094.445) * (-2098.473) [-2095.518] (-2095.854) (-2091.734) -- 0:01:27 711000 -- (-2098.267) (-2094.320) [-2092.458] (-2098.998) * (-2100.736) [-2095.927] (-2090.865) (-2093.572) -- 0:01:27 711500 -- (-2097.826) (-2101.361) (-2094.348) [-2097.186] * (-2098.857) [-2094.432] (-2100.569) (-2096.619) -- 0:01:27 712000 -- [-2094.849] (-2095.993) (-2092.702) (-2094.975) * [-2089.668] (-2094.081) (-2095.694) (-2093.784) -- 0:01:26 712500 -- [-2102.157] (-2101.119) (-2094.878) (-2093.548) * (-2103.522) [-2096.977] (-2092.568) (-2099.261) -- 0:01:26 713000 -- [-2097.736] (-2099.595) (-2092.358) (-2098.581) * [-2090.751] (-2094.334) (-2101.470) (-2091.969) -- 0:01:26 713500 -- (-2101.430) [-2093.781] (-2093.257) (-2096.589) * [-2100.262] (-2096.030) (-2109.732) (-2105.115) -- 0:01:26 714000 -- (-2102.558) (-2100.326) (-2094.071) [-2095.874] * (-2095.796) (-2110.070) (-2089.381) [-2093.909] -- 0:01:26 714500 -- (-2096.978) (-2096.696) [-2092.047] (-2099.332) * (-2091.636) (-2095.112) [-2099.760] (-2095.751) -- 0:01:26 715000 -- (-2096.164) (-2103.520) [-2091.888] (-2097.215) * (-2095.986) (-2094.189) [-2096.146] (-2096.252) -- 0:01:26 Average standard deviation of split frequencies: 0.002304 715500 -- (-2098.284) (-2095.228) [-2103.271] (-2095.824) * (-2113.511) (-2103.220) (-2094.846) [-2100.063] -- 0:01:25 716000 -- (-2093.832) (-2095.726) (-2102.045) [-2097.978] * [-2098.546] (-2098.492) (-2097.692) (-2094.515) -- 0:01:25 716500 -- (-2098.509) [-2095.114] (-2097.817) (-2102.245) * (-2094.773) [-2097.300] (-2096.303) (-2096.654) -- 0:01:25 717000 -- [-2089.172] (-2094.387) (-2090.721) (-2096.849) * (-2097.193) (-2104.630) [-2092.921] (-2092.435) -- 0:01:25 717500 -- (-2093.114) (-2091.319) [-2100.364] (-2109.591) * (-2103.627) (-2095.329) (-2095.708) [-2096.517] -- 0:01:25 718000 -- (-2094.676) (-2103.701) [-2096.143] (-2100.919) * (-2093.788) (-2105.071) [-2096.108] (-2097.606) -- 0:01:25 718500 -- (-2094.339) (-2107.191) (-2093.416) [-2101.083] * [-2097.170] (-2101.400) (-2091.764) (-2093.093) -- 0:01:25 719000 -- (-2098.023) (-2098.368) (-2098.271) [-2100.658] * (-2099.903) (-2098.802) (-2100.368) [-2095.387] -- 0:01:24 719500 -- (-2100.110) (-2096.238) [-2098.651] (-2098.372) * (-2096.983) (-2094.558) (-2103.140) [-2094.759] -- 0:01:24 720000 -- (-2093.890) (-2103.973) [-2099.094] (-2094.864) * [-2097.522] (-2091.419) (-2099.448) (-2098.554) -- 0:01:24 Average standard deviation of split frequencies: 0.002453 720500 -- [-2091.733] (-2100.910) (-2092.354) (-2095.995) * [-2099.522] (-2098.577) (-2097.402) (-2096.425) -- 0:01:24 721000 -- (-2098.992) (-2093.763) (-2099.549) [-2095.765] * (-2100.175) (-2093.872) [-2093.171] (-2095.607) -- 0:01:24 721500 -- (-2096.464) (-2101.021) (-2092.504) [-2092.651] * (-2094.629) [-2091.493] (-2097.691) (-2094.161) -- 0:01:24 722000 -- (-2103.552) (-2095.367) [-2101.216] (-2097.352) * [-2093.944] (-2090.946) (-2100.485) (-2092.891) -- 0:01:23 722500 -- [-2096.379] (-2100.054) (-2098.839) (-2092.023) * (-2096.727) [-2093.427] (-2097.310) (-2095.771) -- 0:01:23 723000 -- (-2097.803) (-2101.480) [-2097.541] (-2105.100) * (-2097.794) [-2094.099] (-2097.144) (-2094.763) -- 0:01:23 723500 -- (-2101.961) [-2095.937] (-2092.204) (-2094.990) * (-2102.496) [-2092.007] (-2105.240) (-2099.042) -- 0:01:23 724000 -- (-2103.546) (-2099.058) (-2093.304) [-2091.732] * [-2096.694] (-2094.113) (-2101.919) (-2095.636) -- 0:01:23 724500 -- (-2101.462) [-2103.658] (-2093.777) (-2102.561) * [-2097.227] (-2103.976) (-2091.043) (-2093.685) -- 0:01:23 725000 -- (-2097.463) [-2095.933] (-2097.512) (-2095.390) * (-2100.608) [-2092.811] (-2095.157) (-2091.919) -- 0:01:23 Average standard deviation of split frequencies: 0.002597 725500 -- [-2101.038] (-2093.847) (-2096.378) (-2093.263) * (-2096.192) (-2089.895) (-2104.404) [-2095.737] -- 0:01:22 726000 -- (-2100.084) (-2102.618) (-2095.728) [-2094.944] * (-2103.194) (-2094.074) (-2098.834) [-2095.874] -- 0:01:22 726500 -- (-2098.386) [-2094.744] (-2091.810) (-2113.435) * (-2103.195) (-2099.420) (-2098.232) [-2094.712] -- 0:01:22 727000 -- (-2106.898) [-2095.962] (-2097.638) (-2102.249) * (-2098.185) [-2105.691] (-2102.037) (-2096.476) -- 0:01:22 727500 -- [-2098.165] (-2092.700) (-2100.232) (-2091.841) * (-2098.577) (-2100.989) (-2090.258) [-2098.279] -- 0:01:22 728000 -- (-2095.007) (-2098.649) (-2098.007) [-2091.096] * (-2093.414) [-2096.318] (-2094.823) (-2097.315) -- 0:01:22 728500 -- (-2103.615) (-2096.321) [-2095.973] (-2101.300) * [-2100.259] (-2099.512) (-2094.654) (-2093.986) -- 0:01:21 729000 -- (-2098.965) [-2094.289] (-2099.953) (-2094.221) * (-2097.748) (-2100.413) (-2091.959) [-2092.462] -- 0:01:21 729500 -- [-2100.921] (-2091.263) (-2109.478) (-2099.068) * (-2095.020) (-2097.897) (-2095.738) [-2097.641] -- 0:01:21 730000 -- [-2096.765] (-2094.173) (-2100.387) (-2093.565) * (-2097.456) (-2101.912) [-2091.743] (-2095.565) -- 0:01:21 Average standard deviation of split frequencies: 0.002097 730500 -- (-2093.114) (-2094.398) [-2095.438] (-2094.454) * (-2096.894) [-2101.240] (-2092.093) (-2098.233) -- 0:01:21 731000 -- (-2095.708) (-2095.862) [-2103.352] (-2094.717) * (-2095.697) (-2102.066) [-2091.492] (-2096.250) -- 0:01:21 731500 -- (-2092.493) (-2091.114) (-2098.518) [-2090.667] * [-2099.361] (-2101.655) (-2099.599) (-2093.938) -- 0:01:21 732000 -- (-2096.840) [-2093.377] (-2100.110) (-2097.063) * (-2095.010) (-2100.835) [-2091.887] (-2095.637) -- 0:01:20 732500 -- (-2103.336) (-2095.997) [-2093.267] (-2097.093) * [-2097.158] (-2096.554) (-2097.207) (-2099.527) -- 0:01:20 733000 -- (-2093.215) [-2097.211] (-2095.783) (-2101.879) * (-2098.826) (-2098.335) (-2103.274) [-2099.093] -- 0:01:20 733500 -- (-2094.454) (-2089.420) [-2094.028] (-2104.600) * (-2096.985) (-2101.719) (-2097.325) [-2095.772] -- 0:01:20 734000 -- [-2095.398] (-2095.546) (-2097.896) (-2100.582) * (-2102.461) [-2090.043] (-2100.876) (-2093.189) -- 0:01:20 734500 -- (-2097.212) (-2091.217) (-2092.056) [-2092.759] * (-2105.066) (-2089.463) [-2099.404] (-2100.543) -- 0:01:20 735000 -- (-2097.910) (-2098.737) (-2098.297) [-2090.829] * (-2097.466) [-2090.371] (-2103.245) (-2104.468) -- 0:01:20 Average standard deviation of split frequencies: 0.001921 735500 -- [-2098.022] (-2105.740) (-2105.648) (-2090.418) * (-2095.044) [-2090.641] (-2093.211) (-2096.031) -- 0:01:19 736000 -- [-2094.533] (-2100.363) (-2096.925) (-2096.540) * (-2101.896) (-2099.305) [-2100.389] (-2093.143) -- 0:01:19 736500 -- (-2100.390) [-2098.556] (-2101.397) (-2094.872) * (-2093.899) (-2094.728) [-2098.523] (-2092.350) -- 0:01:19 737000 -- [-2094.186] (-2097.094) (-2095.213) (-2101.333) * (-2100.631) (-2098.716) (-2101.190) [-2097.172] -- 0:01:19 737500 -- [-2097.474] (-2090.860) (-2097.624) (-2101.789) * [-2100.334] (-2102.259) (-2091.388) (-2095.157) -- 0:01:19 738000 -- (-2096.836) [-2100.413] (-2096.576) (-2101.013) * (-2095.526) [-2103.509] (-2100.296) (-2097.358) -- 0:01:19 738500 -- (-2096.033) (-2098.090) (-2097.624) [-2102.111] * [-2093.776] (-2096.004) (-2093.421) (-2100.326) -- 0:01:18 739000 -- (-2100.642) (-2108.714) [-2098.806] (-2094.768) * (-2095.641) (-2093.673) [-2091.543] (-2100.032) -- 0:01:18 739500 -- (-2098.665) (-2101.122) [-2096.415] (-2097.280) * (-2102.514) [-2092.756] (-2090.169) (-2099.134) -- 0:01:18 740000 -- (-2101.566) [-2098.385] (-2101.746) (-2095.816) * (-2099.192) [-2095.572] (-2095.977) (-2091.502) -- 0:01:18 Average standard deviation of split frequencies: 0.002546 740500 -- (-2096.446) (-2097.955) (-2089.146) [-2100.647] * (-2094.656) [-2094.809] (-2093.848) (-2094.010) -- 0:01:18 741000 -- (-2097.096) [-2092.017] (-2095.999) (-2097.849) * (-2095.879) [-2097.175] (-2095.353) (-2097.963) -- 0:01:18 741500 -- (-2093.186) (-2094.866) (-2093.278) [-2090.368] * [-2091.930] (-2096.141) (-2100.674) (-2099.014) -- 0:01:18 742000 -- (-2097.326) (-2095.011) (-2100.311) [-2091.271] * [-2098.505] (-2098.915) (-2099.723) (-2102.219) -- 0:01:17 742500 -- [-2092.383] (-2097.487) (-2094.576) (-2099.718) * (-2101.426) (-2102.716) [-2100.056] (-2100.833) -- 0:01:17 743000 -- (-2095.936) [-2095.386] (-2096.710) (-2097.946) * [-2094.270] (-2100.670) (-2097.372) (-2096.659) -- 0:01:17 743500 -- (-2096.068) (-2097.884) (-2099.041) [-2097.205] * [-2102.811] (-2095.124) (-2098.482) (-2096.006) -- 0:01:17 744000 -- (-2100.934) (-2092.788) [-2094.364] (-2107.444) * (-2097.687) (-2098.673) [-2097.294] (-2094.225) -- 0:01:17 744500 -- [-2092.113] (-2101.458) (-2094.497) (-2100.015) * (-2098.298) (-2102.346) [-2096.282] (-2100.302) -- 0:01:17 745000 -- (-2092.347) [-2089.632] (-2101.768) (-2093.903) * (-2096.935) (-2096.423) (-2096.989) [-2091.297] -- 0:01:17 Average standard deviation of split frequencies: 0.002370 745500 -- (-2093.165) (-2091.618) (-2100.688) [-2097.250] * (-2093.809) (-2104.419) (-2102.133) [-2098.436] -- 0:01:16 746000 -- (-2095.590) [-2095.871] (-2099.444) (-2095.776) * (-2092.459) (-2094.912) (-2107.057) [-2095.257] -- 0:01:16 746500 -- (-2103.250) [-2098.151] (-2099.949) (-2095.729) * (-2098.637) (-2103.813) (-2098.128) [-2099.262] -- 0:01:16 747000 -- (-2093.170) (-2094.869) [-2091.454] (-2094.973) * (-2099.098) (-2105.024) (-2111.692) [-2102.513] -- 0:01:16 747500 -- (-2095.822) (-2094.428) (-2090.671) [-2094.149] * (-2092.854) (-2101.164) (-2094.531) [-2094.327] -- 0:01:16 748000 -- (-2105.549) (-2094.568) [-2092.004] (-2101.093) * [-2093.757] (-2100.703) (-2098.345) (-2098.064) -- 0:01:16 748500 -- (-2099.398) [-2097.431] (-2096.198) (-2094.740) * [-2097.614] (-2104.325) (-2097.013) (-2098.230) -- 0:01:15 749000 -- (-2103.269) (-2095.220) (-2099.247) [-2093.576] * (-2104.464) (-2094.348) [-2093.976] (-2101.301) -- 0:01:15 749500 -- [-2098.706] (-2096.541) (-2096.170) (-2097.236) * (-2105.052) [-2096.665] (-2092.188) (-2100.438) -- 0:01:15 750000 -- (-2095.093) (-2096.506) (-2093.685) [-2092.405] * (-2107.571) [-2096.746] (-2095.900) (-2102.227) -- 0:01:15 Average standard deviation of split frequencies: 0.002512 750500 -- [-2091.983] (-2096.370) (-2095.623) (-2098.979) * (-2096.852) (-2091.694) [-2095.088] (-2094.265) -- 0:01:15 751000 -- [-2098.083] (-2088.111) (-2107.812) (-2103.985) * (-2091.010) (-2095.672) [-2099.209] (-2090.396) -- 0:01:15 751500 -- (-2098.517) [-2095.843] (-2105.190) (-2097.440) * (-2095.084) (-2103.744) [-2095.019] (-2097.914) -- 0:01:15 752000 -- (-2099.472) [-2097.260] (-2101.604) (-2107.515) * [-2094.122] (-2100.576) (-2089.708) (-2095.939) -- 0:01:14 752500 -- (-2092.209) [-2099.758] (-2095.470) (-2093.497) * (-2094.643) (-2096.637) (-2094.549) [-2092.617] -- 0:01:14 753000 -- (-2093.002) [-2098.928] (-2098.346) (-2094.204) * (-2096.820) [-2098.703] (-2104.806) (-2095.995) -- 0:01:14 753500 -- (-2095.930) (-2100.473) [-2092.539] (-2100.662) * (-2093.511) (-2098.619) (-2102.818) [-2091.995] -- 0:01:14 754000 -- (-2098.058) (-2093.255) (-2091.965) [-2097.149] * (-2093.658) (-2094.737) (-2097.892) [-2102.290] -- 0:01:14 754500 -- (-2088.092) (-2099.027) (-2103.182) [-2093.517] * (-2094.628) [-2094.643] (-2099.211) (-2099.847) -- 0:01:14 755000 -- (-2092.886) (-2099.133) [-2098.343] (-2095.796) * (-2104.881) (-2099.824) (-2092.492) [-2095.974] -- 0:01:13 Average standard deviation of split frequencies: 0.002182 755500 -- (-2095.876) [-2101.466] (-2108.753) (-2103.946) * (-2095.780) (-2100.558) (-2096.571) [-2095.622] -- 0:01:13 756000 -- (-2090.002) (-2096.157) (-2107.990) [-2095.428] * (-2110.153) (-2093.842) (-2099.044) [-2098.304] -- 0:01:13 756500 -- (-2092.983) [-2100.445] (-2088.827) (-2097.559) * (-2097.760) (-2094.520) (-2092.480) [-2097.053] -- 0:01:13 757000 -- (-2097.319) (-2094.626) [-2091.617] (-2099.324) * (-2100.603) (-2104.207) [-2092.531] (-2100.850) -- 0:01:13 757500 -- (-2094.904) (-2099.528) [-2093.111] (-2101.013) * (-2104.490) (-2094.885) [-2095.921] (-2103.945) -- 0:01:13 758000 -- [-2094.517] (-2109.431) (-2099.149) (-2104.190) * (-2099.739) [-2094.056] (-2095.326) (-2102.541) -- 0:01:13 758500 -- [-2095.056] (-2107.605) (-2095.406) (-2101.251) * (-2110.182) (-2092.547) (-2089.108) [-2098.288] -- 0:01:12 759000 -- (-2092.938) (-2106.137) (-2094.134) [-2095.016] * (-2098.512) [-2096.111] (-2095.329) (-2103.271) -- 0:01:12 759500 -- (-2101.627) [-2092.348] (-2100.325) (-2095.646) * (-2092.413) [-2098.389] (-2095.451) (-2098.395) -- 0:01:12 760000 -- (-2097.559) (-2091.453) (-2092.949) [-2093.899] * (-2093.037) (-2096.617) [-2094.048] (-2096.143) -- 0:01:12 Average standard deviation of split frequencies: 0.001859 760500 -- (-2094.439) (-2095.425) [-2094.627] (-2100.974) * (-2095.640) (-2095.847) [-2094.610] (-2095.451) -- 0:01:12 761000 -- (-2098.181) (-2098.008) [-2094.567] (-2092.707) * (-2096.684) (-2091.960) (-2092.703) [-2098.837] -- 0:01:12 761500 -- (-2094.287) (-2096.685) (-2095.890) [-2092.772] * (-2098.541) (-2099.632) (-2097.155) [-2100.798] -- 0:01:12 762000 -- (-2100.467) [-2097.132] (-2090.725) (-2095.158) * (-2093.439) [-2093.990] (-2095.551) (-2096.537) -- 0:01:11 762500 -- (-2108.181) (-2107.025) [-2095.405] (-2094.863) * [-2096.639] (-2099.582) (-2096.495) (-2102.337) -- 0:01:11 763000 -- [-2098.255] (-2104.148) (-2104.404) (-2098.984) * (-2100.408) (-2107.540) [-2096.887] (-2097.117) -- 0:01:11 763500 -- (-2092.118) (-2093.656) (-2094.866) [-2091.437] * (-2100.018) (-2103.560) [-2094.455] (-2103.004) -- 0:01:11 764000 -- [-2094.540] (-2102.016) (-2103.724) (-2097.656) * (-2093.991) (-2100.326) (-2095.246) [-2097.086] -- 0:01:11 764500 -- [-2089.793] (-2103.418) (-2091.810) (-2091.249) * (-2098.019) (-2102.334) (-2098.419) [-2099.839] -- 0:01:11 765000 -- (-2095.901) (-2098.503) [-2098.156] (-2096.587) * (-2100.204) (-2096.050) (-2108.843) [-2099.761] -- 0:01:10 Average standard deviation of split frequencies: 0.001231 765500 -- (-2093.984) [-2099.236] (-2094.904) (-2096.173) * (-2106.370) [-2090.564] (-2096.030) (-2096.187) -- 0:01:10 766000 -- (-2097.459) (-2097.915) (-2098.219) [-2098.651] * (-2096.846) (-2096.210) (-2098.447) [-2096.306] -- 0:01:10 766500 -- (-2097.667) (-2101.245) (-2101.312) [-2091.682] * (-2103.473) [-2092.663] (-2093.931) (-2106.583) -- 0:01:10 767000 -- (-2090.285) (-2096.914) [-2092.902] (-2096.906) * (-2104.394) (-2093.609) (-2098.007) [-2096.348] -- 0:01:10 767500 -- (-2098.478) (-2101.307) (-2101.114) [-2101.260] * (-2105.304) (-2097.681) [-2092.132] (-2097.815) -- 0:01:10 768000 -- (-2100.763) [-2101.536] (-2097.960) (-2093.446) * (-2092.523) (-2094.050) [-2093.135] (-2095.738) -- 0:01:10 768500 -- (-2098.090) [-2094.648] (-2093.979) (-2089.325) * (-2102.709) (-2092.751) (-2103.609) [-2096.172] -- 0:01:09 769000 -- [-2099.196] (-2094.064) (-2098.861) (-2096.455) * (-2104.887) (-2098.360) (-2096.316) [-2094.598] -- 0:01:09 769500 -- [-2090.959] (-2099.406) (-2098.981) (-2097.082) * (-2104.854) [-2088.280] (-2102.642) (-2094.817) -- 0:01:09 770000 -- (-2107.311) (-2096.357) (-2100.114) [-2092.876] * [-2096.897] (-2099.471) (-2094.336) (-2091.764) -- 0:01:09 Average standard deviation of split frequencies: 0.001529 770500 -- (-2102.579) (-2096.401) (-2101.452) [-2099.595] * (-2099.941) [-2096.448] (-2092.218) (-2101.853) -- 0:01:09 771000 -- (-2099.713) [-2095.214] (-2099.493) (-2095.370) * (-2096.743) [-2100.876] (-2110.010) (-2090.409) -- 0:01:09 771500 -- (-2105.037) (-2102.875) [-2091.637] (-2096.146) * (-2095.843) [-2101.157] (-2108.123) (-2103.923) -- 0:01:09 772000 -- (-2096.961) (-2096.004) [-2094.617] (-2094.638) * (-2100.768) (-2111.055) [-2100.485] (-2101.955) -- 0:01:08 772500 -- (-2098.937) (-2096.277) [-2092.913] (-2092.143) * (-2099.544) (-2097.953) [-2101.799] (-2103.075) -- 0:01:08 773000 -- [-2098.193] (-2096.793) (-2096.197) (-2096.809) * [-2091.616] (-2104.101) (-2097.021) (-2092.637) -- 0:01:08 773500 -- (-2101.452) (-2101.046) (-2099.113) [-2093.528] * (-2093.296) [-2091.970] (-2098.936) (-2095.816) -- 0:01:08 774000 -- (-2100.153) (-2092.020) [-2092.106] (-2102.982) * (-2098.563) (-2098.602) (-2094.983) [-2092.948] -- 0:01:08 774500 -- (-2091.830) (-2098.544) [-2092.571] (-2097.613) * (-2106.707) (-2103.578) [-2095.774] (-2094.198) -- 0:01:08 775000 -- (-2104.356) [-2093.966] (-2100.988) (-2099.956) * (-2096.887) (-2094.402) (-2098.352) [-2093.786] -- 0:01:07 Average standard deviation of split frequencies: 0.000911 775500 -- (-2103.458) (-2091.066) [-2097.931] (-2104.656) * (-2105.455) [-2091.638] (-2089.872) (-2099.698) -- 0:01:07 776000 -- (-2099.885) [-2092.356] (-2094.957) (-2097.707) * (-2103.050) (-2096.349) (-2095.814) [-2093.399] -- 0:01:07 776500 -- (-2097.613) (-2096.795) (-2097.786) [-2095.450] * (-2094.744) (-2096.303) (-2093.531) [-2097.234] -- 0:01:07 777000 -- (-2104.035) (-2098.310) (-2092.960) [-2090.853] * (-2102.369) (-2098.701) [-2088.068] (-2094.798) -- 0:01:07 777500 -- (-2096.550) (-2094.635) [-2097.555] (-2091.986) * (-2094.535) (-2095.633) (-2105.421) [-2089.014] -- 0:01:07 778000 -- (-2096.980) [-2096.329] (-2101.103) (-2095.999) * (-2103.908) (-2104.239) (-2096.308) [-2094.520] -- 0:01:07 778500 -- (-2091.558) (-2097.956) (-2102.916) [-2100.805] * (-2097.726) (-2096.223) (-2097.390) [-2096.569] -- 0:01:06 779000 -- [-2097.420] (-2094.244) (-2098.622) (-2099.061) * (-2099.608) [-2093.786] (-2103.786) (-2102.540) -- 0:01:06 779500 -- [-2094.503] (-2110.412) (-2098.027) (-2100.691) * (-2097.317) (-2093.388) (-2097.303) [-2089.190] -- 0:01:06 780000 -- (-2093.963) (-2097.154) [-2099.814] (-2113.764) * (-2098.889) [-2095.813] (-2096.234) (-2102.569) -- 0:01:06 Average standard deviation of split frequencies: 0.001510 780500 -- (-2093.909) [-2098.473] (-2099.568) (-2100.849) * (-2090.235) (-2095.658) (-2102.699) [-2094.264] -- 0:01:06 781000 -- (-2096.302) (-2092.637) (-2109.093) [-2092.938] * (-2095.635) [-2096.911] (-2103.344) (-2098.350) -- 0:01:06 781500 -- (-2091.703) (-2094.640) (-2097.039) [-2096.563] * [-2093.707] (-2093.272) (-2109.698) (-2098.180) -- 0:01:05 782000 -- (-2093.784) [-2097.686] (-2095.119) (-2094.535) * (-2097.433) (-2094.204) (-2095.128) [-2092.232] -- 0:01:05 782500 -- (-2095.963) (-2094.687) (-2101.808) [-2097.128] * (-2103.032) [-2093.063] (-2091.793) (-2092.508) -- 0:01:05 783000 -- [-2091.851] (-2101.916) (-2092.199) (-2111.819) * [-2098.910] (-2091.909) (-2094.494) (-2099.643) -- 0:01:05 783500 -- (-2100.715) (-2099.983) (-2098.067) [-2094.075] * (-2088.841) [-2097.992] (-2094.258) (-2092.196) -- 0:01:05 784000 -- (-2099.909) (-2090.322) (-2104.351) [-2097.123] * [-2091.678] (-2096.039) (-2110.965) (-2101.226) -- 0:01:05 784500 -- (-2094.214) [-2096.346] (-2100.779) (-2101.821) * (-2102.930) (-2095.105) (-2102.832) [-2099.178] -- 0:01:05 785000 -- [-2091.864] (-2100.247) (-2100.682) (-2096.751) * [-2104.072] (-2097.451) (-2108.766) (-2094.451) -- 0:01:04 Average standard deviation of split frequencies: 0.001349 785500 -- [-2090.297] (-2099.964) (-2102.950) (-2100.063) * (-2092.788) (-2094.013) [-2098.897] (-2094.834) -- 0:01:04 786000 -- (-2100.218) (-2101.563) [-2096.977] (-2098.215) * (-2097.579) [-2091.370] (-2103.100) (-2098.995) -- 0:01:04 786500 -- [-2100.630] (-2100.838) (-2097.345) (-2095.814) * (-2097.245) (-2099.092) [-2097.152] (-2096.454) -- 0:01:04 787000 -- (-2099.025) (-2110.581) [-2099.137] (-2097.627) * (-2105.662) (-2091.453) [-2094.700] (-2096.324) -- 0:01:04 787500 -- (-2100.295) [-2096.347] (-2101.312) (-2102.620) * (-2102.181) [-2098.033] (-2094.560) (-2098.916) -- 0:01:04 788000 -- (-2095.123) [-2098.740] (-2095.181) (-2094.168) * (-2093.479) [-2097.988] (-2097.453) (-2095.358) -- 0:01:04 788500 -- (-2094.845) (-2100.608) [-2093.921] (-2097.609) * [-2092.979] (-2089.493) (-2102.201) (-2108.947) -- 0:01:03 789000 -- [-2089.582] (-2092.384) (-2104.853) (-2099.451) * (-2100.193) [-2092.787] (-2103.625) (-2102.020) -- 0:01:03 789500 -- (-2096.976) (-2102.008) (-2096.896) [-2096.868] * (-2111.480) (-2095.612) [-2100.542] (-2103.375) -- 0:01:03 790000 -- (-2101.740) (-2096.164) [-2096.661] (-2098.486) * (-2105.342) (-2094.728) [-2097.771] (-2094.198) -- 0:01:03 Average standard deviation of split frequencies: 0.001491 790500 -- (-2099.316) [-2095.810] (-2096.454) (-2093.657) * (-2104.708) (-2093.667) [-2099.800] (-2098.948) -- 0:01:03 791000 -- [-2091.578] (-2105.680) (-2100.071) (-2097.988) * (-2095.706) [-2096.007] (-2104.047) (-2095.232) -- 0:01:03 791500 -- [-2103.773] (-2100.623) (-2092.654) (-2093.439) * (-2100.311) (-2101.384) (-2102.869) [-2093.726] -- 0:01:02 792000 -- [-2094.784] (-2098.249) (-2095.535) (-2092.724) * (-2102.404) (-2099.764) [-2096.603] (-2103.169) -- 0:01:02 792500 -- [-2096.014] (-2095.912) (-2100.935) (-2094.510) * [-2096.402] (-2092.248) (-2090.586) (-2102.797) -- 0:01:02 793000 -- (-2095.629) [-2091.532] (-2104.677) (-2091.549) * (-2091.183) (-2103.400) (-2099.106) [-2096.175] -- 0:01:02 793500 -- [-2095.615] (-2091.284) (-2098.534) (-2096.067) * (-2099.567) [-2092.439] (-2106.089) (-2092.412) -- 0:01:02 794000 -- (-2099.023) [-2095.424] (-2098.175) (-2091.233) * (-2094.851) (-2091.340) [-2095.610] (-2100.681) -- 0:01:02 794500 -- (-2094.740) (-2104.586) (-2101.686) [-2093.456] * (-2097.944) (-2118.472) (-2093.550) [-2100.846] -- 0:01:02 795000 -- (-2089.993) (-2094.655) [-2098.957] (-2096.805) * (-2094.881) (-2096.706) [-2095.894] (-2100.950) -- 0:01:01 Average standard deviation of split frequencies: 0.001481 795500 -- (-2092.817) (-2098.178) (-2096.071) [-2098.093] * (-2094.946) [-2096.202] (-2091.219) (-2095.619) -- 0:01:01 796000 -- (-2110.914) (-2101.998) [-2095.330] (-2096.124) * (-2101.995) [-2095.443] (-2096.464) (-2099.309) -- 0:01:01 796500 -- (-2093.062) (-2100.131) [-2094.912] (-2092.988) * [-2090.984] (-2098.942) (-2097.148) (-2100.445) -- 0:01:01 797000 -- (-2102.535) (-2103.808) (-2096.607) [-2099.021] * (-2100.164) (-2093.961) (-2096.794) [-2100.121] -- 0:01:01 797500 -- [-2091.146] (-2101.673) (-2104.778) (-2091.925) * (-2094.117) [-2099.126] (-2095.040) (-2094.532) -- 0:01:01 798000 -- (-2094.796) [-2096.300] (-2096.267) (-2098.376) * [-2091.948] (-2097.645) (-2105.187) (-2105.151) -- 0:01:01 798500 -- (-2096.964) (-2092.916) [-2096.708] (-2097.535) * [-2099.265] (-2098.317) (-2090.212) (-2102.331) -- 0:01:00 799000 -- (-2097.259) [-2095.794] (-2094.897) (-2107.112) * [-2092.827] (-2093.690) (-2090.228) (-2095.129) -- 0:01:00 799500 -- (-2091.399) [-2091.440] (-2101.287) (-2100.576) * (-2099.621) (-2099.711) [-2097.790] (-2100.942) -- 0:01:00 800000 -- (-2104.470) [-2091.848] (-2096.933) (-2102.913) * (-2099.555) (-2097.365) [-2100.503] (-2095.462) -- 0:01:00 Average standard deviation of split frequencies: 0.001178 800500 -- (-2105.344) (-2097.540) (-2098.579) [-2094.136] * (-2098.232) [-2098.005] (-2092.942) (-2092.789) -- 0:01:00 801000 -- (-2098.528) [-2093.840] (-2096.556) (-2098.365) * (-2101.150) [-2103.163] (-2099.989) (-2093.186) -- 0:01:00 801500 -- [-2095.244] (-2098.782) (-2110.719) (-2100.730) * [-2097.811] (-2093.486) (-2091.759) (-2101.338) -- 0:00:59 802000 -- (-2096.693) [-2095.052] (-2099.566) (-2097.816) * [-2095.180] (-2092.749) (-2090.788) (-2097.821) -- 0:00:59 802500 -- (-2095.103) (-2108.604) (-2093.977) [-2094.524] * (-2097.979) [-2095.452] (-2098.181) (-2101.012) -- 0:00:59 803000 -- [-2096.898] (-2098.555) (-2093.099) (-2095.503) * [-2095.068] (-2095.482) (-2095.508) (-2099.037) -- 0:00:59 803500 -- (-2091.225) (-2100.313) (-2095.927) [-2098.363] * (-2094.817) (-2093.115) (-2096.339) [-2093.807] -- 0:00:59 804000 -- [-2093.260] (-2093.864) (-2100.073) (-2094.650) * [-2096.496] (-2097.013) (-2096.497) (-2096.573) -- 0:00:59 804500 -- (-2098.005) [-2105.793] (-2090.066) (-2093.418) * [-2097.569] (-2099.188) (-2099.411) (-2098.364) -- 0:00:59 805000 -- [-2093.620] (-2106.641) (-2107.012) (-2096.538) * (-2091.012) (-2099.645) (-2096.768) [-2095.970] -- 0:00:58 Average standard deviation of split frequencies: 0.001024 805500 -- (-2096.845) [-2101.442] (-2104.070) (-2100.287) * (-2113.873) [-2101.235] (-2101.066) (-2096.926) -- 0:00:58 806000 -- [-2097.201] (-2101.724) (-2100.671) (-2102.715) * [-2097.291] (-2096.408) (-2093.731) (-2102.386) -- 0:00:58 806500 -- (-2092.276) (-2104.406) (-2095.467) [-2097.825] * (-2097.105) (-2098.804) (-2093.343) [-2095.165] -- 0:00:58 807000 -- [-2090.171] (-2094.695) (-2095.412) (-2092.448) * [-2094.507] (-2098.939) (-2107.940) (-2095.371) -- 0:00:58 807500 -- (-2100.651) (-2094.302) (-2093.289) [-2093.362] * [-2091.641] (-2100.983) (-2094.814) (-2096.502) -- 0:00:58 808000 -- (-2097.198) (-2094.535) [-2096.713] (-2099.288) * (-2095.255) (-2095.134) (-2094.947) [-2092.112] -- 0:00:57 808500 -- (-2101.330) (-2099.794) (-2101.934) [-2094.098] * [-2091.997] (-2100.219) (-2095.268) (-2096.877) -- 0:00:57 809000 -- [-2094.966] (-2100.544) (-2098.431) (-2095.417) * [-2094.267] (-2098.953) (-2094.700) (-2100.644) -- 0:00:57 809500 -- (-2099.090) (-2093.584) [-2095.195] (-2094.535) * (-2103.546) (-2093.892) [-2097.230] (-2095.686) -- 0:00:57 810000 -- (-2096.690) [-2090.162] (-2097.604) (-2097.771) * (-2095.371) (-2101.903) (-2094.943) [-2103.622] -- 0:00:57 Average standard deviation of split frequencies: 0.000727 810500 -- (-2092.317) (-2102.758) (-2093.234) [-2089.332] * (-2091.898) (-2103.630) (-2105.997) [-2096.955] -- 0:00:57 811000 -- (-2098.150) (-2092.550) (-2092.092) [-2092.717] * [-2092.536] (-2093.149) (-2094.371) (-2101.163) -- 0:00:57 811500 -- (-2101.544) [-2098.403] (-2092.668) (-2094.315) * (-2092.157) (-2092.066) [-2102.738] (-2094.732) -- 0:00:56 812000 -- (-2097.285) [-2099.607] (-2097.748) (-2095.336) * (-2093.470) (-2098.275) [-2098.644] (-2097.477) -- 0:00:56 812500 -- (-2101.213) (-2099.830) (-2093.965) [-2093.349] * [-2093.561] (-2103.277) (-2097.754) (-2099.548) -- 0:00:56 813000 -- (-2102.306) [-2097.428] (-2106.613) (-2093.082) * (-2092.868) [-2104.444] (-2095.802) (-2097.695) -- 0:00:56 813500 -- (-2110.377) (-2097.165) (-2096.495) [-2102.947] * (-2098.800) (-2103.130) [-2093.594] (-2099.115) -- 0:00:56 814000 -- (-2099.673) (-2099.106) [-2100.833] (-2093.740) * (-2096.085) (-2096.750) [-2096.607] (-2100.878) -- 0:00:56 814500 -- [-2099.664] (-2101.123) (-2101.278) (-2093.218) * (-2098.609) [-2092.941] (-2094.772) (-2101.097) -- 0:00:56 815000 -- (-2096.445) (-2102.224) (-2099.446) [-2093.527] * (-2094.720) (-2091.060) [-2097.046] (-2097.242) -- 0:00:55 Average standard deviation of split frequencies: 0.000433 815500 -- (-2094.948) (-2105.315) [-2096.409] (-2100.109) * [-2097.030] (-2100.738) (-2098.242) (-2095.102) -- 0:00:55 816000 -- [-2097.203] (-2099.050) (-2094.031) (-2100.424) * (-2096.137) (-2098.661) (-2096.979) [-2094.535] -- 0:00:55 816500 -- (-2097.564) (-2094.021) [-2088.664] (-2102.647) * [-2096.920] (-2102.585) (-2098.245) (-2091.215) -- 0:00:55 817000 -- (-2094.608) [-2099.436] (-2099.008) (-2101.106) * (-2095.637) [-2095.054] (-2092.083) (-2095.306) -- 0:00:55 817500 -- [-2097.417] (-2101.161) (-2103.744) (-2104.032) * (-2094.906) (-2095.515) (-2100.813) [-2096.011] -- 0:00:55 818000 -- (-2101.187) [-2099.700] (-2094.367) (-2104.576) * (-2097.553) (-2096.553) (-2095.349) [-2096.071] -- 0:00:54 818500 -- [-2096.917] (-2105.864) (-2097.973) (-2090.263) * (-2093.038) (-2113.547) [-2091.760] (-2094.095) -- 0:00:54 819000 -- (-2103.155) (-2096.618) [-2100.538] (-2095.148) * (-2098.657) (-2108.234) (-2096.873) [-2095.119] -- 0:00:54 819500 -- (-2090.402) (-2095.753) (-2106.275) [-2094.870] * [-2098.311] (-2105.794) (-2098.145) (-2093.150) -- 0:00:54 820000 -- [-2100.001] (-2101.420) (-2103.494) (-2104.675) * (-2091.930) (-2111.943) (-2099.487) [-2093.963] -- 0:00:54 Average standard deviation of split frequencies: 0.000574 820500 -- (-2093.637) (-2093.776) (-2097.001) [-2096.204] * (-2091.035) (-2104.086) (-2095.815) [-2095.337] -- 0:00:54 821000 -- [-2096.784] (-2091.635) (-2100.158) (-2099.086) * [-2094.315] (-2094.361) (-2105.152) (-2096.158) -- 0:00:54 821500 -- (-2099.174) (-2099.076) [-2095.836] (-2097.302) * (-2094.664) [-2091.727] (-2096.927) (-2094.631) -- 0:00:53 822000 -- [-2103.511] (-2102.467) (-2093.007) (-2099.177) * (-2094.175) [-2093.595] (-2099.108) (-2092.353) -- 0:00:53 822500 -- (-2093.781) [-2096.978] (-2097.804) (-2100.224) * (-2102.362) (-2100.924) [-2097.874] (-2094.620) -- 0:00:53 823000 -- (-2104.372) (-2095.466) [-2097.577] (-2095.983) * (-2101.256) [-2097.853] (-2098.218) (-2099.259) -- 0:00:53 823500 -- (-2091.540) [-2098.464] (-2102.990) (-2098.613) * (-2097.885) (-2093.429) (-2098.037) [-2096.564] -- 0:00:53 824000 -- [-2097.168] (-2093.128) (-2102.766) (-2093.075) * [-2096.600] (-2096.178) (-2098.909) (-2096.070) -- 0:00:53 824500 -- [-2099.289] (-2098.490) (-2103.290) (-2093.529) * [-2091.365] (-2093.301) (-2098.555) (-2098.248) -- 0:00:53 825000 -- (-2095.161) [-2089.992] (-2097.472) (-2098.405) * (-2100.251) [-2097.001] (-2101.702) (-2098.349) -- 0:00:52 Average standard deviation of split frequencies: 0.000571 825500 -- (-2098.055) (-2096.820) (-2094.694) [-2097.235] * (-2099.588) [-2096.847] (-2101.866) (-2098.848) -- 0:00:52 826000 -- (-2100.252) [-2096.272] (-2100.904) (-2103.837) * [-2094.220] (-2091.871) (-2102.552) (-2097.313) -- 0:00:52 826500 -- (-2095.339) (-2098.273) [-2093.013] (-2096.212) * [-2096.498] (-2099.836) (-2096.081) (-2100.416) -- 0:00:52 827000 -- (-2094.835) (-2095.046) (-2093.069) [-2099.728] * (-2103.662) (-2102.791) [-2100.636] (-2098.539) -- 0:00:52 827500 -- (-2095.629) [-2099.819] (-2102.913) (-2100.265) * (-2097.432) [-2099.150] (-2099.148) (-2106.824) -- 0:00:52 828000 -- [-2092.207] (-2094.406) (-2091.614) (-2100.510) * (-2095.304) (-2101.856) [-2095.632] (-2095.792) -- 0:00:51 828500 -- (-2098.382) (-2095.275) [-2102.438] (-2098.111) * (-2093.840) (-2093.275) [-2103.479] (-2100.502) -- 0:00:51 829000 -- [-2096.494] (-2099.017) (-2106.117) (-2104.961) * (-2096.864) [-2093.384] (-2103.687) (-2096.009) -- 0:00:51 829500 -- (-2097.044) [-2088.144] (-2100.991) (-2101.640) * [-2092.138] (-2097.591) (-2098.098) (-2100.122) -- 0:00:51 830000 -- (-2099.137) (-2100.557) [-2100.516] (-2096.101) * (-2104.125) (-2095.490) (-2100.092) [-2094.836] -- 0:00:51 Average standard deviation of split frequencies: 0.000709 830500 -- (-2096.235) [-2102.401] (-2100.839) (-2107.470) * [-2092.517] (-2101.592) (-2096.576) (-2093.321) -- 0:00:51 831000 -- (-2103.588) (-2099.672) (-2100.053) [-2093.098] * [-2093.006] (-2106.626) (-2092.121) (-2105.085) -- 0:00:51 831500 -- (-2097.843) [-2097.611] (-2098.181) (-2096.149) * (-2092.706) (-2098.749) (-2101.392) [-2097.335] -- 0:00:50 832000 -- (-2098.144) (-2094.956) [-2095.868] (-2091.293) * (-2096.611) (-2094.337) [-2101.932] (-2097.270) -- 0:00:50 832500 -- (-2095.743) (-2096.919) (-2093.226) [-2094.894] * (-2093.071) [-2091.538] (-2096.866) (-2096.896) -- 0:00:50 833000 -- (-2101.002) [-2096.508] (-2101.969) (-2093.134) * [-2097.788] (-2100.406) (-2097.856) (-2097.420) -- 0:00:50 833500 -- (-2101.718) [-2094.153] (-2103.187) (-2096.987) * (-2104.702) (-2102.099) (-2098.839) [-2091.139] -- 0:00:50 834000 -- (-2099.518) [-2095.443] (-2103.479) (-2095.553) * (-2095.115) (-2098.845) [-2101.292] (-2095.962) -- 0:00:50 834500 -- [-2094.702] (-2098.204) (-2093.471) (-2091.108) * (-2091.564) (-2093.780) [-2096.135] (-2097.653) -- 0:00:49 835000 -- (-2100.390) (-2099.985) (-2101.404) [-2093.736] * (-2100.842) [-2092.850] (-2097.524) (-2092.057) -- 0:00:49 Average standard deviation of split frequencies: 0.000987 835500 -- [-2103.441] (-2096.625) (-2096.467) (-2095.485) * (-2102.794) (-2092.143) (-2090.475) [-2094.754] -- 0:00:49 836000 -- [-2090.862] (-2096.802) (-2093.287) (-2095.274) * (-2093.637) [-2090.254] (-2099.522) (-2101.728) -- 0:00:49 836500 -- [-2096.972] (-2097.556) (-2097.077) (-2102.817) * (-2095.912) [-2100.412] (-2099.555) (-2099.481) -- 0:00:49 837000 -- (-2101.812) (-2100.507) [-2096.837] (-2098.339) * (-2094.826) (-2103.430) (-2095.148) [-2094.941] -- 0:00:49 837500 -- (-2103.211) (-2102.293) [-2094.303] (-2101.689) * (-2095.217) (-2096.578) (-2101.718) [-2103.154] -- 0:00:49 838000 -- (-2103.981) [-2096.959] (-2100.501) (-2099.867) * (-2097.317) (-2101.110) [-2097.533] (-2090.815) -- 0:00:48 838500 -- (-2105.169) (-2100.400) (-2109.895) [-2100.138] * [-2095.057] (-2104.044) (-2109.564) (-2092.860) -- 0:00:48 839000 -- [-2100.379] (-2099.180) (-2095.504) (-2098.794) * (-2097.808) (-2093.995) (-2094.634) [-2098.521] -- 0:00:48 839500 -- [-2098.007] (-2101.895) (-2095.739) (-2099.134) * (-2096.897) (-2090.343) (-2094.283) [-2094.571] -- 0:00:48 840000 -- (-2104.850) [-2089.895] (-2100.689) (-2091.696) * (-2096.294) (-2096.029) (-2094.545) [-2097.467] -- 0:00:48 Average standard deviation of split frequencies: 0.001542 840500 -- (-2093.282) (-2094.609) (-2101.185) [-2091.206] * (-2097.176) (-2103.816) (-2093.161) [-2095.642] -- 0:00:48 841000 -- [-2093.683] (-2096.238) (-2092.537) (-2091.299) * (-2105.628) (-2095.300) [-2092.683] (-2093.343) -- 0:00:48 841500 -- (-2096.926) [-2091.282] (-2100.772) (-2096.310) * [-2098.119] (-2099.097) (-2098.863) (-2098.323) -- 0:00:47 842000 -- (-2100.112) (-2091.292) [-2094.686] (-2092.828) * (-2096.876) [-2095.446] (-2099.788) (-2094.588) -- 0:00:47 842500 -- (-2095.988) [-2106.007] (-2093.899) (-2094.812) * (-2098.764) (-2096.556) (-2099.933) [-2090.290] -- 0:00:47 843000 -- (-2094.656) [-2095.693] (-2096.640) (-2094.180) * [-2097.106] (-2094.032) (-2095.832) (-2097.756) -- 0:00:47 843500 -- (-2094.873) (-2107.238) (-2102.705) [-2091.746] * (-2091.365) (-2106.931) [-2098.755] (-2101.691) -- 0:00:47 844000 -- [-2090.929] (-2091.515) (-2096.873) (-2097.368) * [-2095.834] (-2091.088) (-2092.834) (-2097.201) -- 0:00:47 844500 -- (-2097.286) [-2096.539] (-2097.078) (-2095.423) * (-2102.794) (-2097.146) (-2104.195) [-2095.352] -- 0:00:46 845000 -- (-2098.559) [-2094.319] (-2098.267) (-2094.702) * (-2094.137) (-2103.105) [-2095.283] (-2097.283) -- 0:00:46 Average standard deviation of split frequencies: 0.001811 845500 -- [-2094.331] (-2097.397) (-2103.164) (-2091.631) * (-2100.680) (-2099.091) [-2095.699] (-2097.169) -- 0:00:46 846000 -- [-2100.040] (-2095.864) (-2097.598) (-2096.010) * [-2097.417] (-2090.545) (-2097.922) (-2100.428) -- 0:00:46 846500 -- (-2097.862) (-2093.984) (-2095.760) [-2093.926] * (-2106.073) (-2091.940) [-2095.474] (-2093.483) -- 0:00:46 847000 -- [-2089.941] (-2098.160) (-2101.988) (-2095.897) * (-2102.354) (-2095.411) (-2097.688) [-2094.198] -- 0:00:46 847500 -- (-2100.889) (-2100.631) (-2094.514) [-2091.883] * (-2095.368) [-2096.246] (-2101.892) (-2094.569) -- 0:00:46 848000 -- (-2087.669) (-2097.742) [-2092.370] (-2099.583) * [-2099.705] (-2100.673) (-2096.951) (-2100.726) -- 0:00:45 848500 -- [-2092.755] (-2104.448) (-2099.225) (-2097.962) * (-2098.071) [-2095.209] (-2096.823) (-2094.714) -- 0:00:45 849000 -- (-2097.770) (-2101.316) (-2094.257) [-2095.723] * (-2099.389) (-2096.340) [-2094.479] (-2109.391) -- 0:00:45 849500 -- [-2093.425] (-2091.194) (-2099.400) (-2094.891) * (-2096.925) (-2098.575) [-2093.189] (-2095.049) -- 0:00:45 850000 -- (-2097.740) (-2103.722) [-2091.291] (-2108.046) * (-2095.483) (-2100.350) [-2089.717] (-2101.827) -- 0:00:45 Average standard deviation of split frequencies: 0.001662 850500 -- (-2106.600) (-2099.007) (-2103.829) [-2096.392] * (-2100.003) [-2095.139] (-2093.011) (-2103.367) -- 0:00:45 851000 -- (-2097.963) (-2100.115) (-2093.027) [-2100.236] * (-2095.145) [-2094.613] (-2104.343) (-2098.894) -- 0:00:44 851500 -- (-2093.175) (-2099.578) [-2097.878] (-2097.856) * (-2101.932) (-2090.150) [-2094.231] (-2091.210) -- 0:00:44 852000 -- (-2094.233) [-2102.458] (-2093.465) (-2092.206) * (-2096.293) (-2107.335) [-2094.091] (-2109.122) -- 0:00:44 852500 -- (-2092.053) (-2095.935) [-2099.887] (-2105.820) * [-2095.691] (-2095.126) (-2097.708) (-2096.037) -- 0:00:44 853000 -- [-2099.794] (-2099.931) (-2095.950) (-2096.094) * (-2092.635) [-2095.510] (-2094.706) (-2103.608) -- 0:00:44 853500 -- (-2099.445) [-2102.456] (-2111.090) (-2097.014) * (-2095.948) [-2094.216] (-2100.346) (-2102.784) -- 0:00:44 854000 -- (-2108.902) (-2100.604) (-2089.733) [-2091.752] * (-2097.173) (-2108.117) [-2099.379] (-2101.954) -- 0:00:44 854500 -- (-2099.870) (-2090.979) (-2089.346) [-2093.560] * (-2101.674) (-2105.237) [-2095.100] (-2094.345) -- 0:00:43 855000 -- (-2104.002) [-2094.887] (-2090.655) (-2101.354) * (-2091.257) (-2099.581) (-2100.560) [-2093.799] -- 0:00:43 Average standard deviation of split frequencies: 0.001927 855500 -- (-2095.529) [-2100.844] (-2095.078) (-2097.989) * (-2092.767) (-2091.850) (-2094.144) [-2094.998] -- 0:00:43 856000 -- (-2104.274) (-2102.616) (-2092.581) [-2097.789] * [-2092.300] (-2100.307) (-2093.698) (-2106.140) -- 0:00:43 856500 -- (-2104.069) [-2095.986] (-2092.610) (-2101.903) * [-2096.165] (-2100.152) (-2094.806) (-2102.942) -- 0:00:43 857000 -- [-2105.766] (-2099.802) (-2098.120) (-2099.928) * (-2098.205) (-2095.402) [-2091.601] (-2097.001) -- 0:00:43 857500 -- (-2093.079) (-2102.468) (-2092.913) [-2092.787] * (-2098.686) [-2097.702] (-2099.277) (-2103.415) -- 0:00:43 858000 -- [-2097.963] (-2091.824) (-2101.350) (-2103.178) * (-2101.727) (-2100.895) [-2095.845] (-2093.907) -- 0:00:42 858500 -- (-2094.652) [-2093.203] (-2094.313) (-2104.961) * (-2100.277) (-2101.382) [-2096.769] (-2098.945) -- 0:00:42 859000 -- [-2092.776] (-2099.938) (-2099.595) (-2101.245) * (-2105.988) [-2089.666] (-2102.752) (-2102.680) -- 0:00:42 859500 -- (-2100.013) [-2100.387] (-2096.216) (-2099.867) * [-2096.530] (-2098.646) (-2101.757) (-2095.280) -- 0:00:42 860000 -- [-2098.844] (-2094.587) (-2094.835) (-2097.843) * (-2092.268) [-2091.763] (-2100.867) (-2102.329) -- 0:00:42 Average standard deviation of split frequencies: 0.001780 860500 -- (-2092.790) [-2100.041] (-2099.437) (-2094.389) * (-2101.215) (-2098.790) (-2099.119) [-2093.217] -- 0:00:42 861000 -- [-2090.398] (-2098.925) (-2104.681) (-2104.130) * (-2094.313) [-2092.502] (-2098.199) (-2101.323) -- 0:00:41 861500 -- (-2096.589) (-2099.986) [-2100.181] (-2096.117) * (-2094.971) (-2092.131) (-2099.958) [-2103.969] -- 0:00:41 862000 -- (-2094.090) [-2095.308] (-2097.296) (-2096.119) * [-2098.634] (-2093.118) (-2093.617) (-2095.247) -- 0:00:41 862500 -- (-2092.650) (-2094.774) (-2102.452) [-2097.231] * (-2092.904) (-2097.673) [-2091.810] (-2099.849) -- 0:00:41 863000 -- (-2093.572) (-2094.809) (-2103.922) [-2091.993] * (-2099.241) [-2094.108] (-2098.439) (-2094.639) -- 0:00:41 863500 -- (-2092.110) (-2095.048) (-2100.716) [-2095.417] * [-2095.016] (-2096.790) (-2096.638) (-2101.832) -- 0:00:41 864000 -- (-2093.616) [-2096.689] (-2103.664) (-2098.681) * (-2095.827) (-2097.801) (-2102.035) [-2094.933] -- 0:00:41 864500 -- (-2091.401) [-2094.742] (-2104.382) (-2096.630) * (-2100.284) (-2096.682) (-2096.576) [-2092.264] -- 0:00:40 865000 -- (-2102.142) (-2094.014) [-2097.265] (-2092.180) * (-2104.226) [-2095.399] (-2103.998) (-2091.803) -- 0:00:40 Average standard deviation of split frequencies: 0.001497 865500 -- [-2098.393] (-2096.683) (-2094.658) (-2099.205) * (-2097.144) [-2092.496] (-2103.525) (-2091.889) -- 0:00:40 866000 -- [-2091.537] (-2090.205) (-2092.476) (-2098.014) * [-2096.595] (-2099.478) (-2091.432) (-2096.246) -- 0:00:40 866500 -- (-2094.598) [-2097.706] (-2097.293) (-2097.058) * [-2096.134] (-2104.489) (-2101.474) (-2090.645) -- 0:00:40 867000 -- [-2089.780] (-2093.334) (-2100.831) (-2094.784) * [-2100.484] (-2100.379) (-2107.017) (-2094.276) -- 0:00:40 867500 -- [-2096.662] (-2090.949) (-2099.115) (-2096.823) * (-2095.055) (-2101.293) [-2091.239] (-2097.075) -- 0:00:40 868000 -- (-2098.595) (-2097.381) (-2097.115) [-2092.486] * [-2092.907] (-2092.511) (-2094.450) (-2106.115) -- 0:00:39 868500 -- [-2092.707] (-2100.352) (-2094.601) (-2101.831) * [-2096.138] (-2097.495) (-2090.564) (-2097.406) -- 0:00:39 869000 -- (-2095.556) [-2099.097] (-2091.853) (-2098.755) * [-2099.555] (-2103.218) (-2099.273) (-2090.321) -- 0:00:39 869500 -- [-2093.704] (-2097.182) (-2093.895) (-2093.603) * (-2094.128) (-2095.404) [-2093.096] (-2096.255) -- 0:00:39 870000 -- (-2102.026) (-2094.417) [-2094.234] (-2099.472) * (-2094.965) (-2104.379) [-2095.832] (-2094.740) -- 0:00:39 Average standard deviation of split frequencies: 0.001760 870500 -- (-2098.503) [-2102.652] (-2095.157) (-2094.266) * (-2104.889) (-2098.822) [-2091.116] (-2097.021) -- 0:00:39 871000 -- (-2103.834) [-2091.347] (-2101.581) (-2098.762) * (-2099.798) (-2097.287) (-2096.158) [-2092.184] -- 0:00:38 871500 -- (-2104.808) [-2089.758] (-2094.639) (-2100.735) * (-2094.912) (-2102.783) (-2096.554) [-2094.483] -- 0:00:38 872000 -- [-2095.923] (-2095.440) (-2099.137) (-2102.599) * (-2093.018) (-2094.810) [-2103.747] (-2104.339) -- 0:00:38 872500 -- (-2094.422) (-2098.803) [-2092.557] (-2098.925) * [-2093.936] (-2096.761) (-2093.752) (-2099.295) -- 0:00:38 873000 -- (-2096.928) (-2090.233) (-2096.473) [-2098.659] * [-2097.719] (-2094.924) (-2094.380) (-2095.553) -- 0:00:38 873500 -- [-2094.962] (-2101.163) (-2100.511) (-2096.933) * (-2096.675) (-2098.527) (-2093.692) [-2095.954] -- 0:00:38 874000 -- (-2091.891) (-2093.938) [-2096.577] (-2104.011) * [-2095.536] (-2099.525) (-2093.177) (-2100.913) -- 0:00:38 874500 -- (-2093.527) (-2101.894) [-2110.351] (-2094.239) * (-2096.276) [-2095.832] (-2108.040) (-2102.736) -- 0:00:37 875000 -- (-2089.852) [-2101.897] (-2108.623) (-2107.207) * (-2093.485) (-2099.360) [-2095.268] (-2093.041) -- 0:00:37 Average standard deviation of split frequencies: 0.001614 875500 -- [-2091.579] (-2100.881) (-2090.591) (-2102.353) * (-2099.240) (-2100.725) (-2096.456) [-2092.884] -- 0:00:37 876000 -- (-2099.845) (-2105.110) (-2097.301) [-2103.387] * (-2093.663) (-2106.311) (-2096.040) [-2093.916] -- 0:00:37 876500 -- (-2090.427) [-2097.447] (-2092.228) (-2094.015) * (-2089.286) (-2095.815) (-2111.087) [-2094.093] -- 0:00:37 877000 -- [-2097.060] (-2100.991) (-2098.111) (-2099.330) * (-2094.687) (-2096.460) (-2101.360) [-2093.440] -- 0:00:37 877500 -- [-2096.417] (-2098.705) (-2106.880) (-2092.458) * [-2092.588] (-2097.266) (-2092.143) (-2097.592) -- 0:00:36 878000 -- (-2098.923) [-2098.332] (-2098.611) (-2093.512) * (-2094.144) [-2100.021] (-2088.995) (-2094.177) -- 0:00:36 878500 -- (-2099.715) (-2099.291) (-2094.837) [-2095.340] * (-2094.540) (-2098.144) [-2090.685] (-2095.760) -- 0:00:36 879000 -- [-2093.185] (-2094.733) (-2099.715) (-2101.735) * [-2095.761] (-2095.077) (-2090.548) (-2095.521) -- 0:00:36 879500 -- (-2095.927) (-2099.328) [-2091.440] (-2093.902) * [-2095.379] (-2097.491) (-2098.998) (-2096.020) -- 0:00:36 880000 -- (-2094.201) (-2092.962) (-2098.295) [-2101.020] * (-2099.759) (-2090.295) [-2101.724] (-2102.606) -- 0:00:36 Average standard deviation of split frequencies: 0.001338 880500 -- [-2095.657] (-2098.347) (-2096.836) (-2096.623) * (-2093.722) [-2100.006] (-2103.187) (-2098.329) -- 0:00:35 881000 -- (-2118.788) [-2095.002] (-2095.942) (-2096.161) * (-2105.738) [-2099.195] (-2101.327) (-2098.596) -- 0:00:35 881500 -- (-2095.423) [-2094.042] (-2096.527) (-2104.162) * (-2095.386) (-2107.202) (-2103.637) [-2107.145] -- 0:00:35 882000 -- [-2097.583] (-2096.880) (-2094.390) (-2091.461) * [-2091.816] (-2112.650) (-2093.207) (-2098.950) -- 0:00:35 882500 -- (-2097.708) (-2100.886) [-2098.977] (-2097.059) * (-2094.808) (-2101.595) (-2099.197) [-2096.719] -- 0:00:35 883000 -- (-2098.202) (-2101.112) (-2098.649) [-2097.521] * (-2090.976) (-2107.568) (-2098.359) [-2090.498] -- 0:00:35 883500 -- (-2104.616) [-2094.428] (-2088.916) (-2092.445) * [-2091.873] (-2099.235) (-2096.854) (-2099.044) -- 0:00:35 884000 -- (-2095.828) (-2104.438) (-2095.579) [-2092.359] * (-2096.616) (-2097.745) (-2095.287) [-2094.850] -- 0:00:35 884500 -- [-2093.164] (-2108.625) (-2096.947) (-2096.041) * (-2095.221) [-2101.202] (-2108.442) (-2098.263) -- 0:00:34 885000 -- (-2099.879) (-2098.338) [-2101.098] (-2094.265) * (-2103.255) (-2109.961) [-2096.767] (-2098.579) -- 0:00:34 Average standard deviation of split frequencies: 0.001463 885500 -- (-2103.074) (-2095.465) [-2098.029] (-2092.002) * (-2093.443) (-2099.565) [-2094.455] (-2096.356) -- 0:00:34 886000 -- (-2091.096) (-2097.416) (-2102.869) [-2116.994] * [-2096.432] (-2093.676) (-2092.377) (-2095.697) -- 0:00:34 886500 -- (-2097.771) [-2095.740] (-2098.967) (-2096.640) * (-2095.067) (-2095.933) (-2096.009) [-2099.158] -- 0:00:34 887000 -- (-2101.467) [-2090.241] (-2094.655) (-2104.760) * (-2093.323) (-2093.082) [-2092.877] (-2093.364) -- 0:00:34 887500 -- (-2103.349) [-2093.382] (-2096.737) (-2109.036) * (-2097.526) [-2098.388] (-2093.051) (-2098.311) -- 0:00:33 888000 -- [-2091.606] (-2093.707) (-2098.167) (-2099.241) * (-2098.634) (-2095.226) [-2093.107] (-2094.187) -- 0:00:33 888500 -- [-2096.732] (-2099.499) (-2100.694) (-2101.452) * (-2101.463) (-2097.216) [-2102.197] (-2101.006) -- 0:00:33 889000 -- (-2100.352) (-2096.625) (-2097.258) [-2095.389] * [-2095.604] (-2096.173) (-2095.418) (-2104.141) -- 0:00:33 889500 -- (-2103.139) (-2101.316) [-2096.174] (-2097.859) * [-2094.077] (-2095.740) (-2095.673) (-2097.174) -- 0:00:33 890000 -- (-2098.556) [-2099.801] (-2098.216) (-2101.705) * (-2088.207) (-2094.647) [-2094.044] (-2096.836) -- 0:00:33 Average standard deviation of split frequencies: 0.001852 890500 -- [-2094.415] (-2102.044) (-2096.621) (-2099.971) * (-2098.903) (-2094.574) (-2101.517) [-2092.624] -- 0:00:33 891000 -- (-2094.497) [-2093.533] (-2098.329) (-2098.120) * (-2098.302) (-2089.677) [-2094.636] (-2089.416) -- 0:00:32 891500 -- (-2107.005) (-2093.422) [-2091.490] (-2102.431) * (-2101.319) (-2090.108) (-2096.496) [-2090.217] -- 0:00:32 892000 -- (-2111.690) (-2096.167) [-2093.300] (-2097.722) * (-2092.250) [-2099.200] (-2092.598) (-2097.198) -- 0:00:32 892500 -- (-2097.987) (-2092.507) [-2097.946] (-2097.276) * [-2099.327] (-2097.633) (-2095.565) (-2098.198) -- 0:00:32 893000 -- [-2095.205] (-2102.320) (-2096.262) (-2103.130) * (-2097.827) (-2095.869) [-2092.807] (-2098.603) -- 0:00:32 893500 -- [-2103.535] (-2097.774) (-2096.674) (-2095.245) * (-2097.008) (-2097.510) (-2097.202) [-2096.804] -- 0:00:32 894000 -- (-2098.654) (-2104.208) (-2099.545) [-2095.358] * (-2093.163) (-2094.001) (-2095.398) [-2092.604] -- 0:00:32 894500 -- (-2099.472) (-2099.921) (-2099.646) [-2095.727] * (-2096.646) (-2094.419) (-2100.233) [-2095.354] -- 0:00:31 895000 -- (-2089.867) [-2097.014] (-2102.108) (-2094.811) * (-2104.034) (-2101.646) (-2096.763) [-2095.492] -- 0:00:31 Average standard deviation of split frequencies: 0.002236 895500 -- [-2093.510] (-2098.137) (-2098.722) (-2097.113) * (-2114.556) (-2098.945) (-2103.647) [-2093.161] -- 0:00:31 896000 -- (-2097.018) (-2099.302) (-2099.394) [-2094.306] * [-2109.073] (-2099.366) (-2100.657) (-2106.674) -- 0:00:31 896500 -- (-2093.039) (-2101.472) (-2093.160) [-2090.172] * (-2097.294) (-2095.885) (-2098.079) [-2099.160] -- 0:00:31 897000 -- (-2100.592) [-2094.586] (-2096.146) (-2094.520) * (-2098.645) (-2099.210) [-2093.488] (-2096.121) -- 0:00:31 897500 -- (-2097.569) (-2093.838) (-2097.237) [-2095.258] * [-2109.180] (-2098.227) (-2096.584) (-2094.589) -- 0:00:30 898000 -- (-2096.393) [-2095.950] (-2092.361) (-2106.002) * (-2114.555) [-2096.260] (-2093.178) (-2098.841) -- 0:00:30 898500 -- [-2101.390] (-2099.747) (-2095.257) (-2097.495) * (-2093.909) (-2102.291) (-2091.345) [-2095.280] -- 0:00:30 899000 -- (-2102.295) [-2092.959] (-2098.401) (-2091.775) * (-2112.961) [-2094.626] (-2101.881) (-2097.658) -- 0:00:30 899500 -- (-2110.247) (-2095.138) (-2099.770) [-2096.142] * (-2111.494) (-2094.412) (-2106.697) [-2098.174] -- 0:00:30 900000 -- [-2098.462] (-2101.560) (-2101.774) (-2093.732) * (-2102.934) (-2093.475) (-2102.083) [-2097.289] -- 0:00:30 Average standard deviation of split frequencies: 0.002094 900500 -- [-2094.616] (-2095.139) (-2093.888) (-2103.707) * [-2096.913] (-2095.274) (-2097.784) (-2101.468) -- 0:00:30 901000 -- [-2093.389] (-2100.590) (-2090.648) (-2101.136) * [-2102.809] (-2100.596) (-2100.164) (-2093.955) -- 0:00:29 901500 -- [-2095.455] (-2094.439) (-2095.638) (-2093.632) * (-2098.444) (-2094.370) (-2095.657) [-2094.247] -- 0:00:29 902000 -- (-2096.723) (-2101.320) [-2091.525] (-2102.926) * (-2090.665) [-2100.177] (-2109.804) (-2095.813) -- 0:00:29 902500 -- (-2093.916) (-2101.965) (-2093.184) [-2095.297] * (-2097.307) (-2102.966) [-2094.516] (-2102.096) -- 0:00:29 903000 -- (-2093.799) (-2100.558) (-2097.372) [-2099.654] * (-2096.141) [-2093.656] (-2104.403) (-2103.369) -- 0:00:29 903500 -- (-2101.689) (-2093.904) (-2097.225) [-2090.059] * [-2092.865] (-2097.292) (-2096.126) (-2093.310) -- 0:00:29 904000 -- (-2098.216) (-2094.789) [-2095.180] (-2093.698) * (-2095.940) (-2095.649) [-2095.586] (-2091.032) -- 0:00:28 904500 -- (-2093.447) (-2091.248) [-2089.564] (-2094.964) * (-2102.531) [-2096.279] (-2094.277) (-2088.436) -- 0:00:28 905000 -- (-2092.815) [-2096.598] (-2088.504) (-2097.911) * [-2095.131] (-2093.998) (-2101.055) (-2093.667) -- 0:00:28 Average standard deviation of split frequencies: 0.001821 905500 -- [-2086.363] (-2100.791) (-2090.329) (-2095.776) * (-2097.370) (-2096.115) (-2095.155) [-2092.234] -- 0:00:28 906000 -- (-2095.632) (-2098.870) (-2100.972) [-2093.073] * (-2093.946) (-2096.044) (-2094.254) [-2093.559] -- 0:00:28 906500 -- [-2092.062] (-2103.303) (-2100.563) (-2101.655) * (-2105.813) [-2095.645] (-2091.391) (-2099.255) -- 0:00:28 907000 -- (-2096.354) [-2099.163] (-2097.383) (-2094.624) * (-2096.674) (-2104.836) [-2096.558] (-2099.975) -- 0:00:27 907500 -- (-2099.423) (-2096.229) [-2100.443] (-2093.693) * (-2091.373) (-2097.845) [-2101.585] (-2103.737) -- 0:00:27 908000 -- (-2096.782) (-2094.041) (-2102.968) [-2100.207] * [-2090.077] (-2112.741) (-2095.011) (-2094.290) -- 0:00:27 908500 -- (-2096.943) (-2105.731) (-2093.749) [-2095.325] * (-2097.548) (-2115.709) (-2100.510) [-2100.735] -- 0:00:27 909000 -- (-2099.329) (-2104.165) [-2092.724] (-2097.312) * (-2099.075) (-2096.145) (-2099.331) [-2094.926] -- 0:00:27 909500 -- [-2095.754] (-2098.029) (-2090.825) (-2095.847) * (-2100.042) (-2097.469) [-2095.977] (-2101.991) -- 0:00:27 910000 -- (-2091.469) (-2097.412) (-2093.488) [-2092.685] * [-2091.645] (-2097.079) (-2094.251) (-2099.341) -- 0:00:27 Average standard deviation of split frequencies: 0.002071 910500 -- (-2094.109) (-2107.808) [-2097.203] (-2097.342) * [-2093.148] (-2094.884) (-2091.729) (-2104.158) -- 0:00:27 911000 -- (-2095.350) (-2096.960) (-2094.539) [-2096.744] * [-2098.233] (-2093.387) (-2098.800) (-2102.651) -- 0:00:26 911500 -- [-2096.217] (-2102.379) (-2092.547) (-2103.131) * (-2098.773) (-2099.703) (-2099.225) [-2106.215] -- 0:00:26 912000 -- (-2100.509) (-2100.538) (-2096.879) [-2098.865] * (-2094.889) (-2098.670) (-2095.021) [-2094.546] -- 0:00:26 912500 -- (-2100.430) (-2111.094) (-2101.176) [-2099.995] * (-2096.886) (-2095.666) [-2092.043] (-2101.251) -- 0:00:26 913000 -- [-2091.127] (-2104.192) (-2097.050) (-2101.581) * (-2103.438) [-2097.150] (-2089.790) (-2098.349) -- 0:00:26 913500 -- [-2097.958] (-2102.043) (-2091.400) (-2098.001) * [-2099.640] (-2100.262) (-2100.118) (-2092.415) -- 0:00:26 914000 -- [-2094.397] (-2104.352) (-2095.443) (-2095.926) * (-2102.212) [-2094.290] (-2097.297) (-2097.139) -- 0:00:25 914500 -- (-2099.876) (-2106.361) [-2096.712] (-2095.833) * (-2096.337) (-2098.514) [-2096.364] (-2100.864) -- 0:00:25 915000 -- [-2099.240] (-2103.080) (-2098.997) (-2102.231) * (-2099.621) (-2091.207) [-2092.398] (-2101.001) -- 0:00:25 Average standard deviation of split frequencies: 0.001673 915500 -- [-2095.295] (-2101.534) (-2094.311) (-2103.151) * (-2090.421) (-2103.527) [-2091.912] (-2104.993) -- 0:00:25 916000 -- (-2094.377) [-2095.160] (-2091.427) (-2091.539) * [-2096.705] (-2107.079) (-2105.263) (-2095.872) -- 0:00:25 916500 -- [-2091.311] (-2096.869) (-2092.115) (-2095.177) * [-2097.935] (-2099.400) (-2106.112) (-2096.297) -- 0:00:25 917000 -- (-2099.951) (-2097.826) (-2103.180) [-2096.425] * (-2094.581) (-2096.956) [-2097.630] (-2100.216) -- 0:00:24 917500 -- (-2093.679) (-2093.425) (-2094.712) [-2096.094] * [-2096.019] (-2096.968) (-2100.196) (-2096.474) -- 0:00:24 918000 -- (-2099.945) (-2098.654) [-2093.405] (-2099.027) * (-2094.628) (-2095.622) [-2090.673] (-2100.948) -- 0:00:24 918500 -- (-2102.118) [-2094.407] (-2094.819) (-2093.782) * (-2089.984) (-2105.663) [-2096.741] (-2096.416) -- 0:00:24 919000 -- (-2099.282) (-2096.493) (-2106.422) [-2092.702] * (-2100.293) [-2100.477] (-2111.751) (-2097.093) -- 0:00:24 919500 -- (-2096.367) (-2096.729) (-2097.617) [-2091.812] * (-2097.942) (-2099.501) [-2095.848] (-2098.958) -- 0:00:24 920000 -- (-2096.275) (-2097.491) (-2098.243) [-2095.603] * (-2095.075) (-2105.279) [-2095.148] (-2096.627) -- 0:00:24 Average standard deviation of split frequencies: 0.001408 920500 -- (-2100.559) (-2095.248) (-2093.004) [-2095.597] * [-2092.472] (-2100.794) (-2104.390) (-2105.299) -- 0:00:24 921000 -- (-2101.151) [-2094.517] (-2095.364) (-2099.724) * [-2089.916] (-2093.897) (-2110.304) (-2101.565) -- 0:00:23 921500 -- (-2105.384) [-2093.559] (-2098.363) (-2097.803) * [-2099.407] (-2102.290) (-2110.964) (-2096.042) -- 0:00:23 922000 -- (-2094.981) (-2093.536) [-2099.318] (-2100.302) * (-2096.899) (-2098.302) (-2102.728) [-2096.669] -- 0:00:23 922500 -- (-2093.411) (-2097.150) [-2098.484] (-2095.266) * (-2097.901) (-2090.323) [-2090.860] (-2097.927) -- 0:00:23 923000 -- [-2099.305] (-2097.788) (-2094.623) (-2109.867) * (-2093.367) [-2094.705] (-2097.440) (-2095.685) -- 0:00:23 923500 -- (-2089.498) [-2091.592] (-2098.863) (-2099.132) * (-2098.428) (-2095.265) [-2106.647] (-2095.690) -- 0:00:23 924000 -- (-2095.075) (-2091.532) [-2093.048] (-2096.779) * [-2095.914] (-2094.910) (-2100.259) (-2099.930) -- 0:00:22 924500 -- [-2097.200] (-2094.823) (-2104.880) (-2089.342) * (-2092.080) (-2090.982) [-2097.489] (-2097.787) -- 0:00:22 925000 -- [-2094.273] (-2097.462) (-2095.588) (-2097.348) * (-2106.014) (-2091.967) [-2095.352] (-2103.841) -- 0:00:22 Average standard deviation of split frequencies: 0.001782 925500 -- [-2093.541] (-2096.414) (-2093.469) (-2097.258) * [-2092.838] (-2096.266) (-2105.895) (-2090.677) -- 0:00:22 926000 -- (-2093.603) (-2094.321) [-2093.891] (-2103.635) * (-2094.512) [-2096.142] (-2089.175) (-2098.032) -- 0:00:22 926500 -- (-2104.579) (-2095.154) (-2104.205) [-2090.573] * [-2091.439] (-2093.800) (-2093.644) (-2101.311) -- 0:00:22 927000 -- (-2096.490) [-2089.899] (-2095.231) (-2093.814) * [-2090.012] (-2095.517) (-2088.449) (-2104.294) -- 0:00:21 927500 -- [-2088.790] (-2091.781) (-2093.432) (-2089.637) * [-2097.336] (-2097.167) (-2093.937) (-2103.198) -- 0:00:21 928000 -- [-2092.420] (-2098.441) (-2100.149) (-2101.972) * (-2096.324) [-2096.595] (-2095.760) (-2094.493) -- 0:00:21 928500 -- [-2096.453] (-2101.089) (-2104.779) (-2097.739) * (-2101.502) (-2097.746) [-2093.719] (-2096.437) -- 0:00:21 929000 -- (-2094.302) (-2111.271) (-2093.106) [-2093.838] * (-2094.222) (-2099.843) (-2096.268) [-2099.035] -- 0:00:21 929500 -- (-2098.342) [-2094.657] (-2099.475) (-2097.239) * (-2098.765) (-2100.898) [-2101.391] (-2105.582) -- 0:00:21 930000 -- (-2094.954) [-2092.123] (-2093.408) (-2102.120) * [-2095.595] (-2099.804) (-2092.362) (-2100.289) -- 0:00:21 Average standard deviation of split frequencies: 0.002026 930500 -- (-2091.334) (-2095.183) (-2096.355) [-2091.909] * [-2098.859] (-2093.795) (-2089.689) (-2097.632) -- 0:00:20 931000 -- (-2097.243) (-2106.781) [-2095.935] (-2102.541) * (-2104.588) (-2096.673) (-2094.009) [-2092.991] -- 0:00:20 931500 -- (-2099.035) [-2093.155] (-2100.447) (-2098.536) * [-2094.061] (-2094.967) (-2098.883) (-2099.012) -- 0:00:20 932000 -- (-2093.531) (-2101.327) [-2095.890] (-2106.225) * (-2092.287) (-2097.567) [-2094.267] (-2104.074) -- 0:00:20 932500 -- (-2101.357) (-2100.147) [-2096.464] (-2100.407) * (-2090.035) (-2098.361) [-2100.322] (-2094.863) -- 0:00:20 933000 -- (-2095.632) [-2096.568] (-2095.075) (-2102.280) * [-2087.556] (-2097.800) (-2105.630) (-2102.525) -- 0:00:20 933500 -- (-2102.181) (-2113.045) (-2099.751) [-2097.525] * (-2092.796) [-2095.371] (-2098.596) (-2097.062) -- 0:00:20 934000 -- (-2099.231) (-2109.465) [-2106.549] (-2098.617) * (-2100.145) (-2097.743) (-2107.804) [-2092.144] -- 0:00:19 934500 -- [-2093.766] (-2102.975) (-2099.018) (-2107.608) * [-2097.979] (-2093.316) (-2100.344) (-2099.474) -- 0:00:19 935000 -- (-2092.504) [-2094.458] (-2096.870) (-2106.418) * [-2093.271] (-2098.169) (-2100.267) (-2097.460) -- 0:00:19 Average standard deviation of split frequencies: 0.002015 935500 -- (-2096.699) [-2091.603] (-2101.844) (-2092.746) * (-2092.662) [-2095.634] (-2104.175) (-2099.928) -- 0:00:19 936000 -- [-2091.812] (-2097.846) (-2100.106) (-2099.552) * (-2103.401) (-2091.722) (-2099.341) [-2095.955] -- 0:00:19 936500 -- (-2099.023) (-2093.449) (-2094.077) [-2092.411] * [-2093.447] (-2096.104) (-2098.504) (-2102.102) -- 0:00:19 937000 -- [-2101.331] (-2092.443) (-2103.652) (-2091.273) * (-2093.391) (-2094.518) [-2094.731] (-2092.524) -- 0:00:18 937500 -- (-2102.416) [-2094.273] (-2093.322) (-2096.491) * (-2090.274) (-2102.330) (-2107.573) [-2096.078] -- 0:00:18 938000 -- (-2094.455) [-2095.604] (-2092.939) (-2094.867) * (-2098.394) (-2094.688) (-2109.167) [-2092.495] -- 0:00:18 938500 -- (-2090.957) (-2092.635) [-2098.363] (-2099.257) * [-2090.052] (-2093.538) (-2097.447) (-2103.328) -- 0:00:18 939000 -- (-2090.772) (-2094.912) (-2099.536) [-2098.890] * (-2098.436) [-2095.486] (-2094.077) (-2095.197) -- 0:00:18 939500 -- (-2099.446) (-2093.069) [-2094.157] (-2099.139) * (-2095.160) [-2097.485] (-2093.065) (-2098.836) -- 0:00:18 940000 -- [-2098.762] (-2101.097) (-2097.715) (-2098.826) * [-2098.815] (-2093.300) (-2105.717) (-2101.765) -- 0:00:18 Average standard deviation of split frequencies: 0.001879 940500 -- (-2103.950) [-2092.477] (-2095.915) (-2104.946) * (-2111.923) [-2098.067] (-2098.555) (-2102.791) -- 0:00:17 941000 -- (-2096.171) (-2089.570) (-2105.004) [-2097.014] * (-2098.163) [-2102.868] (-2096.158) (-2099.265) -- 0:00:17 941500 -- (-2109.490) (-2097.689) (-2099.995) [-2092.309] * (-2111.598) (-2095.770) (-2095.514) [-2092.603] -- 0:00:17 942000 -- (-2098.320) (-2096.453) (-2101.781) [-2090.648] * (-2105.502) (-2089.838) [-2101.758] (-2095.179) -- 0:00:17 942500 -- (-2098.531) (-2097.647) (-2098.327) [-2104.844] * (-2096.116) (-2091.108) (-2104.628) [-2090.144] -- 0:00:17 943000 -- [-2094.531] (-2099.187) (-2104.488) (-2094.446) * (-2097.487) (-2098.587) [-2091.703] (-2093.773) -- 0:00:17 943500 -- (-2090.547) [-2097.081] (-2105.519) (-2093.989) * (-2103.176) [-2098.399] (-2093.996) (-2092.506) -- 0:00:17 944000 -- (-2099.334) (-2100.667) (-2099.538) [-2094.688] * [-2096.828] (-2107.470) (-2100.454) (-2099.687) -- 0:00:16 944500 -- (-2104.090) (-2087.965) (-2092.319) [-2089.673] * [-2092.132] (-2101.986) (-2099.448) (-2095.176) -- 0:00:16 945000 -- (-2095.214) [-2092.908] (-2099.990) (-2093.950) * (-2100.768) [-2095.647] (-2095.201) (-2103.612) -- 0:00:16 Average standard deviation of split frequencies: 0.001869 945500 -- (-2095.747) (-2097.446) [-2092.800] (-2095.116) * (-2095.275) [-2094.060] (-2100.401) (-2091.337) -- 0:00:16 946000 -- (-2092.588) [-2093.695] (-2097.385) (-2094.670) * (-2101.659) (-2097.963) [-2100.772] (-2098.719) -- 0:00:16 946500 -- (-2097.072) (-2095.476) [-2096.946] (-2105.569) * (-2094.144) (-2098.541) [-2097.032] (-2092.003) -- 0:00:16 947000 -- [-2098.569] (-2094.929) (-2103.894) (-2108.541) * (-2097.869) [-2090.059] (-2090.817) (-2094.572) -- 0:00:15 947500 -- [-2099.481] (-2090.558) (-2097.439) (-2094.970) * (-2098.797) (-2102.515) (-2093.263) [-2093.942] -- 0:00:15 948000 -- (-2094.054) (-2095.697) (-2091.198) [-2101.677] * (-2094.616) [-2093.037] (-2094.274) (-2097.097) -- 0:00:15 948500 -- (-2097.139) (-2095.360) [-2092.559] (-2101.298) * [-2095.355] (-2099.035) (-2095.060) (-2100.101) -- 0:00:15 949000 -- [-2091.271] (-2094.479) (-2089.736) (-2100.781) * [-2092.971] (-2091.552) (-2094.931) (-2091.865) -- 0:00:15 949500 -- [-2095.493] (-2095.793) (-2094.982) (-2092.825) * [-2090.640] (-2096.977) (-2100.505) (-2103.332) -- 0:00:15 950000 -- [-2096.269] (-2098.883) (-2103.690) (-2096.683) * [-2097.326] (-2099.700) (-2100.212) (-2104.012) -- 0:00:15 Average standard deviation of split frequencies: 0.001488 950500 -- (-2096.743) (-2101.424) [-2090.063] (-2099.465) * [-2098.098] (-2098.737) (-2104.563) (-2094.011) -- 0:00:14 951000 -- (-2098.113) (-2099.717) [-2096.647] (-2097.759) * (-2097.237) [-2091.304] (-2096.956) (-2090.947) -- 0:00:14 951500 -- [-2093.980] (-2095.914) (-2094.199) (-2099.025) * (-2095.724) (-2104.288) (-2091.194) [-2094.448] -- 0:00:14 952000 -- (-2100.915) [-2096.623] (-2099.088) (-2097.372) * (-2094.972) (-2104.469) (-2093.506) [-2102.662] -- 0:00:14 952500 -- (-2096.549) (-2096.736) (-2098.645) [-2099.618] * (-2096.756) (-2094.905) [-2096.299] (-2103.038) -- 0:00:14 953000 -- (-2102.307) (-2089.775) (-2096.571) [-2097.605] * (-2099.928) (-2095.356) (-2099.323) [-2095.503] -- 0:00:14 953500 -- (-2090.717) (-2095.169) (-2098.787) [-2101.183] * (-2093.514) (-2101.309) [-2097.100] (-2095.286) -- 0:00:13 954000 -- (-2100.413) [-2095.813] (-2100.707) (-2102.226) * [-2091.915] (-2097.843) (-2109.054) (-2097.898) -- 0:00:13 954500 -- (-2096.008) (-2104.417) [-2097.673] (-2091.398) * (-2094.752) (-2093.345) [-2101.050] (-2097.128) -- 0:00:13 955000 -- [-2096.656] (-2090.245) (-2094.897) (-2110.315) * (-2096.648) [-2095.607] (-2102.810) (-2089.796) -- 0:00:13 Average standard deviation of split frequencies: 0.001109 955500 -- (-2094.169) (-2101.927) (-2092.472) [-2100.044] * (-2092.193) [-2090.804] (-2099.160) (-2091.724) -- 0:00:13 956000 -- [-2094.895] (-2104.450) (-2107.175) (-2101.999) * (-2101.697) (-2095.348) [-2093.972] (-2093.950) -- 0:00:13 956500 -- (-2096.650) (-2100.158) (-2100.423) [-2094.432] * (-2109.573) (-2100.848) (-2094.377) [-2096.300] -- 0:00:13 957000 -- (-2099.061) (-2095.309) (-2092.474) [-2098.811] * (-2100.171) (-2103.994) [-2094.732] (-2094.699) -- 0:00:12 957500 -- (-2102.490) (-2099.543) [-2101.196] (-2095.804) * (-2102.645) (-2098.235) [-2094.872] (-2096.271) -- 0:00:12 958000 -- (-2091.310) [-2093.759] (-2096.596) (-2103.116) * [-2095.505] (-2104.837) (-2095.747) (-2095.474) -- 0:00:12 958500 -- (-2098.013) (-2092.874) [-2096.761] (-2100.410) * (-2092.188) (-2093.154) (-2092.659) [-2094.994] -- 0:00:12 959000 -- [-2101.933] (-2095.198) (-2096.008) (-2099.170) * (-2091.320) (-2091.591) (-2098.261) [-2095.831] -- 0:00:12 959500 -- (-2104.674) (-2100.282) (-2104.264) [-2093.340] * (-2096.200) [-2093.476] (-2097.087) (-2097.995) -- 0:00:12 960000 -- (-2096.684) (-2105.022) (-2094.577) [-2098.175] * (-2102.353) [-2098.024] (-2099.387) (-2095.154) -- 0:00:12 Average standard deviation of split frequencies: 0.001227 960500 -- (-2104.736) (-2095.894) [-2093.058] (-2102.524) * (-2100.873) (-2096.054) [-2097.807] (-2096.706) -- 0:00:11 961000 -- [-2090.552] (-2096.047) (-2095.456) (-2103.743) * (-2104.407) (-2096.168) (-2094.814) [-2096.910] -- 0:00:11 961500 -- (-2099.943) [-2094.818] (-2095.742) (-2105.273) * [-2104.363] (-2096.800) (-2090.395) (-2104.532) -- 0:00:11 962000 -- (-2099.760) (-2096.861) [-2095.803] (-2108.306) * (-2102.036) [-2093.540] (-2102.461) (-2093.937) -- 0:00:11 962500 -- (-2110.500) [-2099.179] (-2096.748) (-2100.444) * (-2098.227) (-2099.210) (-2097.549) [-2089.729] -- 0:00:11 963000 -- [-2094.036] (-2094.683) (-2094.710) (-2093.079) * (-2099.155) [-2095.375] (-2090.217) (-2097.371) -- 0:00:11 963500 -- (-2090.606) [-2094.557] (-2102.868) (-2095.174) * [-2093.641] (-2093.728) (-2093.564) (-2096.443) -- 0:00:10 964000 -- (-2096.606) [-2093.357] (-2097.219) (-2097.658) * [-2093.534] (-2095.174) (-2092.864) (-2095.351) -- 0:00:10 964500 -- (-2097.401) [-2100.512] (-2099.614) (-2095.346) * (-2091.392) (-2101.886) [-2092.560] (-2102.931) -- 0:00:10 965000 -- (-2091.507) [-2088.112] (-2097.996) (-2102.484) * (-2097.124) (-2096.928) [-2096.194] (-2098.093) -- 0:00:10 Average standard deviation of split frequencies: 0.001220 965500 -- [-2094.336] (-2090.492) (-2100.842) (-2107.970) * (-2093.366) [-2094.820] (-2093.874) (-2098.265) -- 0:00:10 966000 -- [-2095.339] (-2096.586) (-2098.915) (-2111.933) * (-2099.523) [-2093.518] (-2098.362) (-2094.549) -- 0:00:10 966500 -- (-2103.388) (-2101.822) (-2100.946) [-2103.318] * (-2101.607) (-2102.019) [-2093.385] (-2090.788) -- 0:00:10 967000 -- (-2099.099) [-2098.407] (-2110.876) (-2099.478) * [-2092.194] (-2094.140) (-2096.516) (-2097.682) -- 0:00:09 967500 -- [-2094.920] (-2097.222) (-2091.757) (-2095.492) * (-2103.736) (-2097.396) [-2090.510] (-2102.923) -- 0:00:09 968000 -- [-2093.857] (-2093.076) (-2097.199) (-2099.711) * (-2103.593) (-2095.533) [-2097.991] (-2102.294) -- 0:00:09 968500 -- (-2096.065) [-2095.956] (-2095.670) (-2095.800) * (-2107.208) (-2102.729) [-2102.535] (-2103.129) -- 0:00:09 969000 -- (-2097.949) [-2094.296] (-2095.530) (-2094.878) * (-2100.458) (-2099.091) (-2106.747) [-2103.580] -- 0:00:09 969500 -- (-2097.963) (-2101.342) (-2095.429) [-2096.574] * (-2098.321) (-2095.397) [-2092.110] (-2092.403) -- 0:00:09 970000 -- (-2098.935) [-2101.844] (-2099.157) (-2095.675) * (-2095.232) [-2098.003] (-2100.921) (-2106.212) -- 0:00:09 Average standard deviation of split frequencies: 0.001336 970500 -- (-2094.804) (-2103.326) [-2092.936] (-2094.421) * (-2098.283) [-2101.146] (-2110.257) (-2100.449) -- 0:00:08 971000 -- (-2097.245) (-2097.011) (-2095.668) [-2093.759] * [-2099.249] (-2100.372) (-2090.568) (-2099.240) -- 0:00:08 971500 -- [-2094.200] (-2097.427) (-2095.895) (-2102.177) * (-2093.548) (-2096.758) (-2097.153) [-2101.289] -- 0:00:08 972000 -- (-2104.182) (-2102.759) [-2101.980] (-2097.515) * [-2092.735] (-2103.381) (-2100.114) (-2102.805) -- 0:00:08 972500 -- (-2107.469) [-2097.405] (-2095.697) (-2094.779) * [-2096.909] (-2094.086) (-2099.216) (-2105.505) -- 0:00:08 973000 -- (-2111.391) (-2096.625) [-2090.921] (-2104.475) * (-2095.242) (-2095.131) (-2099.638) [-2094.577] -- 0:00:08 973500 -- (-2095.893) (-2094.199) (-2101.975) [-2098.366] * [-2091.224] (-2095.028) (-2087.284) (-2107.683) -- 0:00:07 974000 -- (-2092.989) (-2097.369) [-2095.672] (-2095.807) * (-2094.437) (-2099.119) [-2090.290] (-2095.289) -- 0:00:07 974500 -- (-2096.236) [-2096.114] (-2106.671) (-2102.132) * [-2093.404] (-2091.757) (-2096.338) (-2096.756) -- 0:00:07 975000 -- (-2108.824) (-2099.827) (-2100.448) [-2096.599] * (-2095.313) (-2093.505) [-2090.822] (-2102.801) -- 0:00:07 Average standard deviation of split frequencies: 0.001449 975500 -- (-2112.851) [-2098.854] (-2098.566) (-2094.685) * (-2100.115) (-2100.745) (-2104.383) [-2093.359] -- 0:00:07 976000 -- (-2096.614) (-2101.944) [-2093.232] (-2099.162) * [-2095.528] (-2100.448) (-2092.580) (-2096.003) -- 0:00:07 976500 -- (-2102.930) (-2092.859) [-2091.807] (-2108.536) * [-2096.639] (-2089.637) (-2095.498) (-2095.479) -- 0:00:07 977000 -- (-2097.373) (-2097.349) (-2101.298) [-2097.075] * (-2098.202) (-2097.373) [-2094.388] (-2100.372) -- 0:00:06 977500 -- [-2097.464] (-2100.304) (-2099.307) (-2099.571) * (-2095.201) [-2092.836] (-2092.901) (-2097.263) -- 0:00:06 978000 -- (-2095.102) (-2100.392) (-2095.638) [-2097.978] * [-2095.845] (-2097.677) (-2097.200) (-2091.654) -- 0:00:06 978500 -- (-2094.542) (-2101.148) (-2096.741) [-2097.415] * (-2104.443) (-2100.923) [-2100.261] (-2097.868) -- 0:00:06 979000 -- (-2093.940) [-2095.787] (-2102.986) (-2103.485) * (-2103.368) (-2094.020) (-2106.441) [-2094.976] -- 0:00:06 979500 -- [-2098.796] (-2099.004) (-2099.177) (-2101.095) * (-2099.886) (-2093.157) [-2095.810] (-2095.442) -- 0:00:06 980000 -- [-2097.048] (-2097.195) (-2097.351) (-2099.712) * (-2096.634) (-2099.875) (-2093.343) [-2091.465] -- 0:00:06 Average standard deviation of split frequencies: 0.001562 980500 -- [-2089.793] (-2091.606) (-2099.746) (-2103.467) * (-2108.068) (-2092.149) (-2103.626) [-2100.122] -- 0:00:05 981000 -- (-2088.254) (-2097.259) (-2108.465) [-2094.584] * [-2093.747] (-2097.616) (-2102.189) (-2094.506) -- 0:00:05 981500 -- [-2097.815] (-2098.186) (-2094.638) (-2095.819) * (-2092.098) (-2092.231) [-2101.862] (-2097.216) -- 0:00:05 982000 -- [-2098.004] (-2105.997) (-2091.784) (-2092.334) * (-2103.430) (-2093.407) (-2091.470) [-2095.413] -- 0:00:05 982500 -- (-2098.739) (-2093.662) [-2093.378] (-2099.309) * (-2098.200) (-2096.705) (-2098.015) [-2096.087] -- 0:00:05 983000 -- (-2099.089) (-2100.202) (-2098.228) [-2094.602] * (-2100.777) [-2099.156] (-2100.983) (-2096.472) -- 0:00:05 983500 -- (-2099.349) [-2105.655] (-2092.669) (-2095.847) * (-2104.139) (-2091.391) [-2088.909] (-2098.877) -- 0:00:04 984000 -- (-2095.929) (-2104.273) [-2092.852] (-2096.802) * (-2110.476) [-2094.127] (-2093.079) (-2096.450) -- 0:00:04 984500 -- [-2091.882] (-2099.198) (-2099.569) (-2095.921) * (-2101.781) (-2095.223) (-2102.922) [-2096.405] -- 0:00:04 985000 -- (-2092.929) (-2097.978) [-2106.356] (-2102.654) * (-2099.576) (-2093.340) [-2098.145] (-2095.257) -- 0:00:04 Average standard deviation of split frequencies: 0.001793 985500 -- (-2100.449) [-2102.795] (-2102.666) (-2097.869) * (-2093.837) (-2099.767) (-2099.916) [-2089.690] -- 0:00:04 986000 -- [-2094.190] (-2097.848) (-2105.589) (-2101.407) * [-2096.328] (-2100.321) (-2097.344) (-2094.162) -- 0:00:04 986500 -- (-2096.820) [-2096.159] (-2097.957) (-2098.496) * [-2095.257] (-2098.108) (-2100.548) (-2092.811) -- 0:00:04 987000 -- (-2094.887) (-2091.476) (-2097.115) [-2097.618] * [-2095.155] (-2100.454) (-2094.883) (-2096.522) -- 0:00:03 987500 -- (-2100.571) (-2097.488) [-2098.496] (-2094.453) * (-2101.226) [-2093.922] (-2092.117) (-2096.189) -- 0:00:03 988000 -- (-2093.079) (-2092.139) [-2096.155] (-2097.406) * (-2100.248) [-2095.018] (-2103.872) (-2097.457) -- 0:00:03 988500 -- (-2101.053) (-2093.552) (-2095.741) [-2096.321] * (-2099.680) (-2100.151) (-2105.227) [-2099.968] -- 0:00:03 989000 -- (-2091.718) [-2091.180] (-2096.354) (-2090.913) * (-2098.454) (-2102.469) [-2092.366] (-2095.770) -- 0:00:03 989500 -- (-2093.880) (-2095.360) (-2110.722) [-2094.484] * (-2100.989) [-2095.230] (-2102.696) (-2104.255) -- 0:00:03 990000 -- (-2095.384) [-2100.625] (-2095.320) (-2102.135) * (-2100.016) (-2099.089) [-2093.051] (-2101.892) -- 0:00:03 Average standard deviation of split frequencies: 0.001428 990500 -- (-2094.104) (-2101.393) (-2096.649) [-2094.263] * (-2090.842) [-2097.809] (-2100.446) (-2094.117) -- 0:00:02 991000 -- (-2099.463) (-2099.605) (-2098.599) [-2092.394] * [-2098.330] (-2103.685) (-2099.542) (-2095.443) -- 0:00:02 991500 -- [-2097.250] (-2096.670) (-2098.524) (-2103.293) * [-2100.930] (-2101.178) (-2103.666) (-2095.265) -- 0:00:02 992000 -- [-2091.423] (-2096.288) (-2096.262) (-2094.947) * (-2097.641) [-2098.070] (-2097.966) (-2092.938) -- 0:00:02 992500 -- [-2094.018] (-2094.037) (-2098.907) (-2093.355) * (-2091.869) (-2095.321) (-2094.000) [-2091.153] -- 0:00:02 993000 -- (-2100.162) (-2099.433) (-2095.625) [-2096.096] * [-2090.916] (-2095.349) (-2100.787) (-2091.653) -- 0:00:02 993500 -- [-2098.836] (-2099.682) (-2094.201) (-2094.032) * (-2094.462) (-2098.561) (-2096.114) [-2089.812] -- 0:00:01 994000 -- (-2108.442) (-2097.361) (-2100.859) [-2095.167] * (-2103.185) (-2093.568) (-2097.708) [-2095.313] -- 0:00:01 994500 -- (-2090.935) (-2096.934) (-2102.520) [-2095.922] * (-2090.663) (-2098.286) [-2097.059] (-2092.633) -- 0:00:01 995000 -- (-2094.263) [-2095.636] (-2097.679) (-2097.315) * [-2101.521] (-2101.165) (-2094.274) (-2096.135) -- 0:00:01 Average standard deviation of split frequencies: 0.001065 995500 -- (-2097.593) (-2092.191) [-2098.946] (-2092.009) * (-2095.894) (-2096.723) (-2102.209) [-2101.672] -- 0:00:01 996000 -- (-2099.396) (-2094.673) [-2094.000] (-2098.083) * (-2095.977) (-2096.030) (-2103.621) [-2099.785] -- 0:00:01 996500 -- (-2098.218) (-2095.422) [-2097.406] (-2096.348) * (-2097.942) [-2095.597] (-2094.290) (-2102.203) -- 0:00:01 997000 -- (-2094.890) (-2092.320) (-2093.497) [-2099.494] * (-2101.228) [-2094.663] (-2091.041) (-2098.773) -- 0:00:00 997500 -- (-2093.091) (-2093.272) (-2093.840) [-2090.190] * [-2097.293] (-2088.748) (-2095.803) (-2098.462) -- 0:00:00 998000 -- (-2109.543) (-2092.696) (-2098.989) [-2093.464] * (-2104.508) (-2092.760) (-2097.901) [-2101.987] -- 0:00:00 998500 -- [-2096.647] (-2092.584) (-2098.973) (-2096.241) * (-2096.167) (-2099.659) [-2091.752] (-2100.019) -- 0:00:00 999000 -- [-2097.598] (-2095.023) (-2095.651) (-2098.035) * (-2095.933) (-2093.308) [-2093.600] (-2104.781) -- 0:00:00 999500 -- (-2096.970) [-2095.694] (-2095.577) (-2102.858) * [-2093.723] (-2098.817) (-2102.885) (-2105.438) -- 0:00:00 1000000 -- [-2099.535] (-2099.662) (-2100.525) (-2100.335) * (-2094.208) (-2090.858) (-2096.859) [-2096.873] -- 0:00:00 Average standard deviation of split frequencies: 0.001178 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2099.535313 -- 14.925937 Chain 1 -- -2099.535317 -- 14.925937 Chain 2 -- -2099.661543 -- 12.052250 Chain 2 -- -2099.661544 -- 12.052250 Chain 3 -- -2100.525358 -- 15.934089 Chain 3 -- -2100.525360 -- 15.934089 Chain 4 -- -2100.335396 -- 15.789885 Chain 4 -- -2100.335396 -- 15.789885 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2094.207530 -- 12.792689 Chain 1 -- -2094.207530 -- 12.792689 Chain 2 -- -2090.857830 -- 12.400754 Chain 2 -- -2090.857823 -- 12.400754 Chain 3 -- -2096.859329 -- 13.454462 Chain 3 -- -2096.859328 -- 13.454462 Chain 4 -- -2096.873132 -- 16.910170 Chain 4 -- -2096.873133 -- 16.910170 Analysis completed in 5 mins 1 seconds Analysis used 300.93 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2085.76 Likelihood of best state for "cold" chain of run 2 was -2085.76 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 51.5 % ( 39 %) Dirichlet(Revmat{all}) 66.5 % ( 45 %) Slider(Revmat{all}) 25.7 % ( 30 %) Dirichlet(Pi{all}) 28.1 % ( 22 %) Slider(Pi{all}) 55.0 % ( 32 %) Multiplier(Alpha{1,2}) 44.8 % ( 30 %) Multiplier(Alpha{3}) 49.1 % ( 31 %) Slider(Pinvar{all}) 4.7 % ( 6 %) ExtSPR(Tau{all},V{all}) 2.2 % ( 3 %) ExtTBR(Tau{all},V{all}) 5.0 % ( 5 %) NNI(Tau{all},V{all}) 7.0 % ( 7 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 29 %) Multiplier(V{all}) 38.0 % ( 42 %) Nodeslider(V{all}) 25.6 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 51.9 % ( 33 %) Dirichlet(Revmat{all}) 65.4 % ( 42 %) Slider(Revmat{all}) 25.8 % ( 34 %) Dirichlet(Pi{all}) 28.4 % ( 33 %) Slider(Pi{all}) 55.0 % ( 31 %) Multiplier(Alpha{1,2}) 43.6 % ( 37 %) Multiplier(Alpha{3}) 49.4 % ( 28 %) Slider(Pinvar{all}) 4.7 % ( 5 %) ExtSPR(Tau{all},V{all}) 2.2 % ( 0 %) ExtTBR(Tau{all},V{all}) 5.0 % ( 5 %) NNI(Tau{all},V{all}) 7.0 % ( 7 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 19 %) Multiplier(V{all}) 37.8 % ( 37 %) Nodeslider(V{all}) 25.7 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166554 0.82 0.67 3 | 166413 167140 0.84 4 | 166047 166881 166965 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.65 0.51 2 | 166408 0.83 0.67 3 | 167150 166379 0.84 4 | 166145 166828 167090 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2094.39 | 1 2 2 1 | | 1 2 * 2 1 | | 1 2 2 1 2 | | 2 * 1 1 2 2 22 | | 2 12 *1 * 11 2 2 11 112 1 1 | |1 2 21 1 21 *22 2 21 1 1 1 | | *12 1 2 1 21 1 2 21 2 2 2 1 1| | 1* 2 22 1 1 11 2 2 12 2 2 2| | 1 1 2 2 1 | | * 2 2 2 2 | | 2 2 1 2 1 | | 1 1 | | 1 1 1 | |2 | | 2 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2097.84 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2091.86 -2109.68 2 -2092.05 -2104.31 -------------------------------------- TOTAL -2091.95 -2108.99 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.595119 0.005995 0.450219 0.746304 0.588543 1163.59 1262.74 1.000 r(A<->C){all} 0.124925 0.001025 0.061693 0.185846 0.123012 789.39 934.88 1.001 r(A<->G){all} 0.249220 0.001852 0.169875 0.334516 0.246963 773.03 873.93 1.000 r(A<->T){all} 0.080162 0.001108 0.020768 0.144338 0.077337 706.00 781.90 1.001 r(C<->G){all} 0.056181 0.000346 0.023007 0.094871 0.054047 1019.80 1023.56 1.000 r(C<->T){all} 0.415210 0.002813 0.312582 0.522440 0.414621 526.58 648.06 1.001 r(G<->T){all} 0.074302 0.000575 0.029641 0.121435 0.072112 1128.21 1172.40 1.000 pi(A){all} 0.246813 0.000209 0.218702 0.274661 0.246554 1062.07 1140.81 1.001 pi(C){all} 0.265360 0.000211 0.236745 0.292729 0.265356 1175.72 1252.27 1.000 pi(G){all} 0.283722 0.000227 0.254777 0.313835 0.283485 1225.27 1251.85 1.000 pi(T){all} 0.204105 0.000179 0.178155 0.230790 0.203830 1181.20 1229.08 1.000 alpha{1,2} 0.063021 0.001241 0.000142 0.118538 0.065143 1195.55 1229.54 1.000 alpha{3} 2.634940 0.708362 1.188567 4.303611 2.522565 1094.45 1297.72 1.000 pinvar{all} 0.431065 0.003322 0.320603 0.541641 0.431538 1272.84 1313.87 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 Key to taxon bipartitions (saved to file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------- 1 -- .****** 2 -- .*..... 3 -- ..*.... 4 -- ...*... 5 -- ....*.. 6 -- .....*. 7 -- ......* 8 -- ...**** 9 -- .....** 10 -- .**.... 11 -- ....*** ------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 8 3002 1.000000 0.000000 1.000000 1.000000 2 9 2981 0.993005 0.000471 0.992672 0.993338 2 10 2933 0.977015 0.003298 0.974684 0.979347 2 11 2634 0.877415 0.000942 0.876749 0.878081 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.018492 0.000051 0.005710 0.031696 0.017645 1.000 2 length{all}[2] 0.019872 0.000046 0.008306 0.033640 0.018968 1.000 2 length{all}[3] 0.005208 0.000012 0.000100 0.011843 0.004569 1.000 2 length{all}[4] 0.041650 0.000147 0.020868 0.066444 0.040381 1.000 2 length{all}[5] 0.027243 0.000103 0.009316 0.047766 0.026031 1.001 2 length{all}[6] 0.175367 0.001769 0.097928 0.256944 0.171283 1.000 2 length{all}[7] 0.175650 0.001695 0.101775 0.257840 0.171208 1.000 2 length{all}[8] 0.038658 0.000132 0.019070 0.062429 0.037424 1.000 2 length{all}[9] 0.069318 0.000736 0.015669 0.120592 0.066956 1.000 2 length{all}[10] 0.009428 0.000027 0.000743 0.019539 0.008708 1.000 2 length{all}[11] 0.015917 0.000074 0.000748 0.032195 0.014842 1.001 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.001178 Maximum standard deviation of split frequencies = 0.003298 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------------------------------------ C4 (4) | | |-------100-------+ /------------------------------------ C5 (5) | | | + \--------88-------+ /------------------ C6 (6) | \--------99-------+ | \------------------ C7 (7) | | /------------------ C2 (2) \--------------------------98-------------------------+ \------------------ C3 (3) Phylogram (based on average branch lengths): /---- C1 (1) | | /---------- C4 (4) | | |--------+ /------ C5 (5) | | | + \---+ /------------------------------------------ C6 (6) | \----------------+ | \------------------------------------------ C7 (7) | | /----- C2 (2) \-+ \- C3 (3) |-----------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (14 trees sampled): 90 % credible set contains 2 trees 95 % credible set contains 3 trees 99 % credible set contains 5 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 7 ls = 819 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Sites with gaps or missing data are removed. 9 ambiguity characters in seq. 1 9 ambiguity characters in seq. 2 9 ambiguity characters in seq. 3 9 ambiguity characters in seq. 4 9 ambiguity characters in seq. 5 9 ambiguity characters in seq. 6 6 ambiguity characters in seq. 7 5 sites are removed. 16 17 271 272 273 Sequences read.. Counting site patterns.. 0:00 163 patterns at 268 / 268 sites (100.0%), 0:00 Counting codons.. 168 bytes for distance 159088 bytes for conP 22168 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 397720 bytes for conP, adjusted 0.033063 0.056337 0.066419 0.013977 0.053154 0.106956 0.231756 0.211206 0.013835 0.035105 0.007044 0.300000 1.300000 ntime & nrate & np: 11 2 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 13 lnL0 = -2261.159546 Iterating by ming2 Initial: fx= 2261.159546 x= 0.03306 0.05634 0.06642 0.01398 0.05315 0.10696 0.23176 0.21121 0.01383 0.03511 0.00704 0.30000 1.30000 1 h-m-p 0.0000 0.0012 303.4956 +++CYCCC 2238.556257 4 0.0008 28 | 0/13 2 h-m-p 0.0000 0.0002 778.4972 +YCYYYCC 2223.191672 6 0.0001 53 | 0/13 3 h-m-p 0.0000 0.0001 1855.1044 +CYCCC 2206.820175 4 0.0001 77 | 0/13 4 h-m-p 0.0001 0.0005 817.3599 +CYYCCCCC 2161.003238 7 0.0005 106 | 0/13 5 h-m-p 0.0000 0.0001 693.6518 +YYCCC 2157.043730 4 0.0000 129 | 0/13 6 h-m-p 0.0001 0.0012 331.0257 +CCCCC 2135.774366 4 0.0008 155 | 0/13 7 h-m-p 0.0000 0.0002 3330.7256 ++ 2056.246748 m 0.0002 171 | 0/13 8 h-m-p 0.0000 0.0000 8375.0305 h-m-p: 5.47278722e-22 2.73639361e-21 8.37503046e+03 2056.246748 .. | 0/13 9 h-m-p 0.0000 0.0001 1128.3874 ++ 2034.464398 m 0.0001 200 | 0/13 10 h-m-p 0.0000 0.0000 15547.5221 CYYYYC 2030.849225 5 0.0000 222 | 0/13 11 h-m-p 0.0001 0.0004 422.8121 +YYYCYCCCC 2001.982998 8 0.0002 251 | 0/13 12 h-m-p 0.0001 0.0003 334.5906 CCCC 1999.430402 3 0.0001 273 | 0/13 13 h-m-p 0.0001 0.0005 386.1037 +YCYYCCC 1980.416392 6 0.0004 300 | 0/13 14 h-m-p 0.0003 0.0015 42.1737 YYC 1980.204085 2 0.0002 318 | 0/13 15 h-m-p 0.0003 0.0076 39.5147 +YCCC 1979.884640 3 0.0007 340 | 0/13 16 h-m-p 0.0005 0.0027 29.3830 YCC 1979.811522 2 0.0003 359 | 0/13 17 h-m-p 0.0006 0.0594 15.1417 ++CCC 1979.050938 2 0.0093 381 | 0/13 18 h-m-p 0.0015 0.0248 94.3212 CYCC 1978.160176 3 0.0020 402 | 0/13 19 h-m-p 0.0022 0.0110 78.2922 YCYC 1977.591630 3 0.0015 422 | 0/13 20 h-m-p 0.0059 0.0296 13.7724 CCC 1977.499347 2 0.0017 442 | 0/13 21 h-m-p 0.0911 0.7475 0.2509 +YYYCC 1973.989897 4 0.3470 464 | 0/13 22 h-m-p 0.0007 0.0037 47.7350 +YYCCCC 1968.181288 5 0.0024 502 | 0/13 23 h-m-p 0.0380 0.1901 0.2783 +YCYCCC 1965.666187 5 0.1152 527 | 0/13 24 h-m-p 0.2380 2.7443 0.1348 YCCC 1963.952050 3 0.5206 561 | 0/13 25 h-m-p 0.8581 5.7869 0.0818 CCC 1963.705119 2 0.7264 594 | 0/13 26 h-m-p 1.3530 7.3509 0.0439 YYC 1963.561769 2 1.1879 625 | 0/13 27 h-m-p 1.6000 8.0000 0.0141 C 1963.420066 0 1.6000 654 | 0/13 28 h-m-p 1.6000 8.0000 0.0126 +YCCC 1962.983947 3 4.9644 689 | 0/13 29 h-m-p 1.6000 8.0000 0.0090 CCC 1962.745383 2 1.6179 722 | 0/13 30 h-m-p 1.0357 8.0000 0.0141 CCC 1962.662434 2 1.5410 755 | 0/13 31 h-m-p 1.6000 8.0000 0.0042 YC 1962.641957 1 1.1264 785 | 0/13 32 h-m-p 1.6000 8.0000 0.0017 YC 1962.639311 1 1.1770 815 | 0/13 33 h-m-p 1.6000 8.0000 0.0004 YC 1962.638963 1 1.0912 845 | 0/13 34 h-m-p 0.5039 8.0000 0.0010 Y 1962.638928 0 0.9843 874 | 0/13 35 h-m-p 1.6000 8.0000 0.0002 Y 1962.638927 0 1.0062 903 | 0/13 36 h-m-p 1.6000 8.0000 0.0000 Y 1962.638927 0 1.0289 932 | 0/13 37 h-m-p 1.0045 8.0000 0.0000 C 1962.638927 0 1.1706 961 | 0/13 38 h-m-p 1.6000 8.0000 0.0000 Y 1962.638927 0 0.9510 990 | 0/13 39 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/13 40 h-m-p 0.0160 8.0000 0.0003 ------------- | 0/13 41 h-m-p 0.0160 8.0000 0.0003 ------------- Out.. lnL = -1962.638927 1114 lfun, 1114 eigenQcodon, 12254 P(t) Time used: 0:05 Model 1: NearlyNeutral TREE # 1 (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 0.033063 0.056337 0.066419 0.013977 0.053154 0.106956 0.231756 0.211206 0.013835 0.035105 0.007044 1.700566 0.534390 0.193110 ntime & nrate & np: 11 2 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.291335 np = 14 lnL0 = -2058.102507 Iterating by ming2 Initial: fx= 2058.102507 x= 0.03306 0.05634 0.06642 0.01398 0.05315 0.10696 0.23176 0.21121 0.01383 0.03511 0.00704 1.70057 0.53439 0.19311 1 h-m-p 0.0000 0.0012 301.9865 ++++ 2010.837306 m 0.0012 35 | 1/14 2 h-m-p 0.0002 0.0010 288.8362 YCCCCC 1999.076104 5 0.0004 75 | 0/14 3 h-m-p 0.0000 0.0000 3693.8666 CCCC 1996.239391 3 0.0000 111 | 0/14 4 h-m-p 0.0002 0.0010 79.2584 +YYCCCC 1993.950531 5 0.0007 151 | 0/14 5 h-m-p 0.0002 0.0008 148.2109 YCCCC 1992.598875 4 0.0003 189 | 0/14 6 h-m-p 0.0002 0.0009 108.2305 YCCCC 1991.684044 4 0.0004 227 | 0/14 7 h-m-p 0.0006 0.0030 20.3694 YCC 1991.632839 2 0.0003 261 | 0/14 8 h-m-p 0.0006 0.0159 8.5061 YC 1991.572340 1 0.0013 293 | 0/14 9 h-m-p 0.0004 0.0062 29.8811 YC 1991.438426 1 0.0008 325 | 0/14 10 h-m-p 0.0014 0.0267 18.7292 +CYC 1990.898183 2 0.0052 360 | 0/14 11 h-m-p 0.0007 0.0074 132.8225 +YCC 1989.333435 2 0.0022 395 | 0/14 12 h-m-p 0.0015 0.0133 195.4549 +CYCCC 1981.302346 4 0.0071 434 | 0/14 13 h-m-p 0.0027 0.0136 58.5229 YCCC 1980.780600 3 0.0016 470 | 0/14 14 h-m-p 0.0160 0.0798 4.6271 YCC 1980.083294 2 0.0123 504 | 0/14 15 h-m-p 0.0050 0.0344 11.3823 +YCYYCCC 1962.089798 6 0.0296 546 | 0/14 16 h-m-p 0.1448 0.7242 1.8345 +YYYCCC 1953.036623 5 0.5329 585 | 0/14 17 h-m-p 0.1184 0.5922 5.0009 CYCCCC 1947.792936 5 0.2181 625 | 0/14 18 h-m-p 0.1437 0.7186 0.9064 CCCC 1946.927541 3 0.2130 662 | 0/14 19 h-m-p 1.1488 8.0000 0.1680 YCCC 1946.193227 3 0.5564 698 | 0/14 20 h-m-p 1.6000 8.0000 0.0511 YC 1946.092629 1 0.7785 730 | 0/14 21 h-m-p 1.2785 6.3924 0.0116 CC 1946.072622 1 0.4090 763 | 0/14 22 h-m-p 0.3835 8.0000 0.0124 CC 1946.054695 1 0.5385 796 | 0/14 23 h-m-p 1.2581 8.0000 0.0053 CC 1946.048865 1 0.4297 829 | 0/14 24 h-m-p 0.3316 8.0000 0.0069 +CC 1946.044019 1 1.1488 863 | 0/14 25 h-m-p 0.4814 8.0000 0.0164 C 1946.043197 0 0.4289 894 | 0/14 26 h-m-p 1.6000 8.0000 0.0018 YC 1946.043111 1 0.7826 926 | 0/14 27 h-m-p 1.6000 8.0000 0.0005 C 1946.043099 0 0.5625 957 | 0/14 28 h-m-p 1.6000 8.0000 0.0001 Y 1946.043099 0 0.7778 988 | 0/14 29 h-m-p 1.5024 8.0000 0.0000 Y 1946.043099 0 0.8653 1019 | 0/14 30 h-m-p 1.6000 8.0000 0.0000 Y 1946.043099 0 0.6401 1050 | 0/14 31 h-m-p 1.6000 8.0000 0.0000 C 1946.043099 0 0.3516 1081 | 0/14 32 h-m-p 0.5694 8.0000 0.0000 C 1946.043099 0 0.5694 1112 | 0/14 33 h-m-p 1.3865 8.0000 0.0000 -C 1946.043099 0 0.0867 1144 Out.. lnL = -1946.043099 1145 lfun, 3435 eigenQcodon, 25190 P(t) Time used: 0:15 Model 2: PositiveSelection TREE # 1 (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 initial w for M2:NSpselection reset. 0.033063 0.056337 0.066419 0.013977 0.053154 0.106956 0.231756 0.211206 0.013835 0.035105 0.007044 1.735938 1.131355 0.291249 0.418683 2.981222 ntime & nrate & np: 11 3 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.717398 np = 16 lnL0 = -2110.175570 Iterating by ming2 Initial: fx= 2110.175570 x= 0.03306 0.05634 0.06642 0.01398 0.05315 0.10696 0.23176 0.21121 0.01383 0.03511 0.00704 1.73594 1.13136 0.29125 0.41868 2.98122 1 h-m-p 0.0000 0.0038 285.3045 ++CCYC 2105.505168 3 0.0002 44 | 0/16 2 h-m-p 0.0001 0.0003 225.7371 +YYYC 2099.330302 3 0.0002 83 | 0/16 3 h-m-p 0.0000 0.0002 1122.8242 ++ 2071.987741 m 0.0002 118 | 0/16 4 h-m-p 0.0000 0.0000 11478.7133 h-m-p: 3.79273751e-22 1.89636876e-21 1.14787133e+04 2071.987741 .. | 0/16 5 h-m-p 0.0000 0.0009 1791.2900 YCYCCC 2063.007256 5 0.0000 193 | 0/16 6 h-m-p 0.0001 0.0008 231.5056 ++ 2023.581418 m 0.0008 228 | 1/16 7 h-m-p 0.0004 0.0020 234.1615 +YCCCC 2013.487962 4 0.0010 271 | 1/16 8 h-m-p 0.0003 0.0017 398.9919 YCYC 2006.815132 3 0.0006 309 | 1/16 9 h-m-p 0.0001 0.0005 501.0159 +YCCCC 2002.157629 4 0.0003 351 | 1/16 10 h-m-p 0.0002 0.0010 184.5562 CCCC 2000.212449 3 0.0004 391 | 1/16 11 h-m-p 0.0006 0.0029 112.1003 YCCCCC 1997.158287 5 0.0011 434 | 1/16 12 h-m-p 0.0004 0.0020 211.7446 +YCYCCC 1991.715679 5 0.0011 477 | 1/16 13 h-m-p 0.0005 0.0023 152.2078 YCCC 1990.767906 3 0.0004 516 | 1/16 14 h-m-p 0.0004 0.0055 131.0102 +CCCCC 1986.813153 4 0.0018 559 | 1/16 15 h-m-p 0.0003 0.0014 80.6599 YYC 1986.571663 2 0.0002 595 | 0/16 16 h-m-p 0.0003 0.0175 58.1142 YCCC 1986.500997 3 0.0000 634 | 0/16 17 h-m-p 0.0002 0.0603 12.0846 ++YC 1985.796657 1 0.0080 672 | 0/16 18 h-m-p 0.0042 0.1121 23.1610 ++CYYCCC 1973.958750 5 0.0854 717 | 0/16 19 h-m-p 0.1183 0.5913 7.9029 +YYCCC 1958.646873 4 0.4035 759 | 0/16 20 h-m-p 0.1820 0.9101 3.1366 YYCC 1956.919084 3 0.1463 798 | 0/16 21 h-m-p 0.1440 0.8681 3.1875 CCCCC 1954.205257 4 0.1771 841 | 0/16 22 h-m-p 0.3140 1.5702 1.0708 YCCC 1951.963503 3 0.6032 881 | 0/16 23 h-m-p 0.1285 0.6426 1.6239 CCCC 1950.480626 3 0.1957 922 | 0/16 24 h-m-p 0.4900 4.0905 0.6485 +YCC 1949.269822 2 1.5853 961 | 0/16 25 h-m-p 1.0149 5.4785 1.0129 YCCCC 1947.504911 4 1.8283 1003 | 0/16 26 h-m-p 1.0153 5.0765 0.5320 CCCC 1947.043968 3 1.1128 1044 | 0/16 27 h-m-p 1.6000 8.0000 0.2883 YCC 1946.778507 2 0.7548 1082 | 0/16 28 h-m-p 0.6986 8.0000 0.3115 +YCC 1946.516020 2 2.0884 1121 | 0/16 29 h-m-p 1.0813 8.0000 0.6016 CC 1946.347684 1 1.6023 1158 | 0/16 30 h-m-p 1.6000 8.0000 0.4534 CC 1946.265282 1 1.9503 1195 | 0/16 31 h-m-p 1.4387 8.0000 0.6146 YCCC 1946.159036 3 2.4910 1235 | 0/16 32 h-m-p 1.1342 8.0000 1.3498 YC 1946.111687 1 0.7409 1271 | 0/16 33 h-m-p 1.1705 8.0000 0.8543 CCC 1946.077385 2 1.6044 1310 | 0/16 34 h-m-p 1.6000 8.0000 0.7803 C 1946.062988 0 1.6000 1345 | 0/16 35 h-m-p 1.4703 8.0000 0.8492 CYC 1946.053955 2 1.6335 1383 | 0/16 36 h-m-p 1.3701 8.0000 1.0124 CC 1946.047659 1 1.7829 1420 | 0/16 37 h-m-p 1.6000 8.0000 0.8018 CY 1946.045200 1 2.0749 1457 | 0/16 38 h-m-p 1.6000 8.0000 0.8542 CY 1946.044095 1 2.0076 1494 | 0/16 39 h-m-p 1.6000 8.0000 0.8886 C 1946.043544 0 2.0100 1529 | 0/16 40 h-m-p 1.6000 8.0000 0.7976 C 1946.043302 0 2.0183 1564 | 0/16 41 h-m-p 1.6000 8.0000 0.7838 C 1946.043194 0 2.2600 1599 | 0/16 42 h-m-p 1.6000 8.0000 0.8492 C 1946.043141 0 1.9720 1634 | 0/16 43 h-m-p 1.6000 8.0000 0.7891 C 1946.043118 0 2.3642 1669 | 0/16 44 h-m-p 1.6000 8.0000 0.8016 C 1946.043107 0 2.1272 1704 | 0/16 45 h-m-p 1.6000 8.0000 0.8224 C 1946.043103 0 2.0388 1739 | 0/16 46 h-m-p 1.6000 8.0000 0.8552 C 1946.043101 0 2.1112 1774 | 0/16 47 h-m-p 1.6000 8.0000 0.8221 C 1946.043100 0 2.4372 1809 | 0/16 48 h-m-p 1.6000 8.0000 0.8604 Y 1946.043099 0 2.5849 1844 | 0/16 49 h-m-p 1.6000 8.0000 1.0001 Y 1946.043099 0 2.7182 1879 | 0/16 50 h-m-p 1.6000 8.0000 1.5430 Y 1946.043099 0 3.2045 1914 | 0/16 51 h-m-p 0.9327 8.0000 5.3009 Y 1946.043099 0 0.9327 1949 | 0/16 52 h-m-p 0.0070 0.2232 707.7451 Y 1946.043099 0 0.0070 1984 | 0/16 53 h-m-p 0.0149 0.1809 332.4488 ---C 1946.043099 0 0.0001 2022 | 0/16 54 h-m-p 0.0160 8.0000 1.3713 +++C 1946.043099 0 1.2222 2060 | 0/16 55 h-m-p 0.1465 8.0000 11.4378 --Y 1946.043099 0 0.0041 2097 | 0/16 56 h-m-p 0.0160 8.0000 3.6352 ---------Y 1946.043099 0 0.0000 2141 | 0/16 57 h-m-p 0.0160 8.0000 0.0000 ------------Y 1946.043099 0 0.0000 2188 Out.. lnL = -1946.043099 2189 lfun, 8756 eigenQcodon, 72237 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -1965.580772 S = -1904.283806 -52.249017 Calculating f(w|X), posterior probabilities of site classes. did 10 / 163 patterns 0:43 did 20 / 163 patterns 0:43 did 30 / 163 patterns 0:44 did 40 / 163 patterns 0:44 did 50 / 163 patterns 0:44 did 60 / 163 patterns 0:44 did 70 / 163 patterns 0:44 did 80 / 163 patterns 0:44 did 90 / 163 patterns 0:44 did 100 / 163 patterns 0:44 did 110 / 163 patterns 0:44 did 120 / 163 patterns 0:44 did 130 / 163 patterns 0:44 did 140 / 163 patterns 0:44 did 150 / 163 patterns 0:44 did 160 / 163 patterns 0:44 did 163 / 163 patterns 0:44 Time used: 0:44 Model 3: discrete TREE # 1 (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 0.033063 0.056337 0.066419 0.013977 0.053154 0.106956 0.231756 0.211206 0.013835 0.035105 0.007044 1.735938 0.960589 0.897086 0.023842 0.061331 0.083524 ntime & nrate & np: 11 4 17 Bounds (np=17): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 17.770824 np = 17 lnL0 = -1961.333524 Iterating by ming2 Initial: fx= 1961.333524 x= 0.03306 0.05634 0.06642 0.01398 0.05315 0.10696 0.23176 0.21121 0.01383 0.03511 0.00704 1.73594 0.96059 0.89709 0.02384 0.06133 0.08352 1 h-m-p 0.0000 0.0002 166.9865 +++ 1958.206870 m 0.0002 40 | 1/17 2 h-m-p 0.0001 0.0003 73.2271 CYCCC 1957.962967 4 0.0001 84 | 1/17 3 h-m-p 0.0001 0.0008 100.0802 YC 1957.575496 1 0.0002 121 | 1/17 4 h-m-p 0.0002 0.0043 84.2497 +YCCC 1956.686621 3 0.0006 163 | 1/17 5 h-m-p 0.0001 0.0006 367.5001 ++ 1951.219519 m 0.0006 199 | 2/17 6 h-m-p 0.0011 0.0057 59.8868 YCCC 1950.692575 3 0.0005 240 | 2/17 7 h-m-p 0.0006 0.0029 42.6136 YYC 1950.429148 2 0.0004 277 | 2/17 8 h-m-p 0.0005 0.0073 35.5237 YCCC 1950.167159 3 0.0010 317 | 2/17 9 h-m-p 0.0032 0.0159 8.4080 CC 1950.144758 1 0.0007 354 | 2/17 10 h-m-p 0.0003 0.0246 17.0170 CY 1950.124488 1 0.0004 391 | 2/17 11 h-m-p 0.0005 0.0317 13.0212 YC 1950.086095 1 0.0011 427 | 2/17 12 h-m-p 0.0014 0.1487 10.6163 ++YCC 1949.634977 2 0.0184 467 | 2/17 13 h-m-p 0.0008 0.0067 259.9179 CCCC 1948.972358 3 0.0011 508 | 2/17 14 h-m-p 0.0407 0.2037 2.8375 -CC 1948.958099 1 0.0029 546 | 2/17 15 h-m-p 0.0080 1.0515 1.0243 +++YCCC 1947.563631 3 0.3802 589 | 2/17 16 h-m-p 0.0586 0.2929 1.9132 YCCCC 1946.518140 4 0.1174 631 | 2/17 17 h-m-p 0.1065 0.8338 2.1094 +YCCC 1945.506949 3 0.2780 672 | 2/17 18 h-m-p 1.0137 5.0686 0.2603 YCCC 1945.246958 3 0.5078 712 | 2/17 19 h-m-p 1.0504 8.0000 0.1258 YCC 1945.169159 2 0.7109 750 | 1/17 20 h-m-p 0.0073 0.1346 12.3048 --C 1945.169028 0 0.0002 787 | 1/17 21 h-m-p 0.0616 8.0000 0.0317 ++CC 1945.156292 1 0.9126 827 | 0/17 22 h-m-p 0.0796 4.5505 0.3633 ----Y 1945.156284 0 0.0001 867 | 0/17 23 h-m-p 0.0020 1.0126 0.0329 +++++ 1945.152319 m 1.0126 907 | 1/17 24 h-m-p 1.1698 8.0000 0.0284 C 1945.151168 0 1.3434 944 | 0/17 25 h-m-p -0.0000 -0.0000 12203.3130 h-m-p: -1.00034539e-22 -5.00172695e-22 1.22033130e+04 1945.151168 .. | 1/17 26 h-m-p 0.0001 0.0454 0.9420 Y 1945.151141 0 0.0001 1014 | 1/17 27 h-m-p 0.0001 0.0352 0.8870 C 1945.151121 0 0.0001 1050 | 1/17 28 h-m-p 0.0004 0.0850 0.1725 C 1945.151116 0 0.0004 1086 | 0/17 29 h-m-p 0.0005 0.2639 0.4196 C 1945.151111 0 0.0001 1122 | 0/17 30 h-m-p 0.0001 0.0474 0.4264 C 1945.151111 0 0.0000 1159 | 0/17 31 h-m-p 0.0003 0.1621 0.4147 C 1945.151104 0 0.0004 1196 | 0/17 32 h-m-p 0.0003 0.0178 0.5244 Y 1945.151088 0 0.0005 1233 | 0/17 33 h-m-p 0.0004 0.1650 0.6161 Y 1945.151064 0 0.0010 1270 | 0/17 34 h-m-p 0.0005 0.0822 1.1310 Y 1945.151053 0 0.0003 1307 | 0/17 35 h-m-p 0.0006 0.0407 0.5575 Y 1945.151046 0 0.0003 1344 | 0/17 36 h-m-p 0.0030 0.5362 0.0525 -C 1945.151046 0 0.0003 1382 | 0/17 37 h-m-p 0.0002 0.1038 0.2916 C 1945.151045 0 0.0003 1419 | 0/17 38 h-m-p 0.0005 0.1387 0.1353 C 1945.151044 0 0.0002 1456 | 0/17 39 h-m-p 0.0001 0.0371 0.4530 ++++C 1945.150980 0 0.0171 1497 | 0/17 40 h-m-p 0.0004 0.0019 5.0232 ----------.. | 0/17 41 h-m-p 0.0000 0.0000 105.1524 C 1945.150980 0 0.0000 1579 | 0/17 42 h-m-p 0.0000 0.0038 0.5633 +C 1945.150976 0 0.0001 1617 | 0/17 43 h-m-p 0.0001 0.0308 0.2977 C 1945.150972 0 0.0001 1654 | 0/17 44 h-m-p 0.0001 0.0504 0.7606 C 1945.150963 0 0.0001 1691 | 0/17 45 h-m-p 0.0007 0.3527 0.7215 C 1945.150942 0 0.0003 1728 | 0/17 46 h-m-p 0.0014 0.7135 0.2049 C 1945.150938 0 0.0003 1765 | 0/17 47 h-m-p 0.0023 1.1602 0.0637 -Y 1945.150938 0 0.0003 1803 | 0/17 48 h-m-p 0.0051 1.8721 0.0036 ------------.. | 0/17 49 h-m-p 0.0000 0.0000 113.4104 --- Out.. lnL = -1945.150938 1889 lfun, 7556 eigenQcodon, 62337 P(t) Time used: 1:08 Model 7: beta TREE # 1 (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 0.033063 0.056337 0.066419 0.013977 0.053154 0.106956 0.231756 0.211206 0.013835 0.035105 0.007044 1.715314 0.496071 1.323761 ntime & nrate & np: 11 1 14 Bounds (np=14): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 11.009189 np = 14 lnL0 = -1997.680086 Iterating by ming2 Initial: fx= 1997.680086 x= 0.03306 0.05634 0.06642 0.01398 0.05315 0.10696 0.23176 0.21121 0.01383 0.03511 0.00704 1.71531 0.49607 1.32376 1 h-m-p 0.0000 0.0046 216.7930 ++CCCC 1994.824037 3 0.0002 41 | 0/14 2 h-m-p 0.0000 0.0002 204.9416 +YYYCCC 1991.869377 5 0.0002 80 | 0/14 3 h-m-p 0.0000 0.0002 837.6755 +CYYCCC 1979.061820 5 0.0002 120 | 0/14 4 h-m-p 0.0000 0.0001 3802.8982 +YYCYCCC 1958.270522 6 0.0001 161 | 0/14 5 h-m-p 0.0001 0.0005 104.4237 YCCCC 1957.370170 4 0.0002 199 | 0/14 6 h-m-p 0.0003 0.0014 35.4758 YYCC 1957.260954 3 0.0002 234 | 0/14 7 h-m-p 0.0002 0.0039 32.8111 +YC 1957.038802 1 0.0007 267 | 0/14 8 h-m-p 0.0003 0.0135 66.5662 ++YCCC 1954.602547 3 0.0040 305 | 0/14 9 h-m-p 0.0003 0.0017 143.0427 CCCCC 1953.960958 4 0.0005 344 | 0/14 10 h-m-p 0.0011 0.0054 51.5246 YYC 1953.635130 2 0.0008 377 | 0/14 11 h-m-p 0.0020 0.0124 21.9287 YC 1953.513132 1 0.0010 409 | 0/14 12 h-m-p 0.0194 0.2919 1.0900 CC 1953.190438 1 0.0287 442 | 0/14 13 h-m-p 0.0013 0.0474 23.4458 +YCCC 1950.297545 3 0.0093 479 | 0/14 14 h-m-p 0.0156 0.0779 8.1359 -YCC 1950.239056 2 0.0016 514 | 0/14 15 h-m-p 0.0073 1.6286 1.8037 ++CYCC 1949.675274 3 0.1637 552 | 0/14 16 h-m-p 0.2340 1.1702 0.2836 YCCCC 1947.999043 4 0.5304 590 | 0/14 17 h-m-p 1.1192 5.5962 0.0562 CCY 1947.636146 2 1.1065 625 | 0/14 18 h-m-p 0.4455 8.0000 0.1396 +CCC 1947.102308 2 1.8006 661 | 0/14 19 h-m-p 0.6299 3.8439 0.3991 +YYCYCC 1945.656188 5 2.1994 700 | 0/14 20 h-m-p 0.2433 1.2165 0.4297 YCCYC 1945.426389 4 0.4356 737 | 0/14 21 h-m-p 0.7744 8.0000 0.2417 YCCC 1945.326249 3 0.3576 773 | 0/14 22 h-m-p 0.4924 7.5665 0.1756 CCC 1945.268013 2 0.1639 808 | 0/14 23 h-m-p 0.9103 8.0000 0.0316 YC 1945.233404 1 1.5124 840 | 0/14 24 h-m-p 1.6000 8.0000 0.0129 YCC 1945.177879 2 2.9788 874 | 0/14 25 h-m-p 1.6000 8.0000 0.0202 YCC 1945.158345 2 1.1636 908 | 0/14 26 h-m-p 1.6000 8.0000 0.0062 YC 1945.156775 1 0.9258 940 | 0/14 27 h-m-p 1.6000 8.0000 0.0027 YC 1945.156687 1 0.9029 972 | 0/14 28 h-m-p 1.6000 8.0000 0.0003 Y 1945.156686 0 0.9728 1003 | 0/14 29 h-m-p 1.6000 8.0000 0.0000 Y 1945.156686 0 0.8263 1034 | 0/14 30 h-m-p 1.6000 8.0000 0.0000 Y 1945.156686 0 0.8405 1065 | 0/14 31 h-m-p 1.6000 8.0000 0.0000 ----Y 1945.156686 0 0.0016 1100 Out.. lnL = -1945.156686 1101 lfun, 12111 eigenQcodon, 121110 P(t) Time used: 1:56 Model 8: beta&w>1 TREE # 1 (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 initial w for M8:NSbetaw>1 reset. 0.033063 0.056337 0.066419 0.013977 0.053154 0.106956 0.231756 0.211206 0.013835 0.035105 0.007044 1.714481 0.900000 0.225525 1.016293 2.374037 ntime & nrate & np: 11 2 16 Bounds (np=16): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 9.009560 np = 16 lnL0 = -2000.424460 Iterating by ming2 Initial: fx= 2000.424460 x= 0.03306 0.05634 0.06642 0.01398 0.05315 0.10696 0.23176 0.21121 0.01383 0.03511 0.00704 1.71448 0.90000 0.22553 1.01629 2.37404 1 h-m-p 0.0000 0.0003 464.7637 +++ 1970.916259 m 0.0003 38 | 1/16 2 h-m-p 0.0001 0.0005 248.0099 +CYCCC 1959.215006 4 0.0004 81 | 1/16 3 h-m-p 0.0001 0.0003 379.8065 CYCCC 1957.335347 4 0.0001 122 | 1/16 4 h-m-p 0.0006 0.0031 37.2351 YCC 1957.075112 2 0.0004 159 | 0/16 5 h-m-p 0.0001 0.0030 119.7400 CYC 1956.154794 2 0.0001 196 | 0/16 6 h-m-p 0.0008 0.0113 21.0254 CCC 1956.017679 2 0.0007 235 | 0/16 7 h-m-p 0.0006 0.0116 21.3294 CC 1955.894341 1 0.0009 272 | 0/16 8 h-m-p 0.0014 0.0113 13.8834 YC 1955.852237 1 0.0007 308 | 0/16 9 h-m-p 0.0012 0.0345 8.3130 YC 1955.794398 1 0.0022 344 | 0/16 10 h-m-p 0.0008 0.0179 22.4957 YCC 1955.701304 2 0.0014 382 | 0/16 11 h-m-p 0.0011 0.0174 29.8649 +CYCCC 1954.966680 4 0.0078 425 | 0/16 12 h-m-p 0.0002 0.0012 474.5795 ++ 1952.305006 m 0.0012 460 | 0/16 13 h-m-p 0.0000 0.0000 181.6869 h-m-p: 0.00000000e+00 0.00000000e+00 1.81686928e+02 1952.305006 .. | 0/16 14 h-m-p 0.0000 0.0001 184.4852 +CYYCC 1950.482272 4 0.0001 535 | 0/16 15 h-m-p 0.0001 0.0003 246.1883 YCCCC 1948.097277 4 0.0001 577 | 0/16 16 h-m-p 0.0000 0.0002 209.9908 CCCC 1947.453471 3 0.0001 618 | 0/16 17 h-m-p 0.0003 0.0013 51.0793 YCC 1947.272198 2 0.0002 656 | 0/16 18 h-m-p 0.0003 0.0054 34.2082 YC 1947.106639 1 0.0004 692 | 0/16 19 h-m-p 0.0006 0.0058 24.2601 YCC 1947.024250 2 0.0005 730 | 0/16 20 h-m-p 0.0004 0.0022 18.7243 YYC 1946.987519 2 0.0004 767 | 0/16 21 h-m-p 0.0003 0.0030 23.4499 CC 1946.955649 1 0.0003 804 | 0/16 22 h-m-p 0.0011 0.0063 7.1800 YC 1946.945596 1 0.0006 840 | 0/16 23 h-m-p 0.0008 0.1699 5.5121 ++YC 1946.876139 1 0.0080 878 | 0/16 24 h-m-p 0.0003 0.0053 166.6251 YC 1946.747230 1 0.0005 914 | 0/16 25 h-m-p 0.0003 0.0059 242.7693 CCC 1946.534562 2 0.0005 953 | 0/16 26 h-m-p 0.0009 0.0046 107.7093 CCCC 1946.323771 3 0.0012 994 | 0/16 27 h-m-p 0.0096 0.0480 5.8397 CC 1946.309713 1 0.0020 1031 | 0/16 28 h-m-p 0.0047 0.2814 2.4783 +++ 1945.780552 m 0.2814 1067 | 1/16 29 h-m-p 0.0233 0.1163 2.1994 ++ 1945.308273 m 0.1163 1102 | 2/16 30 h-m-p 0.2926 7.4004 0.2562 CYC 1945.211487 2 0.3225 1139 | 2/16 31 h-m-p 0.4956 2.4780 0.1582 YYYC 1945.168218 3 0.4132 1175 | 2/16 32 h-m-p 1.6000 8.0000 0.0339 YC 1945.157224 1 0.6997 1209 | 2/16 33 h-m-p 1.6000 8.0000 0.0068 YC 1945.156797 1 1.0070 1243 | 2/16 34 h-m-p 1.6000 8.0000 0.0007 Y 1945.156786 0 0.9611 1276 | 2/16 35 h-m-p 1.6000 8.0000 0.0001 Y 1945.156786 0 1.0065 1309 | 2/16 36 h-m-p 1.6000 8.0000 0.0000 Y 1945.156786 0 0.7296 1342 | 2/16 37 h-m-p 1.6000 8.0000 0.0000 Y 1945.156786 0 0.2992 1375 | 2/16 38 h-m-p 0.4647 8.0000 0.0000 C 1945.156786 0 0.1162 1408 | 2/16 39 h-m-p 0.1312 8.0000 0.0000 ----------Y 1945.156786 0 0.0000 1451 Out.. lnL = -1945.156786 1452 lfun, 17424 eigenQcodon, 175692 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -1972.445088 S = -1904.961308 -58.746331 Calculating f(w|X), posterior probabilities of site classes. did 10 / 163 patterns 3:04 did 20 / 163 patterns 3:05 did 30 / 163 patterns 3:05 did 40 / 163 patterns 3:05 did 50 / 163 patterns 3:05 did 60 / 163 patterns 3:05 did 70 / 163 patterns 3:05 did 80 / 163 patterns 3:06 did 90 / 163 patterns 3:06 did 100 / 163 patterns 3:06 did 110 / 163 patterns 3:06 did 120 / 163 patterns 3:06 did 130 / 163 patterns 3:07 did 140 / 163 patterns 3:07 did 150 / 163 patterns 3:07 did 160 / 163 patterns 3:07 did 163 / 163 patterns 3:07 Time used: 3:07 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=273 D_melanogaster_aay-PA MSGSVLSLARPAAAT--NGHNLLTKQLNCNGNGTTGGAAKTTVASAITPP D_sechellia_aay-PA MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTDGAAKTTVASAITPP D_simulans_aay-PA MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP D_yakuba_aay-PA MSGSVLSLARPAAAA--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP D_erecta_aay-PA MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP D_takahashii_aay-PA MSGSVLSLARPAAAAATNGHNLLAKQLNCNGNGTAGVAAKTTVASAITPP D_eugracilis_aay-PA MSGSVLSLARPAAATA-NGHNLLAKQLNCNGNGTSGGAAKTTVASAITPP **************: ******:**********:. ************* D_melanogaster_aay-PA KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA D_sechellia_aay-PA KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA D_simulans_aay-PA KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA D_yakuba_aay-PA KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA D_erecta_aay-PA KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA D_takahashii_aay-PA KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA D_eugracilis_aay-PA KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA ************************************************** D_melanogaster_aay-PA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE D_sechellia_aay-PA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFFSHLKAE D_simulans_aay-PA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE D_yakuba_aay-PA MGGAMTFQDALKIRLNIIRPTQQQVRDFIEERPSTLSKNVKRFVSHLKAE D_erecta_aay-PA MGGAMTFQDALKIRLNIIRPTQRQVRDFIQERPSTLSKNVKRFVSHLKAE D_takahashii_aay-PA MGGAMTFQDALKIRLNIIRPSQQQVQDFIRERPSTLSKNVRRFVAHLKAE D_eugracilis_aay-PA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLTKNVKRFVAHLKAE ********************:*:**:***.******:***:**.:***** D_melanogaster_aay-PA GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQP D_sechellia_aay-PA GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP D_simulans_aay-PA GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP D_yakuba_aay-PA GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP D_erecta_aay-PA GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP D_takahashii_aay-PA GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP D_eugracilis_aay-PA GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP ****************************************:******.** D_melanogaster_aay-PA TSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNV D_sechellia_aay-PA TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV D_simulans_aay-PA TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV D_yakuba_aay-PA TSRSGGKAEAIALIRKENSDDALITMIGDGATDLEAVPPANYFIGFGGNV D_erecta_aay-PA TSRSGGKAEAIALIRKENNEDALITMIGDGATDLEAVPPANYFIGFGGNV D_takahashii_aay-PA TSRSGGKAEAIALIKQENSGDSLITMIGDGATDLEAVPPANYFIGFGGNV D_eugracilis_aay-PA TSRSGGKAEAIALIKKENNVDSLITMIGDGATDLEAVPPANYFIGFGGNV **************::**. *:**************************** D_melanogaster_aay-PA VRPEVYRRAQYYVTDFEQLMGQo D_sechellia_aay-PA VRPEVYRRAQYYVTDFEQLMGQo D_simulans_aay-PA VRPEVYRRAQYYVTDFEQLMGQo D_yakuba_aay-PA VRPEVYRRAQYYVTDFEQLMGQo D_erecta_aay-PA VRPEVYRRAQYYVTDFEQLMGQo D_takahashii_aay-PA VRPEVYRRAQYYVTDFEQLMo-- D_eugracilis_aay-PA VRPEVYRRAQYYVTDFEQLMGQ- ********************
>D_melanogaster_aay-PA ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGACCAAACAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGCGCGGCGAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAGTTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGTGGCAAGGGGAGCGAGGTGGCTCGCGTTACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATTCGCTTGAACAT CATACGGCCGACACAGCAGCAAGTGAGGGATTTCATCCAGGAGCGACCCA GTACACTGAGCAAAAACGTGAAGCGTTTCGTCAGCCATTTGAAGGCGGAG GGAAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA TGCTGTTCGATTATTTGGGCGAATACGATAGCTTTGATATCAACCAGCCC ACTTCGCGTTCCGGCGGAAAGGCAGAGGCTATCGCCCTGATAAGGAAGGA GAATAGCGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGATTTTGA GCAGCTGATGGGGCAG--- >D_sechellia_aay-PA ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA CCACCGATGGCGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAGCTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGTGGCAAGGGAAGTGAGGTGGCTCGCGTTACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGCTTGAACAT CATACGACCGACACAGCAGCAAGTGAGGGATTTTATCCAGGAGCGACCCA GTACACTGAGCAAAAACGTGAAACGTTTCTTCAGCCATTTGAAGGCGGAG GGCAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAATGTCTATGCCAACAAGA TGCTTTTCGATTATCTGGGCGACTATGATAGCTTTGATATCAACCAGCCC ACTTCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAACGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >D_simulans_aay-PA ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGCGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAGCTGGCGGCCAAGGTCATCCAGCAGTCACAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGCGGCAAGGGGAGCGAGGTGGCTCGCGTTACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGCTTGAACAT CATACGGCCGACACAGCAGCAAGTGAGGGATTTCATCCAGGAGCGACCCA GTACACTGAGCAAAAACGTGAAGCGTTTCGTCAGCCATTTGAAGGCGGAG GGCAAACAGGTTTACTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA TGCTTTTCGATTATCTGGGCGACTACGATAGCTTTGATATCAACCAGCCC ACTTCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAACGACGATTCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGTGCACAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >D_yakuba_aay-PA ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCGCA----- -AATGGCCATAATCTGCTGGCCAAGCAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGGGCGGCCAAAACCACTGTGGCCTCGGCCATAACGCCGCCC AAGCAGCCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGACTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAGTATTGTGGCAAGGGTAGCGAGGTGGCGCGCGTCACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTTAAAATCCGCTTGAACAT CATCAGGCCTACACAGCAGCAAGTGAGGGATTTCATTGAGGAGCGACCCA GTACACTGAGCAAAAACGTCAAGCGTTTCGTGAGCCACTTGAAGGCGGAG GGCAAACAGGTTTATTTGATATCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGAATTCCGCTGAAAAACGTGTATGCCAACAAGA TGCTCTTTGATTATCTGGGCGAATACGATAGCTTTGATATCAGCCAGCCG ACATCGCGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAGCGACGATGCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTCGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGGGCGCAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >D_erecta_aay-PA ATGAGCGGTTCCGTATTGAGTTTGGCGCGTCCTGCAGCAGCCACA----- -AATGGCCATAATCTGCTGGCCAAACAGCTGAATTGCAATGGCAATGGCA CCACCGGTGGGGCTGCCAAAACCACTGTGGCCTCGGCCATAACACCGCCC AAGCAGCCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTCTG TTTCGATGTGGATTCCACGGTGATTTGCGAGGAGGGCATCGACGAACTGG CCGAATATTGCGGCAAGGGTAGCGAGGTGGCCCGCGTCACCAAGGAGGCG ATGGGCGGTGCCATGACCTTCCAGGATGCCCTCAAAATCCGATTGAACAT CATTAGGCCCACACAGCGGCAAGTGAGGGATTTCATTCAAGAGCGACCCA GTACACTGAGCAAAAACGTGAAGCGTTTCGTGAGCCACTTGAAGGCGGAA GGCAAACAGGTTTATTTGATCTCCGGCGGATTCGATTGCCTAATTGCGCC CGTGGCCAATGAATTGGGTATTCCCCTGAAAAACGTCTATGCCAACAAGA TGCTGTTTGATTATCTAGGCGAATACGATAGCTTTGATATCAGCCAGCCC ACTTCTCGTTCCGGCGGCAAGGCAGAGGCCATCGCCCTGATAAGGAAGGA GAATAACGAAGACGCCCTAATCACCATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCAGCCAACTACTTTATAGGTTTTGGTGGCAATGTC GTGCGGCCGGAGGTCTATCGCCGAGCCCAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG--- >D_takahashii_aay-PA ATGAGCGGTTCCGTTTTAAGTTTGGCGCGTCCTGCAGCCGCAGCAGCCAC AAATGGCCATAATCTTCTGGCCAAACAGCTAAATTGCAATGGCAATGGCA CCGCAGGCGTGGCGGCCAAAACCACAGTGGCCTCGGCCATAACACCACCC AAACAACCCCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTTTG CTTCGATGTCGATTCAACGGTGATTTGCGAGGAGGGCATCGACGAGCTGG CCGAATATTGCGGCAAGGGCAGCGAGGTGGCGCGTGTCACCAAGGAGGCG ATGGGCGGGGCCATGACCTTCCAGGATGCCCTCAAAATCCGGCTGAACAT CATAAGGCCCTCGCAGCAGCAAGTGCAGGATTTCATTCGCGAACGACCCA GTACACTGAGCAAAAACGTGCGGCGTTTCGTGGCCCACCTGAAGGCGGAG GGCAAACAGGTTTATTTGATCTCCGGCGGATTCGATTGTCTCATCGCTCC GGTGGCCAATGAACTGGGCATTCCCCTGAAAAATGTCTATGCCAACAAGA TGCTGTTCGACTATTTGGGCGAATACGATAGCTTTGACATCACACAGCCC ACCTCGCGTTCCGGTGGAAAGGCCGAGGCCATCGCCCTGATAAAGCAGGA GAACAGCGGGGATTCCCTCATCACAATGATCGGCGATGGAGCCACCGATC TGGAGGCCGTACCGCCGGCCAACTATTTCATTGGCTTTGGGGGAAATGTT GTGCGACCGGAGGTCTATCGCCGGGCCCAGTATTACGTAACGGACTTTGA GCAGCTGATG--------- >D_eugracilis_aay-PA ATGAGCGGTTCCGTTTTGAGTTTGGCCCGTCCTGCAGCAGCCACAGCA-- -AATGGCCATAATCTTCTGGCCAAACAGCTCAACTGCAATGGCAATGGCA CCTCCGGAGGAGCGGCCAAAACCACTGTGGCCTCGGCCATAACACCACCC AAACAGCCTCAATTGGCGGCCAAGGTCATCCAGCAGTCGCAGATCGTTTG TTTCGATGTGGATTCCACAGTGATTTGCGAGGAGGGTATCGATGAGTTGG CCGAGTATTGCGGCAAAGGAAGTGAAGTGGCGCGTGTCACCAAGGAGGCG ATGGGCGGTGCCATGACCTTTCAGGATGCCCTTAAAATCAGATTGAACAT CATCCGGCCCACTCAACAGCAAGTAAGGGATTTCATCCAAGAGCGGCCCA GCACACTGACCAAAAACGTCAAGCGTTTCGTTGCCCACTTGAAGGCGGAG GGCAAACAAGTATATTTGATCTCCGGCGGTTTCGATTGCCTCATAGCACC AGTGGCCAACGAATTGGGTATTCCCCTGAAAAATGTTTATGCCAACAAGA TGCTGTTCGATTATTTGGGCGAATACGATAGCTTTGACATCACCCAGCCC ACATCACGTTCCGGCGGAAAGGCAGAGGCCATCGCCCTGATAAAGAAGGA GAATAATGTCGATTCTCTGATCACCATGATCGGCGATGGAGCCACCGATC TTGAGGCCGTACCGCCAGCTAACTATTTTATTGGATTTGGTGGCAATGTA GTACGACCGGAGGTCTATCGCCGGGCCCAGTATTACGTAACGGACTTTGA GCAGCTGATGGGGCAG---
>D_melanogaster_aay-PA MSGSVLSLARPAAAT--NGHNLLTKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQP TSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >D_sechellia_aay-PA MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTDGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFFSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >D_simulans_aay-PA MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGDYDSFDINQP TSRSGGKAEAIALIRKENNDDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >D_yakuba_aay-PA MSGSVLSLARPAAAA--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIEERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENSDDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >D_erecta_aay-PA MSGSVLSLARPAAAT--NGHNLLAKQLNCNGNGTTGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQRQVRDFIQERPSTLSKNVKRFVSHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDISQP TSRSGGKAEAIALIRKENNEDALITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ >D_takahashii_aay-PA MSGSVLSLARPAAAAATNGHNLLAKQLNCNGNGTAGVAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPSQQQVQDFIRERPSTLSKNVRRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKQENSGDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLM-- >D_eugracilis_aay-PA MSGSVLSLARPAAATA-NGHNLLAKQLNCNGNGTSGGAAKTTVASAITPP KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEA MGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLTKNVKRFVAHLKAE GKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDITQP TSRSGGKAEAIALIKKENNVDSLITMIGDGATDLEAVPPANYFIGFGGNV VRPEVYRRAQYYVTDFEQLMGQ
#NEXUS [ID: 6841426400] begin taxa; dimensions ntax=7; taxlabels D_melanogaster_aay-PA D_sechellia_aay-PA D_simulans_aay-PA D_yakuba_aay-PA D_erecta_aay-PA D_takahashii_aay-PA D_eugracilis_aay-PA ; end; begin trees; translate 1 D_melanogaster_aay-PA, 2 D_sechellia_aay-PA, 3 D_simulans_aay-PA, 4 D_yakuba_aay-PA, 5 D_erecta_aay-PA, 6 D_takahashii_aay-PA, 7 D_eugracilis_aay-PA ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01764524,(4:0.04038071,(5:0.02603125,(6:0.1712825,7:0.1712076)0.993:0.06695591)0.877:0.01484196)1.000:0.03742444,(2:0.01896798,3:0.004568629)0.977:0.008708176); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01764524,(4:0.04038071,(5:0.02603125,(6:0.1712825,7:0.1712076):0.06695591):0.01484196):0.03742444,(2:0.01896798,3:0.004568629):0.008708176); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2091.86 -2109.68 2 -2092.05 -2104.31 -------------------------------------- TOTAL -2091.95 -2108.99 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/2/aay-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.595119 0.005995 0.450219 0.746304 0.588543 1163.59 1262.74 1.000 r(A<->C){all} 0.124925 0.001025 0.061693 0.185846 0.123012 789.39 934.88 1.001 r(A<->G){all} 0.249220 0.001852 0.169875 0.334516 0.246963 773.03 873.93 1.000 r(A<->T){all} 0.080162 0.001108 0.020768 0.144338 0.077337 706.00 781.90 1.001 r(C<->G){all} 0.056181 0.000346 0.023007 0.094871 0.054047 1019.80 1023.56 1.000 r(C<->T){all} 0.415210 0.002813 0.312582 0.522440 0.414621 526.58 648.06 1.001 r(G<->T){all} 0.074302 0.000575 0.029641 0.121435 0.072112 1128.21 1172.40 1.000 pi(A){all} 0.246813 0.000209 0.218702 0.274661 0.246554 1062.07 1140.81 1.001 pi(C){all} 0.265360 0.000211 0.236745 0.292729 0.265356 1175.72 1252.27 1.000 pi(G){all} 0.283722 0.000227 0.254777 0.313835 0.283485 1225.27 1251.85 1.000 pi(T){all} 0.204105 0.000179 0.178155 0.230790 0.203830 1181.20 1229.08 1.000 alpha{1,2} 0.063021 0.001241 0.000142 0.118538 0.065143 1195.55 1229.54 1.000 alpha{3} 2.634940 0.708362 1.188567 4.303611 2.522565 1094.45 1297.72 1.000 pinvar{all} 0.431065 0.003322 0.320603 0.541641 0.431538 1272.84 1313.87 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/2/aay-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 7 ls = 268 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 4 3 4 5 3 | Ser TCT 0 0 0 0 1 0 | Tyr TAT 5 6 5 6 6 7 | Cys TGT 2 2 1 2 1 1 TTC 7 7 7 6 5 7 | TCC 5 5 5 4 4 4 | TAC 4 3 4 3 3 2 | TGC 3 3 4 3 4 4 Leu TTA 0 0 0 0 0 1 | TCA 0 0 1 0 0 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 8 6 6 7 7 4 | TCG 3 3 2 3 2 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 1 1 1 0 1 | Pro CCT 1 1 1 2 1 1 | His CAT 2 2 2 1 1 1 | Arg CGT 4 4 4 3 3 4 CTC 1 1 1 1 1 3 | CCC 6 6 6 4 7 6 | CAC 0 0 0 1 1 1 | CGC 3 3 3 3 2 2 CTA 2 2 2 2 3 1 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 2 3 3 | CGA 1 2 1 1 3 2 CTG 10 11 11 10 10 11 | CCG 4 4 4 5 3 4 | CAG 14 14 14 12 11 13 | CGG 2 1 2 2 2 3 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 4 3 3 4 5 4 | Thr ACT 2 2 2 1 2 0 | Asn AAT 8 9 8 8 8 8 | Ser AGT 2 3 2 2 2 2 ATC 10 11 11 10 10 11 | ACC 8 7 7 7 7 6 | AAC 6 6 7 5 6 5 | AGC 6 4 5 7 6 5 ATA 4 4 4 4 3 3 | ACA 4 4 4 3 4 5 | Lys AAA 6 6 5 5 6 7 | Arg AGA 0 0 0 0 0 0 Met ATG 6 6 6 6 6 6 | ACG 2 2 2 3 2 2 | AAG 9 9 10 10 9 7 | AGG 2 2 2 3 3 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 1 1 4 | Ala GCT 2 1 1 0 1 1 | Asp GAT 11 11 10 10 10 9 | Gly GGT 6 5 6 6 7 2 GTC 6 5 6 6 6 5 | GCC 13 16 16 17 19 19 | GAC 3 5 5 4 3 4 | GGC 12 13 13 12 13 14 GTA 3 3 3 3 3 2 | GCA 4 4 4 4 3 4 | Glu GAA 4 3 3 3 6 4 | GGA 4 4 3 4 2 4 GTG 8 8 8 9 9 9 | GCG 7 6 6 8 5 6 | GAG 11 11 11 13 10 11 | GGG 1 0 1 1 1 3 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------ Phe TTT 5 | Ser TCT 1 | Tyr TAT 7 | Cys TGT 1 TTC 5 | TCC 5 | TAC 2 | TGC 4 Leu TTA 0 | TCA 1 | *** TAA 0 | *** TGA 0 TTG 9 | TCG 2 | TAG 0 | Trp TGG 0 ------------------------------------------------------ Leu CTT 3 | Pro CCT 2 | His CAT 1 | Arg CGT 4 CTC 2 | CCC 5 | CAC 1 | CGC 1 CTA 0 | CCA 3 | Gln CAA 5 | CGA 1 CTG 7 | CCG 2 | CAG 10 | CGG 3 ------------------------------------------------------ Ile ATT 3 | Thr ACT 2 | Asn AAT 8 | Ser AGT 2 ATC 12 | ACC 8 | AAC 6 | AGC 3 ATA 3 | ACA 5 | Lys AAA 8 | Arg AGA 1 Met ATG 6 | ACG 1 | AAG 8 | AGG 1 ------------------------------------------------------ Val GTT 4 | Ala GCT 1 | Asp GAT 11 | Gly GGT 6 GTC 5 | GCC 18 | GAC 2 | GGC 11 GTA 6 | GCA 4 | Glu GAA 3 | GGA 6 GTG 5 | GCG 5 | GAG 12 | GGG 0 ------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_aay-PA position 1: T:0.14925 C:0.19403 A:0.29478 G:0.36194 position 2: T:0.27612 C:0.23134 A:0.31343 G:0.17910 position 3: T:0.20149 C:0.34701 A:0.12687 G:0.32463 Average T:0.20896 C:0.25746 A:0.24502 G:0.28856 #2: D_sechellia_aay-PA position 1: T:0.14552 C:0.20149 A:0.29104 G:0.36194 position 2: T:0.27612 C:0.23134 A:0.32090 G:0.17164 position 3: T:0.20896 C:0.35448 A:0.12687 G:0.30970 Average T:0.21020 C:0.26244 A:0.24627 G:0.28109 #3: D_simulans_aay-PA position 1: T:0.14179 C:0.20149 A:0.29104 G:0.36567 position 2: T:0.27612 C:0.23134 A:0.31716 G:0.17537 position 3: T:0.19030 C:0.37313 A:0.11940 G:0.31716 Average T:0.20274 C:0.26866 A:0.24254 G:0.28607 #4: D_yakuba_aay-PA position 1: T:0.14179 C:0.19030 A:0.29104 G:0.37687 position 2: T:0.27612 C:0.23134 A:0.30970 G:0.18284 position 3: T:0.19030 C:0.34701 A:0.11940 G:0.34328 Average T:0.20274 C:0.25622 A:0.24005 G:0.30100 #5: D_erecta_aay-PA position 1: T:0.14179 C:0.19403 A:0.29478 G:0.36940 position 2: T:0.27612 C:0.23134 A:0.30970 G:0.18284 position 3: T:0.20149 C:0.36194 A:0.13806 G:0.29851 Average T:0.20647 C:0.26244 A:0.24751 G:0.28358 #6: D_takahashii_aay-PA position 1: T:0.14179 C:0.21269 A:0.26866 G:0.37687 position 2: T:0.27985 C:0.23881 A:0.30597 G:0.17537 position 3: T:0.17910 C:0.36567 A:0.14179 G:0.31343 Average T:0.20025 C:0.27239 A:0.23881 G:0.28856 #7: D_eugracilis_aay-PA position 1: T:0.15672 C:0.18657 A:0.28731 G:0.36940 position 2: T:0.27985 C:0.24254 A:0.31343 G:0.16418 position 3: T:0.22761 C:0.33582 A:0.17164 G:0.26493 Average T:0.22139 C:0.25498 A:0.25746 G:0.26617 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 27 | Ser S TCT 2 | Tyr Y TAT 42 | Cys C TGT 10 TTC 44 | TCC 32 | TAC 21 | TGC 25 Leu L TTA 1 | TCA 3 | *** * TAA 0 | *** * TGA 0 TTG 47 | TCG 19 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 7 | Pro P CCT 9 | His H CAT 10 | Arg R CGT 26 CTC 10 | CCC 40 | CAC 4 | CGC 17 CTA 12 | CCA 9 | Gln Q CAA 16 | CGA 11 CTG 70 | CCG 26 | CAG 88 | CGG 15 ------------------------------------------------------------------------------ Ile I ATT 26 | Thr T ACT 11 | Asn N AAT 57 | Ser S AGT 15 ATC 75 | ACC 50 | AAC 41 | AGC 36 ATA 25 | ACA 29 | Lys K AAA 43 | Arg R AGA 1 Met M ATG 42 | ACG 14 | AAG 62 | AGG 14 ------------------------------------------------------------------------------ Val V GTT 16 | Ala A GCT 7 | Asp D GAT 72 | Gly G GGT 38 GTC 39 | GCC 118 | GAC 26 | GGC 88 GTA 23 | GCA 27 | Glu E GAA 26 | GGA 27 GTG 56 | GCG 43 | GAG 79 | GGG 7 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.14552 C:0.19723 A:0.28838 G:0.36887 position 2: T:0.27719 C:0.23401 A:0.31290 G:0.17591 position 3: T:0.19989 C:0.35501 A:0.13486 G:0.31023 Average T:0.20753 C:0.26208 A:0.24538 G:0.28500 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_aay-PA D_sechellia_aay-PA 0.0935 (0.0082 0.0879) D_simulans_aay-PA 0.0834 (0.0049 0.0591) 0.0682 (0.0033 0.0481) D_yakuba_aay-PA 0.0424 (0.0082 0.1940) 0.0735 (0.0140 0.1910) 0.0591 (0.0099 0.1673) D_erecta_aay-PA 0.0531 (0.0099 0.1865) 0.0609 (0.0124 0.2035) 0.0495 (0.0082 0.1665) 0.0513 (0.0082 0.1605) D_takahashii_aay-PA 0.0538 (0.0276 0.5127) 0.0622 (0.0336 0.5395) 0.0585 (0.0293 0.5012) 0.0560 (0.0276 0.4928) 0.0705 (0.0302 0.4287) D_eugracilis_aay-PA 0.0310 (0.0166 0.5350) 0.0359 (0.0191 0.5307) 0.0285 (0.0149 0.5229) 0.0411 (0.0199 0.4841) 0.0330 (0.0157 0.4764) 0.0384 (0.0208 0.5420) Model 0: one-ratio TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 check convergence.. lnL(ntime: 11 np: 13): -1962.638927 +0.000000 8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3 0.030149 0.063086 0.072072 0.024050 0.048761 0.117759 0.235205 0.208287 0.017093 0.035221 0.007566 1.700566 0.047684 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.85925 (1: 0.030149, (4: 0.072072, (5: 0.048761, (6: 0.235205, 7: 0.208287): 0.117759): 0.024050): 0.063086, (2: 0.035221, 3: 0.007566): 0.017093); (D_melanogaster_aay-PA: 0.030149, (D_yakuba_aay-PA: 0.072072, (D_erecta_aay-PA: 0.048761, (D_takahashii_aay-PA: 0.235205, D_eugracilis_aay-PA: 0.208287): 0.117759): 0.024050): 0.063086, (D_sechellia_aay-PA: 0.035221, D_simulans_aay-PA: 0.007566): 0.017093); Detailed output identifying parameters kappa (ts/tv) = 1.70057 omega (dN/dS) = 0.04768 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.030 615.8 188.2 0.0477 0.0018 0.0371 1.1 7.0 8..9 0.063 615.8 188.2 0.0477 0.0037 0.0777 2.3 14.6 9..4 0.072 615.8 188.2 0.0477 0.0042 0.0888 2.6 16.7 9..10 0.024 615.8 188.2 0.0477 0.0014 0.0296 0.9 5.6 10..5 0.049 615.8 188.2 0.0477 0.0029 0.0601 1.8 11.3 10..11 0.118 615.8 188.2 0.0477 0.0069 0.1450 4.3 27.3 11..6 0.235 615.8 188.2 0.0477 0.0138 0.2897 8.5 54.5 11..7 0.208 615.8 188.2 0.0477 0.0122 0.2565 7.5 48.3 8..12 0.017 615.8 188.2 0.0477 0.0010 0.0211 0.6 4.0 12..2 0.035 615.8 188.2 0.0477 0.0021 0.0434 1.3 8.2 12..3 0.008 615.8 188.2 0.0477 0.0004 0.0093 0.3 1.8 tree length for dN: 0.0505 tree length for dS: 1.0582 Time used: 0:05 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 lnL(ntime: 11 np: 14): -1946.043099 +0.000000 8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3 0.029744 0.062798 0.071404 0.025024 0.048485 0.112063 0.246049 0.222169 0.017008 0.034843 0.007521 1.735938 0.946661 0.013183 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.87711 (1: 0.029744, (4: 0.071404, (5: 0.048485, (6: 0.246049, 7: 0.222169): 0.112063): 0.025024): 0.062798, (2: 0.034843, 3: 0.007521): 0.017008); (D_melanogaster_aay-PA: 0.029744, (D_yakuba_aay-PA: 0.071404, (D_erecta_aay-PA: 0.048485, (D_takahashii_aay-PA: 0.246049, D_eugracilis_aay-PA: 0.222169): 0.112063): 0.025024): 0.062798, (D_sechellia_aay-PA: 0.034843, D_simulans_aay-PA: 0.007521): 0.017008); Detailed output identifying parameters kappa (ts/tv) = 1.73594 dN/dS (w) for site classes (K=2) p: 0.94666 0.05334 w: 0.01318 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.030 615.2 188.8 0.0658 0.0023 0.0348 1.4 6.6 8..9 0.063 615.2 188.8 0.0658 0.0048 0.0734 3.0 13.9 9..4 0.071 615.2 188.8 0.0658 0.0055 0.0835 3.4 15.8 9..10 0.025 615.2 188.8 0.0658 0.0019 0.0293 1.2 5.5 10..5 0.048 615.2 188.8 0.0658 0.0037 0.0567 2.3 10.7 10..11 0.112 615.2 188.8 0.0658 0.0086 0.1310 5.3 24.7 11..6 0.246 615.2 188.8 0.0658 0.0189 0.2876 11.6 54.3 11..7 0.222 615.2 188.8 0.0658 0.0171 0.2597 10.5 49.0 8..12 0.017 615.2 188.8 0.0658 0.0013 0.0199 0.8 3.8 12..2 0.035 615.2 188.8 0.0658 0.0027 0.0407 1.6 7.7 12..3 0.008 615.2 188.8 0.0658 0.0006 0.0088 0.4 1.7 Time used: 0:15 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 lnL(ntime: 11 np: 16): -1946.043099 +0.000000 8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3 0.029744 0.062798 0.071404 0.025024 0.048485 0.112064 0.246049 0.222169 0.017008 0.034843 0.007521 1.735938 0.946662 0.053338 0.013183 45.582814 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.87711 (1: 0.029744, (4: 0.071404, (5: 0.048485, (6: 0.246049, 7: 0.222169): 0.112064): 0.025024): 0.062798, (2: 0.034843, 3: 0.007521): 0.017008); (D_melanogaster_aay-PA: 0.029744, (D_yakuba_aay-PA: 0.071404, (D_erecta_aay-PA: 0.048485, (D_takahashii_aay-PA: 0.246049, D_eugracilis_aay-PA: 0.222169): 0.112064): 0.025024): 0.062798, (D_sechellia_aay-PA: 0.034843, D_simulans_aay-PA: 0.007521): 0.017008); Detailed output identifying parameters kappa (ts/tv) = 1.73594 dN/dS (w) for site classes (K=3) p: 0.94666 0.05334 0.00000 w: 0.01318 1.00000 45.58281 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.030 615.2 188.8 0.0658 0.0023 0.0348 1.4 6.6 8..9 0.063 615.2 188.8 0.0658 0.0048 0.0734 3.0 13.9 9..4 0.071 615.2 188.8 0.0658 0.0055 0.0835 3.4 15.8 9..10 0.025 615.2 188.8 0.0658 0.0019 0.0293 1.2 5.5 10..5 0.048 615.2 188.8 0.0658 0.0037 0.0567 2.3 10.7 10..11 0.112 615.2 188.8 0.0658 0.0086 0.1310 5.3 24.7 11..6 0.246 615.2 188.8 0.0658 0.0189 0.2876 11.6 54.3 11..7 0.222 615.2 188.8 0.0658 0.0171 0.2597 10.5 49.0 8..12 0.017 615.2 188.8 0.0658 0.0013 0.0199 0.8 3.8 12..2 0.035 615.2 188.8 0.0658 0.0027 0.0407 1.6 7.7 12..3 0.008 615.2 188.8 0.0658 0.0006 0.0088 0.4 1.7 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_aay-PA) Pr(w>1) post mean +- SE for w 15 T 0.536 1.308 +- 0.654 128 Q 0.558 1.343 +- 0.552 218 D 0.509 1.311 +- 0.476 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.850 0.106 0.021 0.008 0.004 0.003 0.002 0.002 0.002 0.002 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 0:44 Model 3: discrete (3 categories) TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 check convergence.. lnL(ntime: 11 np: 17): -1945.150938 +0.000000 8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3 0.029919 0.063027 0.071763 0.024733 0.048592 0.114043 0.243152 0.217008 0.017033 0.034993 0.007541 1.715314 0.455282 0.437034 0.000012 0.001887 0.511186 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.87180 (1: 0.029919, (4: 0.071763, (5: 0.048592, (6: 0.243152, 7: 0.217008): 0.114043): 0.024733): 0.063027, (2: 0.034993, 3: 0.007541): 0.017033); (D_melanogaster_aay-PA: 0.029919, (D_yakuba_aay-PA: 0.071763, (D_erecta_aay-PA: 0.048592, (D_takahashii_aay-PA: 0.243152, D_eugracilis_aay-PA: 0.217008): 0.114043): 0.024733): 0.063027, (D_sechellia_aay-PA: 0.034993, D_simulans_aay-PA: 0.007541): 0.017033); Detailed output identifying parameters kappa (ts/tv) = 1.71531 dN/dS (w) for site classes (K=3) p: 0.45528 0.43703 0.10768 w: 0.00001 0.00189 0.51119 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.030 615.5 188.5 0.0559 0.0020 0.0360 1.2 6.8 8..9 0.063 615.5 188.5 0.0559 0.0042 0.0758 2.6 14.3 9..4 0.072 615.5 188.5 0.0559 0.0048 0.0863 3.0 16.3 9..10 0.025 615.5 188.5 0.0559 0.0017 0.0297 1.0 5.6 10..5 0.049 615.5 188.5 0.0559 0.0033 0.0584 2.0 11.0 10..11 0.114 615.5 188.5 0.0559 0.0077 0.1371 4.7 25.8 11..6 0.243 615.5 188.5 0.0559 0.0163 0.2924 10.1 55.1 11..7 0.217 615.5 188.5 0.0559 0.0146 0.2610 9.0 49.2 8..12 0.017 615.5 188.5 0.0559 0.0011 0.0205 0.7 3.9 12..2 0.035 615.5 188.5 0.0559 0.0024 0.0421 1.4 7.9 12..3 0.008 615.5 188.5 0.0559 0.0005 0.0091 0.3 1.7 Naive Empirical Bayes (NEB) analysis Time used: 1:08 Model 7: beta (10 categories) TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 lnL(ntime: 11 np: 14): -1945.156686 +0.000000 8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3 0.029887 0.062966 0.071697 0.024733 0.048552 0.113899 0.243148 0.217117 0.017021 0.034963 0.007534 1.714481 0.031368 0.497484 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.87152 (1: 0.029887, (4: 0.071697, (5: 0.048552, (6: 0.243148, 7: 0.217117): 0.113899): 0.024733): 0.062966, (2: 0.034963, 3: 0.007534): 0.017021); (D_melanogaster_aay-PA: 0.029887, (D_yakuba_aay-PA: 0.071697, (D_erecta_aay-PA: 0.048552, (D_takahashii_aay-PA: 0.243148, D_eugracilis_aay-PA: 0.217117): 0.113899): 0.024733): 0.062966, (D_sechellia_aay-PA: 0.034963, D_simulans_aay-PA: 0.007534): 0.017021); Detailed output identifying parameters kappa (ts/tv) = 1.71448 Parameters in M7 (beta): p = 0.03137 q = 0.49748 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00040 0.02144 0.53565 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.030 615.5 188.5 0.0557 0.0020 0.0360 1.2 6.8 8..9 0.063 615.5 188.5 0.0557 0.0042 0.0758 2.6 14.3 9..4 0.072 615.5 188.5 0.0557 0.0048 0.0863 3.0 16.3 9..10 0.025 615.5 188.5 0.0557 0.0017 0.0298 1.0 5.6 10..5 0.049 615.5 188.5 0.0557 0.0033 0.0584 2.0 11.0 10..11 0.114 615.5 188.5 0.0557 0.0076 0.1370 4.7 25.8 11..6 0.243 615.5 188.5 0.0557 0.0163 0.2925 10.0 55.1 11..7 0.217 615.5 188.5 0.0557 0.0146 0.2612 9.0 49.2 8..12 0.017 615.5 188.5 0.0557 0.0011 0.0205 0.7 3.9 12..2 0.035 615.5 188.5 0.0557 0.0023 0.0421 1.4 7.9 12..3 0.008 615.5 188.5 0.0557 0.0005 0.0091 0.3 1.7 Time used: 1:56 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (4, (5, (6, 7))), (2, 3)); MP score: 186 lnL(ntime: 11 np: 16): -1945.156786 +0.000000 8..1 8..9 9..4 9..10 10..5 10..11 11..6 11..7 8..12 12..2 12..3 0.029887 0.062966 0.071698 0.024733 0.048552 0.113899 0.243148 0.217118 0.017021 0.034963 0.007534 1.714484 0.999990 0.031365 0.497477 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.87152 (1: 0.029887, (4: 0.071698, (5: 0.048552, (6: 0.243148, 7: 0.217118): 0.113899): 0.024733): 0.062966, (2: 0.034963, 3: 0.007534): 0.017021); (D_melanogaster_aay-PA: 0.029887, (D_yakuba_aay-PA: 0.071698, (D_erecta_aay-PA: 0.048552, (D_takahashii_aay-PA: 0.243148, D_eugracilis_aay-PA: 0.217118): 0.113899): 0.024733): 0.062966, (D_sechellia_aay-PA: 0.034963, D_simulans_aay-PA: 0.007534): 0.017021); Detailed output identifying parameters kappa (ts/tv) = 1.71448 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.03136 q = 0.49748 (p1 = 0.00001) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00040 0.02142 0.53559 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 8..1 0.030 615.5 188.5 0.0558 0.0020 0.0360 1.2 6.8 8..9 0.063 615.5 188.5 0.0558 0.0042 0.0758 2.6 14.3 9..4 0.072 615.5 188.5 0.0558 0.0048 0.0863 3.0 16.3 9..10 0.025 615.5 188.5 0.0558 0.0017 0.0298 1.0 5.6 10..5 0.049 615.5 188.5 0.0558 0.0033 0.0584 2.0 11.0 10..11 0.114 615.5 188.5 0.0558 0.0076 0.1370 4.7 25.8 11..6 0.243 615.5 188.5 0.0558 0.0163 0.2925 10.0 55.1 11..7 0.217 615.5 188.5 0.0558 0.0146 0.2612 9.0 49.2 8..12 0.017 615.5 188.5 0.0558 0.0011 0.0205 0.7 3.9 12..2 0.035 615.5 188.5 0.0558 0.0023 0.0421 1.4 7.9 12..3 0.008 615.5 188.5 0.0558 0.0005 0.0091 0.3 1.7 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_aay-PA) Pr(w>1) post mean +- SE for w 15 T 0.658 1.198 +- 0.651 128 Q 0.720 1.281 +- 0.587 217 S 0.589 1.126 +- 0.585 218 D 0.669 1.227 +- 0.571 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.001 0.013 0.068 0.244 0.674 ws: 0.921 0.065 0.009 0.002 0.001 0.001 0.000 0.000 0.000 0.000 Time used: 3:07
Model 1: NearlyNeutral -1946.043099 Model 2: PositiveSelection -1946.043099 Model 0: one-ratio -1962.638927 Model 3: discrete -1945.150938 Model 7: beta -1945.156686 Model 8: beta&w>1 -1945.156786 Model 0 vs 1 33.191655999999966 Model 2 vs 1 0.0 Model 8 vs 7 1.999999999497959E-4