--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Sat Nov 12 06:25:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/2/Acam-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1110.30         -1121.13
2      -1110.07         -1120.43
--------------------------------------
TOTAL    -1110.18         -1120.84
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.588260    0.014350    0.386510    0.834654    0.572829   1169.75   1218.07    1.000
r(A<->C){all}   0.067587    0.001092    0.006582    0.130859    0.063434    810.53    824.99    1.000
r(A<->G){all}   0.115444    0.001431    0.048079    0.185832    0.110839    677.14    696.94    1.000
r(A<->T){all}   0.145961    0.002647    0.056466    0.248078    0.140422    635.23    779.35    1.000
r(C<->G){all}   0.072773    0.000794    0.021432    0.129036    0.070040    907.00    920.25    1.000
r(C<->T){all}   0.535875    0.005455    0.396769    0.686797    0.536096    486.34    569.31    1.000
r(G<->T){all}   0.062360    0.000929    0.009532    0.123450    0.058836    784.95    787.85    1.000
pi(A){all}      0.256504    0.000390    0.213938    0.292031    0.255910    953.02   1040.11    1.001
pi(C){all}      0.234786    0.000354    0.201746    0.273815    0.234301   1300.06   1310.78    1.000
pi(G){all}      0.316402    0.000426    0.274204    0.354399    0.316762   1015.95   1076.08    1.001
pi(T){all}      0.192307    0.000290    0.160116    0.226104    0.192215   1163.88   1222.23    1.000
alpha{1,2}      0.098410    0.002055    0.000185    0.169666    0.101191   1001.46   1050.64    1.000
alpha{3}        1.980196    0.636948    0.708885    3.563970    1.846130   1490.25   1495.62    1.000
pinvar{all}     0.377626    0.010746    0.177734    0.571704    0.386845    722.49    907.94    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1014.050256
Model 2: PositiveSelection	-1014.049666
Model 0: one-ratio	-1014.049666
Model 3: discrete	-1012.263531
Model 7: beta	-1012.456943
Model 8: beta&w>1	-1012.458344


Model 0 vs 1	0.0011799999999766442

Model 2 vs 1	0.0011799999999766442

Model 8 vs 7	0.002801999999974214
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=148 

C1              MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C2              MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C3              MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C4              MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C5              MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C6              MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
                *********************:***** :**************:*.****

C1              LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C2              LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C3              LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C4              LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C5              LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C6              LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
                *:*:.:.*.:* *:*:***.******************************

C1              SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C2              SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C3              SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C4              SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C5              SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C6              SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
                ************************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  148 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  148 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4440]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [4440]--->[4440]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/2/Acam-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.306 Mb, Max= 30.529 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK

FORMAT of file /tmp/tmp3126613387916832052aln Not Supported[FATAL:T-COFFEE]
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:148 S:100 BS:148
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.32 C1	 C2	 99.32
TOP	    1    0	 99.32 C2	 C1	 99.32
BOT	    0    2	 99.32 C1	 C3	 99.32
TOP	    2    0	 99.32 C3	 C1	 99.32
BOT	    0    3	 97.30 C1	 C4	 97.30
TOP	    3    0	 97.30 C4	 C1	 97.30
BOT	    0    4	 97.30 C1	 C5	 97.30
TOP	    4    0	 97.30 C5	 C1	 97.30
BOT	    0    5	 91.22 C1	 C6	 91.22
TOP	    5    0	 91.22 C6	 C1	 91.22
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 96.62 C2	 C4	 96.62
TOP	    3    1	 96.62 C4	 C2	 96.62
BOT	    1    4	 96.62 C2	 C5	 96.62
TOP	    4    1	 96.62 C5	 C2	 96.62
BOT	    1    5	 90.54 C2	 C6	 90.54
TOP	    5    1	 90.54 C6	 C2	 90.54
BOT	    2    3	 96.62 C3	 C4	 96.62
TOP	    3    2	 96.62 C4	 C3	 96.62
BOT	    2    4	 96.62 C3	 C5	 96.62
TOP	    4    2	 96.62 C5	 C3	 96.62
BOT	    2    5	 90.54 C3	 C6	 90.54
TOP	    5    2	 90.54 C6	 C3	 90.54
BOT	    3    4	 98.65 C4	 C5	 98.65
TOP	    4    3	 98.65 C5	 C4	 98.65
BOT	    3    5	 92.57 C4	 C6	 92.57
TOP	    5    3	 92.57 C6	 C4	 92.57
BOT	    4    5	 91.22 C5	 C6	 91.22
TOP	    5    4	 91.22 C6	 C5	 91.22
AVG	 0	 C1	  *	 96.89
AVG	 1	 C2	  *	 96.62
AVG	 2	 C3	  *	 96.62
AVG	 3	 C4	  *	 96.35
AVG	 4	 C5	  *	 96.08
AVG	 5	 C6	  *	 91.22
TOT	 TOT	  *	 95.63
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTCCGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
C2              ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
C3              ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
C4              ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTCGT
C5              ATGTCGGAACTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTCGT
C6              ATGTCCGAGCTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTTGT
                ***** **.*****************:******************** **

C1              CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
C2              CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACTCGTGAGCTGGGCA
C3              CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
C4              GCAGTTCGACAAGGAGGGAACCGGCAAGATAGCCACCCGTGAGCTGGGCA
C5              CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
C6              GCAGTTCGATAAGGACGGAACCGGGAAGATAAACAGCCGTGAGTTGGGCA
                 ******** ***** ******** *****...**  ****** ******

C1              CATTGATGCGCACCTTGGGCCAGAATCCAACGGAGGCCGAGTTGCAAGAT
C2              CCTTGATGCGCACCTTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
C3              CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
C4              CTTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAC
C5              CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
C6              CCTTGATGCGCACCCTTGGCCAGAATCCCTCGGAGGGCGAGCTGCAGGAC
                * ************ * ***********.:****** **** ****.** 

C1              TTGATAGCTGAGGCCGAGAACAACAACAATGGCCAACTGAACTTCACTGA
C2              TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
C3              TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
C4              TTGATTGCTGAGGCCGACAACAACAGCAATGGCCAACTGGACTTCAGTGA
C5              TTAATTGCCGATGCCGACAATAACAGCAATGGCCAACTGGACTTCACTGA
C6              CTGATGGCCGAGGTCGAGAACAACAGCGAGGGGCTACTGGACTTCAGTGA
                 *.** ** ** * *** *. ****.*.* ** *:****.******  **

C1              GTTCTGCGGTATAATGGCCAAGCAAATGCGGGAAACTGACACTGAGGAGG
C2              GTTTTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
C3              GTTCTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
C4              GTTCTGTGGCATTATGGCCAAGCAGATGCGCGAAACGGATACTGAGGAGG
C5              GTTCTGTGGTATCATGGCAAAGCAAATGCGTGAAACGGATACGGAGGAGG
C6              GTTCTGTGCCATCATGGCCAAGCAGATGCGCGAAACCGATACCGAGGAGG
                *** ** *  ** *****.*****.***** ***** ** ** *******

C1              AAATGCGTGAGGCATTCAAGATTTTTGATCGTGATGGCGATGGCTTTATA
C2              AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C3              AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C4              AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C5              AAATGCGGGAGGCTTTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C6              AGATGCGCGAGGCCTTTAAGATCTTCGATCGCGATGGGGATGGCTTTATA
                *.***** ***** ** ***** ** ***** ***** ************

C1              TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C2              TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C3              TCACCAGCCGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C4              TCGCCAGCTGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C5              TCACCAGCTGAGCTTCGCTTTGTAATGATTAATCTCGGCGAGAAGGTCAC
C6              TCGCCGGCTGAGCTCCGCTTTGTGATGATCAATCTGGGAGAAAAGGTCAC
                **.**.** ***** ********.***** ***** **.**.********

C1              CGACGAGGAGATCGATGAGATGATTCGCGAGGCTGATTTTGATGGGGATG
C2              CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
C3              CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
C4              CGACGAGGAGATCGACGAGATGATACGCGAGGCGGATTTTGATGGAGATG
C5              CGATGAAGAGATCGACGAGATGATACGCGAGGCTGATTTTGATGGGGATG
C6              CGACGAGGAGATCGACGAGATGATCCGCGAGGCCGATTTCGATGGCGACG
                *** **.******** ******** ** ***** ***** ***** ** *

C1              GCATGATCAACTACGAGGAATTCGTATGGATGATAAGCCAGAAG
C2              GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
C3              GCATGATCAACTACGAGGAATTCGTTTGGATGATTAGCCAGAAG
C4              GCATGATCAACTACGAGGAGTTCGTTTGGATGATAAGCCAGAAG
C5              GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
C6              GTATGATCAACTACGAGGAGTTCGTCTGGATGATCAGCCAGAAG
                * *****************.***** ******** *********



>C1
ATGTCCGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
CATTGATGCGCACCTTGGGCCAGAATCCAACGGAGGCCGAGTTGCAAGAT
TTGATAGCTGAGGCCGAGAACAACAACAATGGCCAACTGAACTTCACTGA
GTTCTGCGGTATAATGGCCAAGCAAATGCGGGAAACTGACACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGTGATGGCGATGGCTTTATA
TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGATGAGATGATTCGCGAGGCTGATTTTGATGGGGATG
GCATGATCAACTACGAGGAATTCGTATGGATGATAAGCCAGAAG
>C2
ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACTCGTGAGCTGGGCA
CCTTGATGCGCACCTTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
GTTTTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
>C3
ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
GTTCTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCACCAGCCGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
GCATGATCAACTACGAGGAATTCGTTTGGATGATTAGCCAGAAG
>C4
ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTCGT
GCAGTTCGACAAGGAGGGAACCGGCAAGATAGCCACCCGTGAGCTGGGCA
CTTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAC
TTGATTGCTGAGGCCGACAACAACAGCAATGGCCAACTGGACTTCAGTGA
GTTCTGTGGCATTATGGCCAAGCAGATGCGCGAAACGGATACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCGCCAGCTGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGACGAGATGATACGCGAGGCGGATTTTGATGGAGATG
GCATGATCAACTACGAGGAGTTCGTTTGGATGATAAGCCAGAAG
>C5
ATGTCGGAACTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTCGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
TTAATTGCCGATGCCGACAATAACAGCAATGGCCAACTGGACTTCACTGA
GTTCTGTGGTATCATGGCAAAGCAAATGCGTGAAACGGATACGGAGGAGG
AAATGCGGGAGGCTTTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCACCAGCTGAGCTTCGCTTTGTAATGATTAATCTCGGCGAGAAGGTCAC
CGATGAAGAGATCGACGAGATGATACGCGAGGCTGATTTTGATGGGGATG
GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
>C6
ATGTCCGAGCTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTTGT
GCAGTTCGATAAGGACGGAACCGGGAAGATAAACAGCCGTGAGTTGGGCA
CCTTGATGCGCACCCTTGGCCAGAATCCCTCGGAGGGCGAGCTGCAGGAC
CTGATGGCCGAGGTCGAGAACAACAGCGAGGGGCTACTGGACTTCAGTGA
GTTCTGTGCCATCATGGCCAAGCAGATGCGCGAAACCGATACCGAGGAGG
AGATGCGCGAGGCCTTTAAGATCTTCGATCGCGATGGGGATGGCTTTATA
TCGCCGGCTGAGCTCCGCTTTGTGATGATCAATCTGGGAGAAAAGGTCAC
CGACGAGGAGATCGACGAGATGATCCGCGAGGCCGATTTCGATGGCGACG
GTATGATCAACTACGAGGAGTTCGTCTGGATGATCAGCCAGAAG
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 444 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478931618
      Setting output file names to "/opt/ADOPS/2/Acam-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1275748376
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6877473159
      Seed = 1056139369
      Swapseed = 1478931618
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 11 unique site patterns
      Division 2 has 12 unique site patterns
      Division 3 has 52 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1394.304268 -- -24.965149
         Chain 2 -- -1403.720239 -- -24.965149
         Chain 3 -- -1376.415980 -- -24.965149
         Chain 4 -- -1383.806065 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1395.806261 -- -24.965149
         Chain 2 -- -1408.182143 -- -24.965149
         Chain 3 -- -1402.642188 -- -24.965149
         Chain 4 -- -1383.806065 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1394.304] (-1403.720) (-1376.416) (-1383.806) * [-1395.806] (-1408.182) (-1402.642) (-1383.806) 
        500 -- (-1162.249) (-1160.702) [-1150.400] (-1149.641) * [-1164.457] (-1150.589) (-1155.543) (-1154.935) -- 0:00:00
       1000 -- [-1140.009] (-1142.061) (-1146.282) (-1159.609) * (-1142.276) [-1137.427] (-1148.156) (-1144.180) -- 0:00:00
       1500 -- [-1121.042] (-1136.931) (-1144.424) (-1155.195) * (-1135.958) (-1132.886) [-1134.060] (-1133.918) -- 0:00:00
       2000 -- (-1127.485) [-1122.322] (-1141.943) (-1142.291) * (-1124.306) (-1131.384) [-1120.161] (-1122.688) -- 0:00:00
       2500 -- (-1120.629) (-1125.513) (-1139.764) [-1133.524] * (-1122.055) (-1117.711) (-1121.857) [-1119.875] -- 0:00:00
       3000 -- [-1124.838] (-1120.639) (-1133.692) (-1125.399) * (-1119.076) (-1111.724) (-1114.455) [-1115.081] -- 0:00:00
       3500 -- (-1113.114) [-1116.006] (-1129.475) (-1124.836) * [-1122.405] (-1123.998) (-1121.164) (-1117.410) -- 0:00:00
       4000 -- [-1114.852] (-1117.548) (-1125.584) (-1121.251) * (-1124.051) [-1121.729] (-1117.138) (-1112.436) -- 0:00:00
       4500 -- (-1115.623) (-1118.075) (-1129.547) [-1116.792] * (-1119.961) [-1112.883] (-1119.148) (-1115.051) -- 0:03:41
       5000 -- (-1118.775) [-1121.041] (-1122.796) (-1116.298) * [-1117.675] (-1111.530) (-1118.977) (-1117.195) -- 0:03:19

      Average standard deviation of split frequencies: 0.039284

       5500 -- [-1119.573] (-1119.664) (-1123.963) (-1113.971) * [-1115.970] (-1118.822) (-1116.907) (-1110.899) -- 0:03:00
       6000 -- (-1127.157) (-1115.843) (-1113.167) [-1126.014] * (-1117.478) (-1113.179) [-1113.534] (-1109.924) -- 0:02:45
       6500 -- (-1120.623) [-1119.616] (-1117.051) (-1111.638) * (-1116.168) (-1112.216) (-1116.241) [-1110.566] -- 0:02:32
       7000 -- (-1123.552) [-1110.753] (-1118.924) (-1114.011) * (-1115.109) (-1115.892) (-1119.152) [-1108.636] -- 0:02:21
       7500 -- [-1116.039] (-1120.118) (-1117.868) (-1112.362) * [-1115.589] (-1116.937) (-1120.472) (-1112.893) -- 0:02:12
       8000 -- (-1114.539) (-1119.700) [-1116.433] (-1113.201) * (-1120.054) (-1113.332) [-1111.934] (-1115.024) -- 0:02:04
       8500 -- (-1113.015) (-1116.746) (-1114.965) [-1113.928] * (-1114.852) (-1124.104) (-1118.132) [-1113.876] -- 0:01:56
       9000 -- (-1112.906) (-1116.161) [-1119.360] (-1124.222) * (-1115.080) [-1118.043] (-1112.271) (-1115.275) -- 0:01:50
       9500 -- [-1109.341] (-1112.855) (-1113.938) (-1116.655) * (-1112.937) (-1119.962) (-1109.929) [-1115.695] -- 0:01:44
      10000 -- (-1117.367) [-1113.823] (-1116.066) (-1112.746) * [-1116.753] (-1124.080) (-1114.747) (-1114.542) -- 0:03:18

      Average standard deviation of split frequencies: 0.066291

      10500 -- (-1117.690) [-1113.471] (-1117.229) (-1114.642) * (-1116.944) (-1116.395) (-1113.553) [-1113.396] -- 0:03:08
      11000 -- (-1113.993) [-1115.770] (-1113.152) (-1111.086) * [-1116.396] (-1122.350) (-1114.708) (-1116.125) -- 0:02:59
      11500 -- (-1115.228) (-1114.940) [-1112.536] (-1109.598) * (-1111.763) [-1112.839] (-1113.350) (-1111.624) -- 0:02:51
      12000 -- (-1112.908) (-1111.158) (-1113.500) [-1113.903] * (-1119.175) (-1117.014) (-1118.509) [-1113.335] -- 0:02:44
      12500 -- (-1113.911) [-1113.795] (-1110.763) (-1109.374) * (-1113.211) (-1113.547) (-1121.003) [-1116.390] -- 0:02:38
      13000 -- (-1117.328) (-1114.757) [-1111.675] (-1116.850) * [-1114.847] (-1112.742) (-1121.078) (-1115.168) -- 0:02:31
      13500 -- (-1113.297) (-1113.350) (-1115.127) [-1115.292] * [-1117.092] (-1113.308) (-1115.824) (-1117.569) -- 0:02:26
      14000 -- [-1114.983] (-1111.291) (-1118.584) (-1111.227) * [-1112.368] (-1118.208) (-1119.941) (-1111.689) -- 0:02:20
      14500 -- (-1118.424) (-1115.870) (-1110.877) [-1110.525] * (-1115.966) [-1121.472] (-1123.700) (-1114.304) -- 0:02:15
      15000 -- (-1120.369) (-1113.968) [-1115.509] (-1116.136) * (-1123.353) (-1110.671) [-1113.926] (-1114.795) -- 0:03:17

      Average standard deviation of split frequencies: 0.063836

      15500 -- (-1113.819) (-1120.618) [-1113.146] (-1120.516) * [-1113.402] (-1122.306) (-1108.896) (-1122.812) -- 0:03:10
      16000 -- (-1112.571) (-1122.553) (-1114.731) [-1111.372] * (-1109.965) [-1114.673] (-1111.149) (-1122.879) -- 0:03:04
      16500 -- (-1116.217) [-1111.388] (-1110.505) (-1119.425) * [-1112.590] (-1117.384) (-1110.641) (-1118.893) -- 0:02:58
      17000 -- (-1117.040) [-1111.656] (-1119.633) (-1119.891) * (-1112.587) (-1114.092) [-1111.863] (-1115.046) -- 0:02:53
      17500 -- [-1109.603] (-1121.046) (-1117.395) (-1112.981) * (-1114.872) (-1122.515) [-1115.239] (-1112.289) -- 0:02:48
      18000 -- [-1110.593] (-1120.737) (-1115.751) (-1121.845) * (-1110.212) (-1119.199) [-1113.200] (-1108.705) -- 0:02:43
      18500 -- (-1119.177) [-1112.996] (-1117.405) (-1117.905) * (-1116.604) (-1120.669) [-1114.923] (-1119.916) -- 0:02:39
      19000 -- (-1124.708) (-1114.008) [-1114.738] (-1111.420) * (-1120.829) (-1125.580) [-1112.047] (-1117.203) -- 0:02:34
      19500 -- (-1112.289) (-1117.891) (-1117.319) [-1117.841] * (-1119.407) [-1114.872] (-1112.756) (-1120.714) -- 0:02:30
      20000 -- (-1121.447) [-1118.274] (-1117.817) (-1115.272) * (-1118.822) (-1112.861) [-1111.952] (-1125.677) -- 0:02:27

      Average standard deviation of split frequencies: 0.072231

      20500 -- (-1112.434) (-1112.086) [-1113.548] (-1116.316) * (-1119.913) (-1112.619) (-1116.780) [-1119.669] -- 0:03:11
      21000 -- (-1111.200) [-1111.290] (-1110.414) (-1113.316) * (-1122.465) (-1114.993) (-1118.920) [-1115.372] -- 0:03:06
      21500 -- (-1110.744) [-1113.247] (-1116.163) (-1108.962) * [-1117.390] (-1113.775) (-1121.297) (-1113.125) -- 0:03:02
      22000 -- (-1113.462) (-1114.215) [-1110.455] (-1116.298) * (-1117.709) (-1117.724) (-1111.191) [-1127.567] -- 0:02:57
      22500 -- (-1109.843) (-1125.103) (-1112.894) [-1112.511] * (-1116.682) (-1120.269) [-1111.211] (-1116.028) -- 0:02:53
      23000 -- (-1108.805) (-1116.907) [-1112.675] (-1114.599) * (-1118.567) (-1116.252) (-1118.825) [-1118.287] -- 0:02:49
      23500 -- (-1117.851) (-1115.660) (-1118.286) [-1111.096] * (-1114.899) (-1114.790) [-1119.926] (-1114.379) -- 0:02:46
      24000 -- (-1112.303) (-1114.221) (-1119.924) [-1112.992] * (-1115.732) (-1112.709) (-1114.129) [-1112.898] -- 0:02:42
      24500 -- (-1113.778) (-1122.817) [-1113.034] (-1113.792) * [-1123.008] (-1119.386) (-1120.807) (-1116.295) -- 0:02:39
      25000 -- (-1119.803) (-1115.496) [-1116.883] (-1118.474) * (-1131.696) (-1116.754) (-1110.374) [-1114.577] -- 0:02:36

      Average standard deviation of split frequencies: 0.069502

      25500 -- (-1120.226) (-1110.794) (-1121.423) [-1115.482] * (-1114.198) [-1119.496] (-1116.931) (-1115.688) -- 0:02:32
      26000 -- (-1118.803) (-1108.597) (-1123.676) [-1111.626] * (-1110.690) (-1111.537) (-1111.129) [-1113.483] -- 0:03:07
      26500 -- (-1119.793) (-1111.473) [-1115.344] (-1114.288) * (-1108.477) (-1110.028) [-1116.290] (-1110.749) -- 0:03:03
      27000 -- [-1112.506] (-1117.119) (-1112.144) (-1115.477) * (-1110.121) (-1113.904) (-1113.495) [-1114.182] -- 0:03:00
      27500 -- (-1116.738) [-1115.305] (-1121.081) (-1115.495) * (-1116.559) (-1115.265) [-1115.976] (-1113.815) -- 0:02:56
      28000 -- (-1115.548) [-1111.159] (-1118.419) (-1116.153) * (-1113.830) (-1110.686) (-1118.769) [-1108.392] -- 0:02:53
      28500 -- (-1114.514) (-1116.368) (-1119.693) [-1114.252] * (-1114.631) (-1113.001) (-1110.361) [-1109.814] -- 0:02:50
      29000 -- (-1114.949) (-1124.853) (-1119.188) [-1107.283] * (-1117.811) (-1120.610) (-1127.335) [-1110.043] -- 0:02:47
      29500 -- [-1112.568] (-1114.417) (-1114.095) (-1115.822) * [-1114.673] (-1116.380) (-1112.448) (-1115.738) -- 0:02:44
      30000 -- (-1118.008) (-1115.696) (-1127.721) [-1111.900] * (-1115.869) (-1111.801) (-1110.597) [-1112.725] -- 0:02:41

      Average standard deviation of split frequencies: 0.067636

      30500 -- [-1113.774] (-1118.392) (-1113.298) (-1109.011) * (-1113.718) (-1111.566) [-1111.134] (-1117.900) -- 0:02:38
      31000 -- (-1113.845) (-1115.179) (-1116.548) [-1115.007] * (-1118.513) (-1113.661) [-1114.432] (-1115.466) -- 0:03:07
      31500 -- [-1119.741] (-1110.375) (-1120.221) (-1114.104) * (-1114.245) (-1113.777) (-1113.230) [-1113.770] -- 0:03:04
      32000 -- (-1117.342) [-1108.685] (-1112.130) (-1115.591) * (-1119.255) (-1111.423) (-1112.702) [-1110.305] -- 0:03:01
      32500 -- (-1120.008) (-1115.253) [-1114.898] (-1114.348) * (-1112.950) [-1112.318] (-1117.549) (-1112.729) -- 0:02:58
      33000 -- (-1120.777) [-1114.992] (-1116.618) (-1113.350) * (-1109.453) (-1117.067) [-1112.162] (-1118.554) -- 0:02:55
      33500 -- [-1117.431] (-1114.997) (-1123.244) (-1115.094) * (-1112.078) (-1112.233) [-1119.714] (-1117.474) -- 0:02:53
      34000 -- [-1112.642] (-1115.969) (-1121.256) (-1120.990) * [-1112.174] (-1110.308) (-1117.588) (-1119.324) -- 0:02:50
      34500 -- (-1112.355) [-1112.998] (-1118.275) (-1122.210) * [-1112.370] (-1113.510) (-1119.841) (-1120.197) -- 0:02:47
      35000 -- (-1119.877) [-1111.098] (-1115.893) (-1115.980) * (-1113.499) (-1114.159) [-1109.357] (-1116.693) -- 0:02:45

      Average standard deviation of split frequencies: 0.061108

      35500 -- (-1110.058) [-1112.963] (-1117.494) (-1114.300) * (-1115.472) (-1115.533) [-1110.373] (-1116.001) -- 0:02:43
      36000 -- (-1117.352) (-1112.257) (-1116.730) [-1115.195] * [-1107.660] (-1116.879) (-1117.025) (-1115.124) -- 0:02:40
      36500 -- (-1119.743) [-1114.992] (-1120.876) (-1118.263) * (-1114.198) (-1122.149) [-1110.641] (-1114.176) -- 0:03:04
      37000 -- (-1113.962) (-1117.682) [-1111.901] (-1115.371) * (-1117.773) (-1117.441) (-1117.340) [-1112.856] -- 0:03:02
      37500 -- [-1113.425] (-1123.819) (-1110.497) (-1116.652) * [-1114.977] (-1115.307) (-1111.112) (-1119.274) -- 0:02:59
      38000 -- [-1112.519] (-1117.373) (-1117.008) (-1112.842) * (-1111.424) [-1113.910] (-1114.854) (-1116.569) -- 0:02:57
      38500 -- (-1118.063) (-1117.205) (-1113.430) [-1112.654] * (-1114.100) (-1121.781) [-1117.243] (-1113.007) -- 0:02:54
      39000 -- (-1118.495) (-1119.001) (-1117.770) [-1113.872] * [-1110.667] (-1114.649) (-1113.202) (-1119.855) -- 0:02:52
      39500 -- (-1110.746) [-1109.186] (-1115.453) (-1112.909) * (-1117.515) (-1116.796) (-1111.809) [-1113.103] -- 0:02:50
      40000 -- (-1114.554) (-1110.139) (-1120.614) [-1117.346] * [-1109.836] (-1114.495) (-1121.326) (-1118.454) -- 0:02:48

      Average standard deviation of split frequencies: 0.038640

      40500 -- (-1120.809) (-1110.952) (-1118.233) [-1119.040] * (-1111.346) (-1119.659) [-1111.356] (-1112.725) -- 0:02:45
      41000 -- (-1118.735) (-1114.328) [-1116.821] (-1118.037) * (-1111.517) (-1118.790) [-1113.966] (-1117.222) -- 0:02:43
      41500 -- (-1111.154) (-1119.906) (-1115.893) [-1119.149] * (-1116.411) (-1117.678) (-1119.459) [-1113.951] -- 0:03:04
      42000 -- (-1111.774) [-1113.618] (-1118.285) (-1117.429) * (-1115.352) (-1111.695) [-1119.565] (-1124.566) -- 0:03:02
      42500 -- (-1116.439) (-1123.675) [-1111.177] (-1123.914) * [-1106.898] (-1114.037) (-1119.371) (-1127.469) -- 0:03:00
      43000 -- (-1117.488) [-1114.534] (-1116.644) (-1116.002) * (-1115.334) [-1111.962] (-1116.391) (-1124.369) -- 0:02:58
      43500 -- (-1115.165) [-1109.797] (-1110.349) (-1119.925) * (-1108.355) [-1112.245] (-1120.930) (-1117.454) -- 0:02:55
      44000 -- (-1116.305) (-1116.810) [-1115.034] (-1114.843) * [-1111.476] (-1113.763) (-1117.443) (-1119.881) -- 0:02:53
      44500 -- [-1112.792] (-1115.481) (-1109.601) (-1119.025) * (-1112.027) (-1108.612) [-1114.251] (-1119.216) -- 0:02:51
      45000 -- (-1116.187) [-1110.718] (-1110.919) (-1125.031) * (-1115.813) (-1112.337) (-1110.568) [-1112.883] -- 0:02:49

      Average standard deviation of split frequencies: 0.047824

      45500 -- (-1112.281) (-1111.080) [-1113.397] (-1119.855) * (-1112.789) [-1113.093] (-1115.884) (-1110.886) -- 0:02:47
      46000 -- [-1107.309] (-1115.008) (-1111.778) (-1118.299) * (-1113.417) (-1121.712) [-1117.219] (-1110.284) -- 0:02:45
      46500 -- [-1110.772] (-1110.950) (-1121.216) (-1116.212) * (-1119.919) (-1114.534) [-1114.889] (-1116.772) -- 0:02:44
      47000 -- (-1108.696) (-1119.343) [-1109.259] (-1119.554) * (-1118.179) [-1117.540] (-1111.854) (-1115.620) -- 0:03:02
      47500 -- (-1109.627) (-1117.105) [-1116.164] (-1114.614) * (-1115.695) (-1116.571) (-1123.064) [-1110.106] -- 0:03:00
      48000 -- (-1119.621) (-1114.104) (-1110.834) [-1111.479] * (-1117.895) (-1115.997) (-1108.650) [-1112.921] -- 0:02:58
      48500 -- (-1117.822) (-1110.369) (-1121.927) [-1110.095] * (-1118.828) [-1116.558] (-1114.758) (-1114.980) -- 0:02:56
      49000 -- (-1118.410) (-1119.225) [-1109.103] (-1114.188) * (-1115.397) [-1115.479] (-1117.453) (-1117.092) -- 0:02:54
      49500 -- (-1121.842) [-1115.606] (-1115.354) (-1111.027) * (-1114.248) [-1117.159] (-1112.671) (-1112.160) -- 0:02:52
      50000 -- [-1118.947] (-1108.878) (-1111.749) (-1120.452) * (-1115.605) (-1118.833) [-1115.864] (-1110.526) -- 0:02:51

      Average standard deviation of split frequencies: 0.034115

      50500 -- (-1123.778) [-1113.237] (-1113.877) (-1117.257) * (-1117.580) (-1116.865) [-1114.155] (-1117.168) -- 0:02:49
      51000 -- (-1123.883) [-1111.586] (-1116.357) (-1110.423) * [-1110.360] (-1125.442) (-1117.977) (-1116.993) -- 0:02:47
      51500 -- (-1120.995) (-1128.558) (-1113.412) [-1111.668] * (-1110.433) (-1122.133) (-1112.241) [-1115.359] -- 0:02:45
      52000 -- (-1114.130) [-1116.549] (-1117.677) (-1118.424) * [-1113.714] (-1114.605) (-1119.075) (-1112.721) -- 0:03:02
      52500 -- (-1124.013) (-1112.193) (-1115.361) [-1111.395] * (-1119.120) (-1110.684) (-1119.382) [-1109.142] -- 0:03:00
      53000 -- (-1122.372) (-1114.081) [-1115.838] (-1121.859) * [-1115.555] (-1118.242) (-1114.086) (-1112.555) -- 0:02:58
      53500 -- (-1119.416) (-1116.780) [-1109.670] (-1110.477) * (-1111.673) (-1112.329) [-1114.855] (-1120.531) -- 0:02:56
      54000 -- (-1116.169) (-1114.571) (-1117.813) [-1115.419] * (-1122.713) (-1112.767) (-1112.885) [-1107.779] -- 0:02:55
      54500 -- (-1115.411) (-1115.034) [-1115.384] (-1114.177) * [-1117.143] (-1115.460) (-1116.657) (-1107.793) -- 0:02:53
      55000 -- (-1111.489) [-1118.390] (-1117.764) (-1111.843) * [-1111.084] (-1117.369) (-1112.729) (-1111.749) -- 0:02:51

      Average standard deviation of split frequencies: 0.030866

      55500 -- (-1109.896) (-1114.381) (-1115.004) [-1120.658] * (-1115.364) [-1109.332] (-1116.937) (-1108.867) -- 0:02:50
      56000 -- [-1109.625] (-1115.030) (-1116.502) (-1120.441) * (-1115.335) (-1111.524) (-1113.230) [-1111.091] -- 0:02:48
      56500 -- [-1124.011] (-1112.791) (-1124.855) (-1123.130) * (-1121.087) [-1112.622] (-1115.027) (-1114.568) -- 0:02:46
      57000 -- (-1123.441) (-1111.076) (-1113.769) [-1120.549] * (-1115.371) (-1118.561) [-1117.693] (-1113.318) -- 0:02:45
      57500 -- (-1117.574) [-1110.464] (-1120.973) (-1125.483) * (-1110.359) (-1116.883) (-1115.968) [-1117.169] -- 0:03:00
      58000 -- [-1118.761] (-1117.555) (-1110.365) (-1115.118) * (-1119.977) (-1114.189) [-1116.950] (-1112.122) -- 0:02:58
      58500 -- (-1115.112) (-1110.866) (-1117.758) [-1113.226] * (-1119.639) (-1120.637) (-1115.619) [-1113.125] -- 0:02:57
      59000 -- (-1117.497) (-1113.524) [-1113.033] (-1117.646) * (-1121.818) (-1111.630) [-1116.382] (-1110.855) -- 0:02:55
      59500 -- (-1117.966) (-1111.531) [-1112.173] (-1117.508) * (-1120.086) (-1121.112) [-1109.970] (-1116.086) -- 0:02:53
      60000 -- (-1116.019) (-1107.135) [-1110.097] (-1113.236) * (-1121.123) [-1113.235] (-1114.902) (-1125.369) -- 0:02:52

      Average standard deviation of split frequencies: 0.015541

      60500 -- (-1116.129) (-1111.760) (-1111.768) [-1115.294] * [-1107.804] (-1112.888) (-1115.285) (-1119.520) -- 0:02:50
      61000 -- (-1118.684) (-1117.882) (-1121.624) [-1113.554] * (-1114.501) (-1117.523) (-1117.787) [-1112.223] -- 0:02:49
      61500 -- (-1115.867) [-1110.965] (-1119.641) (-1123.105) * [-1107.760] (-1114.345) (-1114.152) (-1119.713) -- 0:02:47
      62000 -- (-1112.417) [-1115.436] (-1119.093) (-1114.797) * (-1115.485) (-1109.421) [-1114.480] (-1123.633) -- 0:02:46
      62500 -- (-1119.939) (-1116.195) (-1119.090) [-1118.942] * (-1111.153) (-1112.819) (-1116.921) [-1114.193] -- 0:02:45
      63000 -- (-1117.507) (-1116.824) (-1113.662) [-1114.503] * (-1118.816) [-1120.466] (-1118.752) (-1112.224) -- 0:02:58
      63500 -- (-1118.558) (-1109.763) [-1110.215] (-1115.998) * [-1110.917] (-1113.325) (-1115.313) (-1118.215) -- 0:02:56
      64000 -- (-1115.410) [-1110.256] (-1115.451) (-1124.299) * (-1110.223) (-1113.232) [-1115.070] (-1122.972) -- 0:02:55
      64500 -- [-1115.221] (-1112.717) (-1111.249) (-1115.268) * (-1111.197) [-1114.989] (-1108.734) (-1117.097) -- 0:02:54
      65000 -- (-1112.567) (-1111.177) (-1114.070) [-1123.937] * (-1116.419) (-1113.914) [-1110.446] (-1116.960) -- 0:02:52

      Average standard deviation of split frequencies: 0.009523

      65500 -- (-1115.332) (-1116.312) [-1113.483] (-1125.687) * [-1110.961] (-1117.578) (-1114.675) (-1112.700) -- 0:02:51
      66000 -- [-1112.495] (-1115.041) (-1109.990) (-1118.862) * [-1110.406] (-1124.527) (-1115.333) (-1113.357) -- 0:02:49
      66500 -- (-1113.370) [-1116.705] (-1108.952) (-1124.921) * (-1109.866) (-1117.929) (-1113.410) [-1113.716] -- 0:02:48
      67000 -- (-1109.737) (-1114.440) (-1117.658) [-1118.882] * (-1113.511) (-1121.973) (-1118.988) [-1113.384] -- 0:02:47
      67500 -- (-1110.568) (-1116.577) [-1117.323] (-1127.228) * [-1115.394] (-1111.397) (-1112.081) (-1111.718) -- 0:02:45
      68000 -- (-1116.084) (-1115.424) (-1108.545) [-1121.875] * (-1114.491) [-1120.208] (-1113.557) (-1117.720) -- 0:02:58
      68500 -- (-1114.735) (-1115.889) [-1113.556] (-1116.451) * (-1111.902) (-1120.365) [-1115.880] (-1120.367) -- 0:02:56
      69000 -- [-1115.797] (-1122.062) (-1116.088) (-1107.366) * (-1108.849) (-1116.477) (-1115.683) [-1110.604] -- 0:02:55
      69500 -- (-1111.485) (-1117.518) [-1111.972] (-1115.840) * [-1114.426] (-1116.727) (-1108.265) (-1109.997) -- 0:02:54
      70000 -- (-1116.764) (-1123.863) [-1114.477] (-1110.697) * [-1112.439] (-1122.948) (-1110.296) (-1113.116) -- 0:02:52

      Average standard deviation of split frequencies: 0.008894

      70500 -- (-1115.419) (-1118.544) (-1117.546) [-1113.494] * (-1119.311) [-1117.218] (-1113.598) (-1119.046) -- 0:02:51
      71000 -- [-1118.879] (-1116.825) (-1118.220) (-1118.446) * (-1122.284) (-1122.467) [-1116.491] (-1115.016) -- 0:02:50
      71500 -- [-1116.713] (-1116.343) (-1124.160) (-1111.790) * (-1112.628) [-1124.923] (-1113.151) (-1114.363) -- 0:02:48
      72000 -- (-1111.280) (-1113.317) [-1116.740] (-1112.440) * [-1113.613] (-1121.255) (-1112.150) (-1125.628) -- 0:02:47
      72500 -- [-1110.631] (-1117.297) (-1117.169) (-1123.901) * (-1113.925) (-1122.703) (-1122.410) [-1115.586] -- 0:02:46
      73000 -- (-1112.170) [-1117.372] (-1117.156) (-1115.204) * [-1114.332] (-1118.721) (-1113.007) (-1117.764) -- 0:02:45
      73500 -- (-1112.509) [-1113.792] (-1118.968) (-1119.069) * [-1113.754] (-1125.139) (-1110.767) (-1117.519) -- 0:02:56
      74000 -- (-1114.913) (-1112.741) [-1110.129] (-1119.835) * [-1113.756] (-1117.196) (-1113.810) (-1115.796) -- 0:02:55
      74500 -- (-1112.402) (-1113.259) (-1109.817) [-1113.489] * (-1114.424) (-1117.523) (-1112.056) [-1112.733] -- 0:02:53
      75000 -- (-1118.335) [-1115.978] (-1122.065) (-1113.239) * (-1115.388) (-1115.569) (-1114.509) [-1107.845] -- 0:02:52

      Average standard deviation of split frequencies: 0.012405

      75500 -- [-1107.274] (-1115.766) (-1114.599) (-1117.509) * (-1108.137) (-1120.703) [-1108.017] (-1113.484) -- 0:02:51
      76000 -- [-1112.303] (-1122.194) (-1121.386) (-1119.128) * (-1110.923) (-1116.953) [-1109.109] (-1118.304) -- 0:02:50
      76500 -- (-1113.230) [-1119.904] (-1114.809) (-1119.137) * (-1112.025) (-1113.136) [-1109.840] (-1115.560) -- 0:02:49
      77000 -- (-1108.237) (-1119.856) [-1114.471] (-1111.347) * [-1112.587] (-1115.480) (-1114.143) (-1118.206) -- 0:02:47
      77500 -- [-1116.388] (-1117.682) (-1119.225) (-1114.638) * (-1114.227) (-1118.653) (-1111.858) [-1112.616] -- 0:02:46
      78000 -- [-1111.849] (-1112.863) (-1113.911) (-1129.891) * (-1113.543) (-1115.134) (-1118.400) [-1111.203] -- 0:02:45
      78500 -- [-1112.591] (-1113.943) (-1116.195) (-1119.637) * (-1119.942) (-1120.092) (-1111.064) [-1113.142] -- 0:02:56
      79000 -- [-1112.993] (-1119.647) (-1117.526) (-1118.265) * (-1113.542) (-1116.792) (-1115.381) [-1112.646] -- 0:02:54
      79500 -- [-1110.903] (-1118.818) (-1116.869) (-1120.693) * (-1114.095) (-1113.242) [-1112.746] (-1113.583) -- 0:02:53
      80000 -- (-1110.458) [-1116.650] (-1119.544) (-1117.034) * (-1114.171) (-1119.076) (-1119.727) [-1109.455] -- 0:02:52

      Average standard deviation of split frequencies: 0.011688

      80500 -- [-1110.869] (-1115.177) (-1123.097) (-1113.287) * (-1119.094) (-1116.620) [-1111.855] (-1109.262) -- 0:02:51
      81000 -- [-1116.534] (-1110.610) (-1121.487) (-1115.063) * (-1118.552) [-1111.939] (-1108.480) (-1108.051) -- 0:02:50
      81500 -- [-1117.256] (-1119.721) (-1120.285) (-1120.379) * (-1114.182) (-1118.433) [-1114.403] (-1114.093) -- 0:02:49
      82000 -- (-1112.318) (-1112.901) [-1119.721] (-1115.112) * (-1111.501) (-1116.591) (-1117.601) [-1115.773] -- 0:02:47
      82500 -- [-1114.593] (-1112.515) (-1122.418) (-1110.407) * (-1119.780) (-1121.691) [-1109.489] (-1112.556) -- 0:02:46
      83000 -- (-1110.984) (-1117.665) (-1115.625) [-1111.967] * (-1113.988) (-1119.260) (-1111.213) [-1114.387] -- 0:02:45
      83500 -- (-1113.066) (-1113.201) (-1124.788) [-1114.137] * (-1113.135) (-1119.746) (-1120.607) [-1111.248] -- 0:02:44
      84000 -- (-1115.384) (-1115.844) [-1117.695] (-1115.705) * (-1114.824) (-1120.352) [-1107.850] (-1113.527) -- 0:02:54
      84500 -- (-1115.044) [-1116.068] (-1122.970) (-1122.040) * (-1118.352) (-1120.781) [-1115.222] (-1111.949) -- 0:02:53
      85000 -- (-1121.212) (-1110.638) [-1115.504] (-1117.594) * (-1124.867) (-1120.514) (-1109.578) [-1112.650] -- 0:02:52

      Average standard deviation of split frequencies: 0.009136

      85500 -- (-1113.204) [-1121.759] (-1116.446) (-1116.554) * (-1121.637) [-1118.143] (-1112.777) (-1114.944) -- 0:02:51
      86000 -- (-1116.875) (-1115.235) (-1113.973) [-1116.223] * (-1122.743) (-1116.557) [-1114.324] (-1115.927) -- 0:02:50
      86500 -- (-1108.152) (-1121.653) [-1116.237] (-1117.026) * (-1117.616) [-1114.677] (-1115.976) (-1111.212) -- 0:02:48
      87000 -- [-1117.528] (-1119.908) (-1117.280) (-1120.366) * (-1119.407) [-1111.828] (-1116.128) (-1114.601) -- 0:02:47
      87500 -- [-1115.215] (-1121.236) (-1118.600) (-1114.987) * (-1116.293) (-1113.690) (-1116.894) [-1114.974] -- 0:02:46
      88000 -- [-1115.204] (-1118.578) (-1119.788) (-1118.082) * (-1119.450) (-1117.583) (-1117.025) [-1115.576] -- 0:02:45
      88500 -- (-1114.684) [-1115.591] (-1125.103) (-1118.757) * [-1112.172] (-1118.499) (-1119.559) (-1115.678) -- 0:02:44
      89000 -- (-1117.059) (-1120.921) (-1121.049) [-1115.954] * (-1116.926) (-1116.455) [-1112.868] (-1115.218) -- 0:02:54
      89500 -- (-1118.579) (-1114.229) [-1113.190] (-1116.674) * (-1115.383) (-1116.144) [-1116.591] (-1121.385) -- 0:02:52
      90000 -- [-1113.265] (-1115.353) (-1112.967) (-1120.688) * (-1114.056) (-1111.252) [-1115.892] (-1113.963) -- 0:02:51

      Average standard deviation of split frequencies: 0.005199

      90500 -- [-1112.912] (-1118.750) (-1113.555) (-1116.378) * (-1114.057) (-1115.423) [-1111.671] (-1118.525) -- 0:02:50
      91000 -- [-1109.152] (-1115.847) (-1118.696) (-1119.263) * (-1116.767) (-1111.985) (-1106.338) [-1117.485] -- 0:02:49
      91500 -- (-1109.513) (-1117.294) (-1116.229) [-1114.817] * (-1117.852) [-1109.184] (-1113.568) (-1123.643) -- 0:02:48
      92000 -- (-1111.497) [-1113.984] (-1115.714) (-1118.133) * (-1122.352) [-1113.174] (-1112.624) (-1117.865) -- 0:02:47
      92500 -- (-1110.739) [-1116.519] (-1123.846) (-1115.419) * (-1117.146) [-1113.038] (-1114.802) (-1125.038) -- 0:02:46
      93000 -- (-1119.152) (-1121.589) (-1114.243) [-1114.991] * (-1121.122) [-1118.912] (-1115.286) (-1115.177) -- 0:02:45
      93500 -- (-1115.082) (-1116.973) [-1112.655] (-1119.980) * (-1115.588) (-1114.266) [-1111.929] (-1115.980) -- 0:02:44
      94000 -- (-1117.857) [-1119.178] (-1110.799) (-1121.125) * (-1119.011) (-1117.933) [-1109.753] (-1121.883) -- 0:02:43
      94500 -- (-1111.179) (-1113.013) (-1116.197) [-1113.555] * (-1115.706) (-1117.795) (-1118.429) [-1118.120] -- 0:02:52
      95000 -- [-1115.136] (-1117.033) (-1110.961) (-1124.052) * (-1111.830) (-1111.799) (-1121.783) [-1120.188] -- 0:02:51

      Average standard deviation of split frequencies: 0.006547

      95500 -- (-1124.711) [-1120.339] (-1108.976) (-1120.556) * (-1118.162) [-1118.462] (-1114.048) (-1121.225) -- 0:02:50
      96000 -- (-1124.318) (-1117.624) (-1119.876) [-1119.079] * (-1119.653) [-1113.329] (-1113.187) (-1120.781) -- 0:02:49
      96500 -- [-1114.607] (-1112.944) (-1115.743) (-1115.196) * (-1114.640) (-1122.581) [-1113.843] (-1123.444) -- 0:02:48
      97000 -- (-1117.014) (-1112.532) [-1120.714] (-1110.963) * (-1113.343) (-1120.246) [-1112.023] (-1124.114) -- 0:02:47
      97500 -- (-1117.607) (-1119.260) (-1112.280) [-1117.500] * (-1112.633) (-1123.042) [-1116.590] (-1122.931) -- 0:02:46
      98000 -- (-1111.529) (-1116.287) (-1111.844) [-1117.407] * (-1108.560) (-1118.591) [-1112.468] (-1121.968) -- 0:02:45
      98500 -- (-1112.142) (-1112.455) [-1112.625] (-1111.476) * (-1110.933) [-1113.888] (-1117.102) (-1117.226) -- 0:02:44
      99000 -- (-1118.374) [-1112.401] (-1115.985) (-1116.196) * (-1110.092) (-1112.837) (-1115.367) [-1112.981] -- 0:02:43
      99500 -- [-1113.754] (-1119.582) (-1114.551) (-1113.930) * (-1111.840) (-1114.390) [-1114.666] (-1118.286) -- 0:02:42
      100000 -- (-1114.508) (-1119.510) (-1112.120) [-1117.562] * (-1117.329) (-1114.734) [-1110.287] (-1120.794) -- 0:02:51

      Average standard deviation of split frequencies: 0.004683

      100500 -- [-1110.219] (-1117.183) (-1113.452) (-1116.888) * (-1116.330) [-1111.192] (-1115.825) (-1116.693) -- 0:02:50
      101000 -- (-1109.915) (-1117.643) [-1115.203] (-1118.607) * (-1111.772) (-1114.489) [-1116.084] (-1115.249) -- 0:02:49
      101500 -- [-1111.736] (-1114.030) (-1117.107) (-1114.751) * [-1108.574] (-1110.772) (-1116.208) (-1118.384) -- 0:02:48
      102000 -- (-1121.109) (-1111.108) [-1119.562] (-1112.452) * (-1118.413) (-1111.330) (-1112.387) [-1113.028] -- 0:02:47
      102500 -- [-1110.361] (-1111.239) (-1114.668) (-1116.567) * (-1114.517) (-1117.623) (-1111.072) [-1109.175] -- 0:02:46
      103000 -- (-1107.835) (-1124.130) (-1116.572) [-1117.146] * (-1122.826) (-1121.811) (-1114.601) [-1108.503] -- 0:02:45
      103500 -- (-1120.888) (-1115.376) [-1120.343] (-1117.089) * (-1116.919) (-1112.752) [-1111.838] (-1119.670) -- 0:02:44
      104000 -- (-1117.317) [-1112.640] (-1111.401) (-1123.636) * [-1117.978] (-1116.058) (-1114.427) (-1121.863) -- 0:02:43
      104500 -- [-1117.397] (-1117.551) (-1120.736) (-1114.692) * (-1115.962) (-1113.767) [-1112.141] (-1115.255) -- 0:02:42
      105000 -- (-1118.982) (-1118.967) (-1116.920) [-1116.725] * [-1114.734] (-1117.775) (-1113.560) (-1117.651) -- 0:02:50

      Average standard deviation of split frequencies: 0.002965

      105500 -- (-1111.981) (-1125.578) [-1119.812] (-1117.986) * (-1112.728) (-1110.841) [-1116.384] (-1109.315) -- 0:02:49
      106000 -- (-1113.256) (-1119.547) [-1115.344] (-1112.320) * [-1110.203] (-1112.557) (-1115.226) (-1112.548) -- 0:02:48
      106500 -- (-1116.745) (-1113.718) (-1112.042) [-1111.933] * [-1118.391] (-1121.471) (-1119.497) (-1120.557) -- 0:02:47
      107000 -- (-1113.679) (-1113.918) [-1117.934] (-1117.383) * [-1122.266] (-1115.126) (-1113.917) (-1114.696) -- 0:02:46
      107500 -- (-1118.485) (-1119.566) [-1109.661] (-1118.253) * (-1119.938) [-1116.039] (-1116.193) (-1111.021) -- 0:02:46
      108000 -- (-1116.368) [-1115.575] (-1112.506) (-1117.000) * (-1112.167) (-1114.855) (-1122.572) [-1116.056] -- 0:02:45
      108500 -- (-1123.032) (-1115.625) [-1124.706] (-1109.382) * (-1113.086) (-1116.154) [-1118.249] (-1115.743) -- 0:02:44
      109000 -- (-1115.204) (-1119.275) (-1117.330) [-1112.157] * (-1113.941) [-1110.332] (-1120.221) (-1114.909) -- 0:02:43
      109500 -- (-1119.089) (-1116.143) [-1122.072] (-1114.194) * (-1110.627) [-1115.917] (-1118.554) (-1116.920) -- 0:02:42
      110000 -- (-1115.346) [-1113.886] (-1115.726) (-1121.690) * (-1117.258) [-1116.306] (-1116.603) (-1112.685) -- 0:02:41

      Average standard deviation of split frequencies: 0.005680

      110500 -- (-1113.989) [-1111.677] (-1110.450) (-1110.144) * (-1113.687) [-1109.531] (-1115.144) (-1110.777) -- 0:02:49
      111000 -- (-1120.849) (-1115.711) (-1123.471) [-1109.179] * (-1116.241) (-1117.651) (-1117.801) [-1111.994] -- 0:02:48
      111500 -- [-1116.505] (-1117.938) (-1123.000) (-1116.307) * [-1110.728] (-1111.672) (-1120.502) (-1111.365) -- 0:02:47
      112000 -- (-1114.417) (-1124.904) (-1117.034) [-1115.193] * (-1109.160) [-1111.906] (-1110.181) (-1117.572) -- 0:02:46
      112500 -- [-1113.887] (-1117.028) (-1115.698) (-1112.982) * [-1112.993] (-1112.904) (-1110.934) (-1110.949) -- 0:02:45
      113000 -- (-1115.076) [-1117.951] (-1128.878) (-1113.421) * (-1111.946) [-1110.722] (-1112.280) (-1113.473) -- 0:02:44
      113500 -- (-1114.730) (-1118.833) [-1114.494] (-1110.664) * (-1114.892) [-1111.114] (-1114.652) (-1112.083) -- 0:02:44
      114000 -- (-1114.885) (-1113.241) [-1117.503] (-1113.475) * (-1110.829) (-1109.834) (-1118.220) [-1115.293] -- 0:02:43
      114500 -- [-1117.528] (-1115.631) (-1120.648) (-1119.322) * (-1110.076) (-1114.567) [-1118.331] (-1112.413) -- 0:02:42
      115000 -- (-1118.478) (-1114.888) [-1119.220] (-1115.648) * (-1126.749) (-1116.269) (-1112.820) [-1111.999] -- 0:02:41

      Average standard deviation of split frequencies: 0.002709

      115500 -- (-1120.343) [-1114.836] (-1124.949) (-1118.432) * (-1116.956) [-1112.867] (-1112.873) (-1111.883) -- 0:02:48
      116000 -- [-1112.087] (-1116.348) (-1115.598) (-1116.771) * (-1118.181) (-1122.826) (-1116.187) [-1111.666] -- 0:02:47
      116500 -- (-1111.796) (-1113.320) [-1117.706] (-1111.817) * (-1109.813) (-1109.548) (-1114.254) [-1109.461] -- 0:02:46
      117000 -- (-1118.309) [-1113.279] (-1113.094) (-1123.094) * (-1115.616) [-1116.573] (-1114.562) (-1113.032) -- 0:02:46
      117500 -- (-1115.167) [-1114.030] (-1123.556) (-1111.779) * (-1118.993) [-1113.075] (-1113.338) (-1110.222) -- 0:02:45
      118000 -- (-1115.932) (-1118.115) [-1110.792] (-1111.193) * (-1122.567) (-1122.512) (-1113.795) [-1108.809] -- 0:02:44
      118500 -- (-1112.928) (-1116.973) (-1114.922) [-1118.475] * (-1120.998) [-1110.353] (-1113.795) (-1111.499) -- 0:02:43
      119000 -- [-1117.376] (-1117.042) (-1112.225) (-1119.283) * (-1119.394) (-1111.659) (-1114.058) [-1112.274] -- 0:02:42
      119500 -- [-1117.601] (-1112.441) (-1116.303) (-1124.146) * (-1112.703) [-1108.344] (-1114.976) (-1117.801) -- 0:02:42
      120000 -- (-1117.641) [-1112.723] (-1117.081) (-1115.738) * (-1115.312) (-1116.817) [-1115.188] (-1120.536) -- 0:02:41

      Average standard deviation of split frequencies: 0.002604

      120500 -- (-1110.338) [-1112.501] (-1115.183) (-1117.228) * (-1111.925) (-1116.012) (-1116.637) [-1114.339] -- 0:02:40
      121000 -- [-1114.532] (-1121.625) (-1114.635) (-1118.677) * [-1112.705] (-1117.254) (-1110.127) (-1119.845) -- 0:02:47
      121500 -- [-1112.628] (-1114.146) (-1111.935) (-1118.177) * (-1115.640) (-1109.884) (-1112.817) [-1119.083] -- 0:02:46
      122000 -- [-1113.289] (-1118.340) (-1117.790) (-1128.036) * [-1110.524] (-1112.366) (-1110.779) (-1121.111) -- 0:02:45
      122500 -- (-1116.227) (-1123.654) [-1113.181] (-1121.542) * (-1121.067) (-1113.048) [-1111.986] (-1127.125) -- 0:02:44
      123000 -- (-1116.999) (-1119.853) [-1111.504] (-1126.557) * (-1109.624) (-1111.244) (-1118.144) [-1113.915] -- 0:02:43
      123500 -- (-1117.467) (-1119.466) [-1109.324] (-1124.591) * (-1119.767) (-1113.209) (-1112.377) [-1118.661] -- 0:02:43
      124000 -- (-1121.269) (-1114.205) [-1113.409] (-1122.872) * (-1123.102) [-1117.664] (-1113.869) (-1119.558) -- 0:02:42
      124500 -- (-1111.538) (-1113.350) [-1113.783] (-1126.829) * (-1116.930) (-1113.327) [-1112.169] (-1112.910) -- 0:02:41
      125000 -- (-1114.602) (-1116.573) [-1119.550] (-1128.862) * (-1117.267) (-1118.568) [-1118.005] (-1112.837) -- 0:02:41

      Average standard deviation of split frequencies: 0.002494

      125500 -- (-1111.084) [-1109.859] (-1109.092) (-1122.033) * (-1117.282) [-1115.005] (-1116.594) (-1112.998) -- 0:02:40
      126000 -- (-1118.980) [-1111.688] (-1114.791) (-1129.431) * (-1118.914) (-1121.898) (-1108.949) [-1110.042] -- 0:02:46
      126500 -- (-1113.990) (-1114.481) [-1114.138] (-1120.591) * [-1115.547] (-1114.827) (-1113.025) (-1112.899) -- 0:02:45
      127000 -- (-1110.531) (-1123.900) [-1108.347] (-1109.909) * (-1126.163) (-1113.774) [-1115.514] (-1110.498) -- 0:02:44
      127500 -- (-1115.601) (-1119.495) (-1108.572) [-1114.692] * (-1112.195) (-1112.112) (-1121.621) [-1115.895] -- 0:02:44
      128000 -- [-1110.628] (-1115.257) (-1110.507) (-1110.087) * (-1118.175) [-1113.430] (-1110.532) (-1113.716) -- 0:02:43
      128500 -- (-1111.917) [-1112.841] (-1116.371) (-1114.657) * (-1119.141) (-1122.252) (-1116.049) [-1112.336] -- 0:02:42
      129000 -- (-1117.250) [-1114.580] (-1123.991) (-1113.890) * (-1121.315) [-1116.203] (-1114.064) (-1122.947) -- 0:02:42
      129500 -- (-1123.069) (-1110.929) [-1115.904] (-1117.809) * (-1117.221) [-1110.100] (-1118.444) (-1126.006) -- 0:02:41
      130000 -- (-1117.343) (-1122.247) (-1110.843) [-1110.572] * (-1112.284) (-1117.353) [-1116.783] (-1128.118) -- 0:02:40

      Average standard deviation of split frequencies: 0.002405

      130500 -- (-1117.312) (-1116.593) [-1110.894] (-1112.028) * (-1112.313) [-1118.102] (-1123.675) (-1123.165) -- 0:02:39
      131000 -- (-1112.477) (-1114.536) [-1117.404] (-1112.971) * (-1119.102) (-1114.594) (-1113.403) [-1117.517] -- 0:02:39
      131500 -- [-1113.289] (-1117.178) (-1109.767) (-1114.524) * (-1121.636) (-1109.985) (-1111.657) [-1114.886] -- 0:02:45
      132000 -- (-1117.492) (-1122.791) [-1122.820] (-1119.635) * (-1123.077) (-1114.105) (-1117.935) [-1113.436] -- 0:02:44
      132500 -- [-1110.645] (-1111.256) (-1115.708) (-1116.686) * [-1109.616] (-1120.311) (-1123.134) (-1110.474) -- 0:02:43
      133000 -- (-1120.181) (-1114.678) (-1114.132) [-1112.305] * (-1112.386) (-1113.800) [-1115.645] (-1113.106) -- 0:02:42
      133500 -- (-1116.220) (-1118.934) [-1111.535] (-1115.250) * (-1109.814) [-1112.630] (-1113.792) (-1111.312) -- 0:02:42
      134000 -- (-1116.238) [-1115.698] (-1110.468) (-1112.357) * (-1127.867) [-1110.307] (-1114.497) (-1111.619) -- 0:02:41
      134500 -- [-1111.651] (-1116.838) (-1114.077) (-1111.916) * [-1120.551] (-1112.920) (-1114.178) (-1112.198) -- 0:02:40
      135000 -- [-1114.586] (-1111.661) (-1113.264) (-1114.245) * (-1117.236) (-1115.572) (-1116.171) [-1110.631] -- 0:02:40

      Average standard deviation of split frequencies: 0.002311

      135500 -- (-1121.120) (-1115.423) (-1113.090) [-1113.890] * (-1115.615) [-1113.987] (-1116.142) (-1117.356) -- 0:02:39
      136000 -- [-1116.042] (-1114.427) (-1116.419) (-1122.509) * (-1109.337) (-1124.923) [-1114.230] (-1120.884) -- 0:02:38
      136500 -- (-1117.281) (-1118.784) [-1109.175] (-1115.078) * (-1116.636) [-1114.283] (-1118.968) (-1115.899) -- 0:02:38
      137000 -- [-1115.731] (-1114.720) (-1108.632) (-1118.651) * (-1111.485) (-1115.328) (-1114.759) [-1123.691] -- 0:02:43
      137500 -- [-1109.485] (-1112.270) (-1109.486) (-1115.341) * (-1115.430) (-1115.631) (-1117.561) [-1110.842] -- 0:02:43
      138000 -- (-1110.043) (-1111.407) [-1114.584] (-1112.303) * (-1115.551) (-1117.374) [-1110.577] (-1115.118) -- 0:02:42
      138500 -- [-1108.063] (-1117.615) (-1114.584) (-1116.649) * (-1121.221) [-1114.875] (-1109.020) (-1114.697) -- 0:02:41
      139000 -- (-1118.527) (-1116.325) (-1119.124) [-1119.209] * (-1107.833) [-1112.569] (-1115.338) (-1119.034) -- 0:02:41
      139500 -- [-1116.845] (-1121.578) (-1114.125) (-1110.274) * (-1117.652) (-1112.608) (-1118.969) [-1116.722] -- 0:02:40
      140000 -- (-1116.478) (-1117.793) (-1125.584) [-1114.246] * (-1116.548) [-1112.043] (-1112.962) (-1111.635) -- 0:02:39

      Average standard deviation of split frequencies: 0.004468

      140500 -- (-1116.704) (-1113.282) (-1124.925) [-1120.070] * (-1115.065) (-1112.377) [-1112.862] (-1113.517) -- 0:02:39
      141000 -- (-1113.680) [-1117.781] (-1129.056) (-1122.043) * [-1117.295] (-1113.681) (-1114.321) (-1111.328) -- 0:02:38
      141500 -- (-1115.618) [-1115.778] (-1123.336) (-1123.366) * (-1111.678) (-1110.810) [-1110.867] (-1114.649) -- 0:02:37
      142000 -- (-1119.405) (-1117.383) (-1126.906) [-1110.273] * [-1112.506] (-1115.435) (-1111.227) (-1111.291) -- 0:02:43
      142500 -- [-1114.015] (-1119.371) (-1114.592) (-1113.570) * [-1113.104] (-1111.071) (-1118.702) (-1109.892) -- 0:02:42
      143000 -- (-1112.795) [-1114.387] (-1119.723) (-1112.652) * (-1112.650) [-1110.697] (-1119.035) (-1117.594) -- 0:02:41
      143500 -- (-1116.999) (-1119.072) [-1114.212] (-1113.613) * (-1110.093) (-1111.605) (-1123.556) [-1113.664] -- 0:02:41
      144000 -- (-1113.515) (-1115.421) [-1121.293] (-1112.363) * (-1112.839) (-1108.499) [-1110.920] (-1115.614) -- 0:02:40
      144500 -- (-1118.298) (-1112.868) [-1118.277] (-1118.804) * (-1115.536) (-1115.384) (-1116.548) [-1114.218] -- 0:02:39
      145000 -- [-1115.798] (-1114.051) (-1119.054) (-1113.839) * (-1119.664) [-1117.375] (-1118.319) (-1112.389) -- 0:02:39

      Average standard deviation of split frequencies: 0.001076

      145500 -- (-1118.851) (-1118.932) (-1112.444) [-1115.897] * (-1117.662) [-1115.940] (-1114.528) (-1112.344) -- 0:02:38
      146000 -- (-1118.081) (-1123.888) [-1112.416] (-1120.265) * (-1116.253) (-1114.748) (-1112.744) [-1108.453] -- 0:02:37
      146500 -- (-1117.502) [-1111.678] (-1117.731) (-1116.897) * [-1112.453] (-1112.325) (-1113.158) (-1117.020) -- 0:02:37
      147000 -- [-1122.153] (-1117.671) (-1125.495) (-1119.992) * (-1111.084) (-1120.470) [-1116.157] (-1110.919) -- 0:02:36
      147500 -- (-1117.759) [-1110.020] (-1127.487) (-1114.794) * (-1111.587) [-1113.270] (-1115.198) (-1114.709) -- 0:02:41
      148000 -- (-1118.483) (-1114.886) [-1121.730] (-1112.760) * (-1113.544) (-1123.507) [-1112.410] (-1123.889) -- 0:02:41
      148500 -- (-1122.927) [-1113.559] (-1121.409) (-1117.155) * [-1109.234] (-1112.352) (-1117.894) (-1115.003) -- 0:02:40
      149000 -- (-1115.913) (-1120.982) (-1119.124) [-1115.192] * [-1114.458] (-1113.387) (-1116.625) (-1110.465) -- 0:02:39
      149500 -- [-1110.934] (-1115.189) (-1109.564) (-1112.213) * (-1114.534) (-1112.168) [-1108.299] (-1110.792) -- 0:02:39
      150000 -- (-1110.376) (-1122.104) (-1116.216) [-1111.719] * (-1110.187) (-1112.628) [-1112.808] (-1114.658) -- 0:02:38

      Average standard deviation of split frequencies: 0.002086

      150500 -- [-1112.651] (-1109.946) (-1114.034) (-1114.122) * (-1113.248) (-1111.807) [-1112.805] (-1115.139) -- 0:02:38
      151000 -- (-1111.991) [-1112.182] (-1117.214) (-1117.011) * (-1114.994) [-1110.943] (-1117.488) (-1110.779) -- 0:02:37
      151500 -- [-1114.988] (-1114.150) (-1114.166) (-1118.247) * (-1109.672) (-1121.780) (-1113.311) [-1111.325] -- 0:02:36
      152000 -- (-1119.959) [-1109.317] (-1114.537) (-1116.048) * (-1109.472) [-1110.194] (-1112.927) (-1116.385) -- 0:02:36
      152500 -- (-1108.978) (-1113.559) (-1115.171) [-1132.878] * (-1118.550) (-1120.520) [-1109.696] (-1115.205) -- 0:02:41
      153000 -- (-1114.268) (-1116.014) [-1117.173] (-1114.241) * (-1118.380) [-1112.126] (-1119.656) (-1112.004) -- 0:02:40
      153500 -- [-1112.568] (-1117.032) (-1113.975) (-1119.743) * (-1111.021) (-1119.777) [-1112.004] (-1113.860) -- 0:02:39
      154000 -- (-1113.294) [-1113.746] (-1110.134) (-1111.024) * [-1112.764] (-1122.358) (-1112.023) (-1116.560) -- 0:02:39
      154500 -- (-1114.821) (-1116.263) (-1115.788) [-1108.789] * (-1120.462) (-1117.854) [-1114.499] (-1122.164) -- 0:02:38
      155000 -- (-1120.523) (-1118.884) (-1113.208) [-1113.817] * (-1125.559) (-1116.439) [-1126.768] (-1113.564) -- 0:02:38

      Average standard deviation of split frequencies: 0.002015

      155500 -- (-1114.767) (-1114.482) (-1113.505) [-1115.683] * [-1117.635] (-1112.761) (-1117.693) (-1121.159) -- 0:02:37
      156000 -- (-1117.315) (-1111.477) (-1114.717) [-1109.436] * [-1117.044] (-1116.409) (-1119.842) (-1115.918) -- 0:02:36
      156500 -- (-1113.092) (-1109.947) (-1118.789) [-1112.920] * [-1116.894] (-1116.239) (-1113.626) (-1120.961) -- 0:02:36
      157000 -- (-1124.070) (-1112.314) (-1118.768) [-1115.308] * (-1108.587) [-1109.058] (-1122.103) (-1116.834) -- 0:02:35
      157500 -- (-1119.191) (-1119.710) (-1111.412) [-1110.022] * (-1122.607) [-1118.304] (-1121.400) (-1116.353) -- 0:02:35
      158000 -- (-1116.347) (-1116.182) [-1112.101] (-1115.656) * [-1110.577] (-1118.463) (-1118.238) (-1111.098) -- 0:02:39
      158500 -- (-1115.851) (-1118.748) [-1110.434] (-1108.403) * (-1114.606) (-1115.506) (-1114.958) [-1110.947] -- 0:02:39
      159000 -- (-1114.362) (-1124.096) [-1118.871] (-1120.251) * (-1110.668) (-1112.114) [-1119.382] (-1121.467) -- 0:02:38
      159500 -- [-1116.623] (-1109.562) (-1116.791) (-1112.991) * (-1111.299) [-1116.354] (-1111.996) (-1109.415) -- 0:02:38
      160000 -- [-1115.551] (-1117.804) (-1119.438) (-1114.288) * [-1111.053] (-1125.102) (-1119.300) (-1115.670) -- 0:02:37

      Average standard deviation of split frequencies: 0.004890

      160500 -- (-1109.755) (-1111.867) [-1119.194] (-1112.415) * (-1115.678) (-1112.518) (-1110.675) [-1117.847] -- 0:02:36
      161000 -- [-1112.743] (-1116.215) (-1116.040) (-1113.573) * (-1116.528) [-1114.273] (-1112.656) (-1114.475) -- 0:02:36
      161500 -- [-1119.543] (-1108.567) (-1114.410) (-1114.295) * (-1119.972) [-1116.416] (-1116.411) (-1119.524) -- 0:02:35
      162000 -- (-1120.116) [-1112.583] (-1113.323) (-1110.538) * [-1118.225] (-1116.236) (-1116.629) (-1119.762) -- 0:02:35
      162500 -- (-1113.257) [-1115.193] (-1113.725) (-1117.787) * (-1113.461) (-1111.767) [-1113.604] (-1116.635) -- 0:02:34
      163000 -- [-1108.374] (-1114.220) (-1113.253) (-1117.911) * [-1117.993] (-1111.619) (-1121.973) (-1125.054) -- 0:02:39
      163500 -- [-1110.350] (-1117.960) (-1119.232) (-1115.226) * [-1113.783] (-1106.946) (-1122.601) (-1125.622) -- 0:02:38
      164000 -- [-1108.031] (-1118.317) (-1125.766) (-1116.675) * (-1118.350) (-1114.900) [-1112.997] (-1118.177) -- 0:02:38
      164500 -- (-1112.155) (-1109.218) [-1111.643] (-1111.022) * (-1111.994) [-1111.392] (-1117.302) (-1110.990) -- 0:02:37
      165000 -- (-1112.708) [-1115.739] (-1115.183) (-1113.283) * [-1120.025] (-1123.210) (-1124.586) (-1116.565) -- 0:02:36

      Average standard deviation of split frequencies: 0.001893

      165500 -- (-1113.313) [-1116.299] (-1117.302) (-1113.901) * (-1112.988) [-1111.204] (-1116.856) (-1117.589) -- 0:02:36
      166000 -- (-1111.374) [-1111.030] (-1116.584) (-1112.518) * [-1112.452] (-1113.614) (-1113.136) (-1116.287) -- 0:02:35
      166500 -- (-1115.765) (-1110.930) [-1116.019] (-1119.619) * (-1114.177) [-1113.029] (-1114.459) (-1116.372) -- 0:02:35
      167000 -- (-1114.198) [-1116.839] (-1114.075) (-1111.567) * (-1121.889) [-1111.407] (-1110.168) (-1109.568) -- 0:02:34
      167500 -- (-1122.924) [-1111.593] (-1111.589) (-1110.703) * [-1112.257] (-1111.419) (-1116.243) (-1114.447) -- 0:02:34
      168000 -- (-1114.936) (-1117.561) (-1117.336) [-1109.915] * (-1115.384) [-1113.205] (-1112.265) (-1121.874) -- 0:02:33
      168500 -- [-1111.711] (-1113.351) (-1114.571) (-1115.907) * (-1113.460) (-1107.333) [-1116.156] (-1119.941) -- 0:02:37
      169000 -- [-1111.170] (-1122.300) (-1122.529) (-1120.807) * (-1115.813) (-1111.281) [-1115.279] (-1120.389) -- 0:02:37
      169500 -- (-1110.636) (-1113.121) [-1112.256] (-1122.192) * (-1116.148) (-1116.846) (-1109.549) [-1122.014] -- 0:02:36
      170000 -- (-1122.863) [-1110.945] (-1115.934) (-1121.834) * (-1119.146) (-1121.746) [-1114.731] (-1118.132) -- 0:02:36

      Average standard deviation of split frequencies: 0.003683

      170500 -- (-1121.810) [-1112.769] (-1122.514) (-1110.464) * (-1113.767) [-1111.930] (-1112.113) (-1114.938) -- 0:02:35
      171000 -- (-1112.587) (-1115.796) (-1114.049) [-1109.916] * [-1119.987] (-1115.315) (-1113.917) (-1112.614) -- 0:02:35
      171500 -- (-1114.314) (-1123.223) (-1118.910) [-1127.144] * (-1115.655) (-1109.982) [-1111.333] (-1117.991) -- 0:02:34
      172000 -- (-1121.161) [-1113.597] (-1120.571) (-1119.550) * (-1114.508) [-1116.054] (-1113.533) (-1122.495) -- 0:02:34
      172500 -- (-1114.213) (-1119.027) (-1117.245) [-1110.646] * (-1110.466) (-1113.465) [-1114.671] (-1119.468) -- 0:02:33
      173000 -- (-1121.533) (-1123.203) [-1112.974] (-1120.073) * (-1109.763) (-1111.844) [-1115.117] (-1113.915) -- 0:02:32
      173500 -- (-1115.435) (-1117.648) [-1114.743] (-1114.000) * (-1121.608) (-1110.589) (-1113.209) [-1111.505] -- 0:02:37
      174000 -- [-1110.777] (-1112.002) (-1115.807) (-1113.732) * [-1116.483] (-1114.464) (-1113.105) (-1117.111) -- 0:02:36
      174500 -- [-1111.892] (-1114.991) (-1113.018) (-1113.086) * [-1109.231] (-1127.776) (-1109.189) (-1113.550) -- 0:02:36
      175000 -- [-1115.893] (-1124.516) (-1115.082) (-1118.651) * (-1111.422) (-1118.603) (-1116.061) [-1108.091] -- 0:02:35

      Average standard deviation of split frequencies: 0.005357

      175500 -- (-1109.851) [-1114.248] (-1112.897) (-1114.836) * [-1110.560] (-1116.824) (-1107.380) (-1107.990) -- 0:02:35
      176000 -- (-1113.482) [-1108.445] (-1121.592) (-1112.510) * [-1114.212] (-1115.100) (-1115.902) (-1116.415) -- 0:02:34
      176500 -- (-1117.627) (-1114.875) [-1110.143] (-1114.368) * (-1116.629) (-1112.126) [-1112.872] (-1113.859) -- 0:02:33
      177000 -- (-1114.908) (-1114.967) (-1115.408) [-1112.580] * (-1116.968) (-1113.894) [-1115.280] (-1114.432) -- 0:02:33
      177500 -- (-1119.081) [-1108.713] (-1115.926) (-1117.274) * (-1115.446) (-1113.570) (-1119.210) [-1112.983] -- 0:02:32
      178000 -- (-1117.102) [-1110.047] (-1117.691) (-1115.691) * (-1116.641) (-1119.162) [-1114.311] (-1112.956) -- 0:02:32
      178500 -- (-1119.205) [-1113.572] (-1118.465) (-1111.157) * [-1120.468] (-1116.920) (-1121.351) (-1116.535) -- 0:02:31
      179000 -- (-1111.824) (-1110.583) (-1118.104) [-1109.646] * (-1112.771) (-1107.936) [-1118.578] (-1111.825) -- 0:02:35
      179500 -- [-1115.437] (-1115.860) (-1118.213) (-1111.564) * [-1109.621] (-1109.828) (-1113.748) (-1112.422) -- 0:02:35
      180000 -- (-1116.387) [-1115.646] (-1109.356) (-1120.084) * (-1112.467) (-1112.809) (-1124.627) [-1108.480] -- 0:02:34

      Average standard deviation of split frequencies: 0.006958

      180500 -- [-1112.227] (-1112.681) (-1117.808) (-1126.294) * [-1113.170] (-1117.369) (-1113.402) (-1118.078) -- 0:02:34
      181000 -- (-1111.560) [-1114.273] (-1118.094) (-1122.289) * [-1108.924] (-1118.626) (-1116.845) (-1120.705) -- 0:02:33
      181500 -- [-1110.888] (-1113.637) (-1114.164) (-1117.823) * (-1117.505) (-1113.004) (-1118.134) [-1112.554] -- 0:02:33
      182000 -- (-1120.511) (-1115.784) (-1117.350) [-1116.887] * [-1109.583] (-1122.527) (-1116.801) (-1113.661) -- 0:02:32
      182500 -- (-1114.743) [-1118.429] (-1123.610) (-1116.140) * [-1114.455] (-1111.451) (-1125.539) (-1112.982) -- 0:02:32
      183000 -- (-1114.909) (-1111.787) (-1114.964) [-1113.094] * (-1110.784) [-1114.419] (-1111.194) (-1113.761) -- 0:02:31
      183500 -- (-1118.427) (-1116.972) [-1114.111] (-1112.039) * (-1117.307) [-1113.761] (-1113.128) (-1116.573) -- 0:02:31
      184000 -- (-1115.356) (-1113.563) [-1114.683] (-1111.870) * (-1118.704) (-1110.901) [-1119.463] (-1122.970) -- 0:02:30
      184500 -- [-1110.619] (-1111.544) (-1120.117) (-1109.772) * (-1114.737) (-1115.079) (-1125.551) [-1107.843] -- 0:02:34
      185000 -- (-1122.928) (-1116.511) (-1110.733) [-1116.082] * [-1119.244] (-1116.966) (-1122.304) (-1114.181) -- 0:02:34

      Average standard deviation of split frequencies: 0.005914

      185500 -- [-1110.981] (-1121.390) (-1114.777) (-1112.006) * (-1118.134) (-1112.003) [-1112.495] (-1108.980) -- 0:02:33
      186000 -- (-1113.841) (-1110.702) (-1119.939) [-1112.332] * (-1122.140) [-1110.674] (-1127.492) (-1111.817) -- 0:02:33
      186500 -- (-1111.721) (-1111.413) (-1113.545) [-1112.127] * (-1113.165) (-1111.308) (-1123.532) [-1110.506] -- 0:02:32
      187000 -- [-1110.311] (-1110.879) (-1114.113) (-1115.961) * [-1112.988] (-1115.438) (-1119.863) (-1107.326) -- 0:02:32
      187500 -- (-1115.814) [-1112.126] (-1116.182) (-1115.309) * (-1117.994) (-1111.477) [-1118.857] (-1119.162) -- 0:02:31
      188000 -- (-1113.408) (-1111.765) (-1108.758) [-1110.235] * [-1118.037] (-1110.960) (-1117.551) (-1117.117) -- 0:02:31
      188500 -- (-1118.595) (-1117.629) (-1112.273) [-1113.741] * [-1120.414] (-1114.633) (-1118.098) (-1122.806) -- 0:02:30
      189000 -- (-1115.589) (-1115.763) (-1113.559) [-1113.198] * [-1119.198] (-1115.703) (-1115.412) (-1121.897) -- 0:02:30
      189500 -- (-1111.624) (-1114.834) [-1115.418] (-1120.038) * (-1124.189) (-1123.855) (-1107.716) [-1115.648] -- 0:02:33
      190000 -- (-1115.035) [-1110.565] (-1115.069) (-1117.588) * (-1118.354) (-1120.748) [-1108.078] (-1110.516) -- 0:02:33

      Average standard deviation of split frequencies: 0.004945

      190500 -- (-1110.252) (-1114.396) [-1115.129] (-1117.014) * [-1112.446] (-1129.248) (-1116.533) (-1111.315) -- 0:02:32
      191000 -- [-1118.856] (-1114.443) (-1119.938) (-1114.385) * (-1112.406) (-1118.520) [-1113.067] (-1114.001) -- 0:02:32
      191500 -- (-1121.286) [-1115.453] (-1108.954) (-1110.710) * (-1117.868) (-1119.766) (-1113.974) [-1116.403] -- 0:02:31
      192000 -- (-1121.853) (-1114.441) [-1114.562] (-1114.690) * (-1115.079) (-1114.156) (-1124.597) [-1111.740] -- 0:02:31
      192500 -- (-1117.879) (-1113.131) (-1117.018) [-1112.661] * (-1111.530) [-1111.582] (-1119.011) (-1113.716) -- 0:02:31
      193000 -- (-1115.049) (-1113.539) (-1115.244) [-1117.725] * [-1113.048] (-1113.531) (-1123.299) (-1114.531) -- 0:02:30
      193500 -- [-1117.159] (-1118.362) (-1111.889) (-1111.288) * (-1117.558) [-1116.166] (-1110.291) (-1112.999) -- 0:02:30
      194000 -- (-1124.017) (-1119.146) [-1110.499] (-1113.632) * (-1113.346) (-1117.366) (-1117.076) [-1114.195] -- 0:02:29
      194500 -- (-1116.902) (-1118.073) [-1111.007] (-1110.452) * [-1117.160] (-1119.858) (-1116.606) (-1113.644) -- 0:02:29
      195000 -- (-1125.144) [-1111.578] (-1118.961) (-1113.714) * [-1117.781] (-1111.822) (-1112.175) (-1110.535) -- 0:02:32

      Average standard deviation of split frequencies: 0.007215

      195500 -- (-1114.167) (-1113.876) [-1121.371] (-1126.382) * [-1110.627] (-1115.674) (-1116.254) (-1116.158) -- 0:02:32
      196000 -- (-1113.518) (-1119.369) [-1115.783] (-1127.261) * (-1118.905) [-1112.173] (-1117.220) (-1114.233) -- 0:02:31
      196500 -- [-1113.919] (-1113.388) (-1119.918) (-1122.753) * (-1116.428) (-1116.099) [-1110.583] (-1122.787) -- 0:02:31
      197000 -- [-1114.359] (-1113.862) (-1111.868) (-1128.913) * (-1120.504) (-1115.433) (-1115.955) [-1113.566] -- 0:02:30
      197500 -- (-1111.742) (-1111.780) (-1111.908) [-1108.551] * [-1117.124] (-1121.414) (-1119.027) (-1113.977) -- 0:02:30
      198000 -- (-1115.699) [-1118.812] (-1117.119) (-1113.953) * (-1111.571) (-1114.057) (-1114.886) [-1111.880] -- 0:02:29
      198500 -- (-1119.225) (-1115.033) (-1116.468) [-1120.153] * [-1115.131] (-1116.104) (-1117.248) (-1115.423) -- 0:02:29
      199000 -- [-1110.661] (-1118.864) (-1112.789) (-1116.347) * (-1110.915) (-1118.089) (-1118.696) [-1115.267] -- 0:02:28
      199500 -- (-1109.219) (-1121.027) (-1110.359) [-1113.219] * [-1116.344] (-1112.019) (-1116.824) (-1114.144) -- 0:02:28
      200000 -- [-1113.481] (-1122.021) (-1111.824) (-1109.502) * [-1115.143] (-1115.255) (-1117.332) (-1119.973) -- 0:02:32

      Average standard deviation of split frequencies: 0.006265

      200500 -- (-1110.895) (-1114.012) [-1115.638] (-1117.550) * (-1116.971) [-1113.720] (-1117.245) (-1114.765) -- 0:02:31
      201000 -- [-1124.783] (-1119.995) (-1118.001) (-1115.004) * [-1112.735] (-1115.020) (-1113.990) (-1115.930) -- 0:02:31
      201500 -- [-1118.241] (-1116.172) (-1111.419) (-1119.290) * (-1123.648) (-1115.184) [-1117.219] (-1117.382) -- 0:02:30
      202000 -- (-1108.765) (-1113.346) [-1111.492] (-1121.310) * (-1114.342) [-1113.174] (-1114.898) (-1119.062) -- 0:02:30
      202500 -- [-1115.446] (-1111.403) (-1118.290) (-1119.413) * (-1120.476) (-1117.828) [-1117.474] (-1122.900) -- 0:02:29
      203000 -- (-1121.171) [-1112.172] (-1118.211) (-1123.252) * [-1115.701] (-1125.499) (-1112.821) (-1120.388) -- 0:02:29
      203500 -- (-1114.993) (-1113.747) [-1115.260] (-1114.898) * (-1114.820) [-1115.043] (-1118.304) (-1117.043) -- 0:02:28
      204000 -- (-1117.680) [-1115.454] (-1121.729) (-1115.743) * (-1120.961) (-1114.566) [-1115.106] (-1119.993) -- 0:02:28
      204500 -- (-1114.005) (-1112.875) (-1122.351) [-1118.073] * (-1112.860) [-1107.913] (-1114.374) (-1115.502) -- 0:02:27
      205000 -- (-1113.674) (-1112.844) (-1125.145) [-1114.903] * [-1115.646] (-1113.841) (-1119.489) (-1120.279) -- 0:02:27

      Average standard deviation of split frequencies: 0.003051

      205500 -- (-1119.093) (-1118.701) (-1117.151) [-1114.526] * (-1112.792) (-1111.290) (-1121.777) [-1113.294] -- 0:02:30
      206000 -- (-1111.485) (-1119.230) (-1119.230) [-1115.725] * (-1114.997) (-1117.596) (-1113.532) [-1117.335] -- 0:02:30
      206500 -- (-1113.058) (-1110.507) (-1114.873) [-1112.864] * (-1124.111) [-1115.027] (-1111.581) (-1123.102) -- 0:02:29
      207000 -- (-1125.270) (-1114.309) [-1112.049] (-1114.351) * [-1118.091] (-1111.456) (-1110.110) (-1117.289) -- 0:02:29
      207500 -- (-1120.672) [-1112.433] (-1113.215) (-1120.876) * (-1117.851) (-1110.982) (-1112.736) [-1113.926] -- 0:02:28
      208000 -- (-1121.926) (-1111.103) (-1110.038) [-1113.984] * [-1114.894] (-1117.270) (-1115.604) (-1114.542) -- 0:02:28
      208500 -- (-1121.372) (-1111.867) [-1112.491] (-1120.807) * (-1119.850) (-1111.869) (-1120.971) [-1111.541] -- 0:02:28
      209000 -- (-1127.826) (-1117.796) [-1114.142] (-1113.135) * (-1117.676) (-1124.247) (-1118.201) [-1111.952] -- 0:02:27
      209500 -- (-1125.015) [-1112.758] (-1114.145) (-1119.948) * (-1117.058) (-1118.433) (-1115.342) [-1109.750] -- 0:02:27
      210000 -- (-1114.707) (-1115.997) (-1120.093) [-1112.326] * (-1115.541) (-1116.612) (-1115.673) [-1108.943] -- 0:02:26

      Average standard deviation of split frequencies: 0.002984

      210500 -- (-1115.084) (-1112.483) [-1112.118] (-1110.322) * (-1113.546) [-1114.069] (-1118.200) (-1112.160) -- 0:02:30
      211000 -- (-1110.237) (-1108.846) [-1109.573] (-1112.334) * (-1111.125) [-1114.069] (-1116.096) (-1116.866) -- 0:02:29
      211500 -- (-1123.380) [-1114.037] (-1114.887) (-1113.161) * (-1118.498) (-1121.504) (-1120.647) [-1112.961] -- 0:02:29
      212000 -- (-1121.426) (-1114.986) (-1115.486) [-1110.994] * (-1115.779) [-1111.069] (-1116.534) (-1113.934) -- 0:02:28
      212500 -- (-1115.617) (-1110.316) (-1118.312) [-1109.951] * (-1118.071) [-1111.172] (-1109.957) (-1120.938) -- 0:02:28
      213000 -- (-1118.684) (-1114.325) (-1119.398) [-1115.594] * [-1115.516] (-1118.759) (-1111.775) (-1127.370) -- 0:02:27
      213500 -- [-1116.990] (-1125.034) (-1115.063) (-1118.305) * (-1114.688) (-1120.952) (-1114.485) [-1123.463] -- 0:02:27
      214000 -- (-1111.595) (-1110.946) [-1114.767] (-1113.328) * (-1119.225) (-1110.625) [-1110.444] (-1124.556) -- 0:02:26
      214500 -- (-1113.015) (-1115.303) (-1116.869) [-1110.889] * (-1112.028) [-1111.735] (-1115.968) (-1112.401) -- 0:02:26
      215000 -- (-1112.750) (-1117.551) (-1115.689) [-1111.274] * [-1111.095] (-1121.289) (-1117.629) (-1109.091) -- 0:02:26

      Average standard deviation of split frequencies: 0.003637

      215500 -- [-1109.528] (-1114.431) (-1111.969) (-1118.117) * (-1117.189) (-1114.097) [-1117.601] (-1111.006) -- 0:02:25
      216000 -- (-1112.001) (-1113.420) (-1118.834) [-1108.543] * (-1111.500) (-1112.269) [-1118.849] (-1117.290) -- 0:02:28
      216500 -- (-1112.198) (-1123.991) (-1119.037) [-1112.996] * (-1111.086) [-1113.046] (-1109.445) (-1114.402) -- 0:02:28
      217000 -- (-1110.014) (-1111.903) (-1120.744) [-1116.088] * (-1111.992) [-1115.506] (-1113.103) (-1120.478) -- 0:02:27
      217500 -- [-1113.234] (-1109.588) (-1117.874) (-1118.078) * (-1114.292) (-1114.666) (-1112.599) [-1118.048] -- 0:02:27
      218000 -- [-1112.681] (-1112.349) (-1113.708) (-1111.745) * (-1115.531) [-1113.503] (-1119.006) (-1116.420) -- 0:02:27
      218500 -- (-1119.914) (-1116.383) (-1113.353) [-1114.393] * [-1118.096] (-1122.301) (-1122.536) (-1111.124) -- 0:02:26
      219000 -- [-1115.663] (-1114.196) (-1123.307) (-1107.895) * (-1115.983) (-1116.211) [-1111.258] (-1110.169) -- 0:02:26
      219500 -- [-1117.466] (-1119.722) (-1116.650) (-1115.982) * (-1121.965) [-1111.869] (-1113.523) (-1108.401) -- 0:02:25
      220000 -- [-1120.651] (-1118.950) (-1121.057) (-1110.363) * (-1125.715) [-1111.269] (-1111.237) (-1112.755) -- 0:02:25

      Average standard deviation of split frequencies: 0.002136

      220500 -- (-1120.111) (-1119.045) [-1116.283] (-1115.110) * (-1116.426) (-1112.759) [-1115.700] (-1115.366) -- 0:02:24
      221000 -- (-1112.887) (-1131.889) (-1115.194) [-1115.142] * (-1122.258) (-1112.264) (-1110.169) [-1116.818] -- 0:02:24
      221500 -- [-1115.907] (-1111.971) (-1119.947) (-1113.101) * (-1117.416) [-1111.250] (-1111.488) (-1118.477) -- 0:02:27
      222000 -- (-1113.325) (-1111.571) [-1114.882] (-1111.466) * (-1119.297) (-1110.205) [-1116.434] (-1117.220) -- 0:02:27
      222500 -- (-1110.715) [-1118.257] (-1122.507) (-1113.028) * (-1117.324) (-1123.643) [-1119.460] (-1118.504) -- 0:02:26
      223000 -- (-1122.953) (-1118.042) [-1114.207] (-1121.075) * (-1108.114) [-1115.964] (-1117.866) (-1118.625) -- 0:02:26
      223500 -- (-1116.035) (-1110.618) (-1121.886) [-1112.708] * [-1111.332] (-1110.844) (-1112.883) (-1126.040) -- 0:02:25
      224000 -- (-1119.326) (-1111.873) [-1116.593] (-1109.150) * [-1109.523] (-1114.083) (-1112.030) (-1122.369) -- 0:02:25
      224500 -- (-1114.847) (-1113.855) (-1114.463) [-1109.731] * [-1112.860] (-1111.498) (-1113.341) (-1113.426) -- 0:02:25
      225000 -- [-1119.275] (-1116.689) (-1115.670) (-1116.381) * (-1110.835) (-1118.019) [-1115.800] (-1119.622) -- 0:02:24

      Average standard deviation of split frequencies: 0.002086

      225500 -- (-1114.587) (-1118.257) (-1112.436) [-1109.842] * [-1115.859] (-1115.051) (-1112.889) (-1116.768) -- 0:02:24
      226000 -- (-1111.856) (-1114.545) (-1112.638) [-1117.247] * [-1117.295] (-1123.635) (-1116.366) (-1117.693) -- 0:02:23
      226500 -- (-1116.766) [-1114.120] (-1116.169) (-1115.621) * (-1116.396) [-1113.702] (-1125.956) (-1121.433) -- 0:02:26
      227000 -- (-1110.573) (-1116.876) (-1113.296) [-1116.639] * (-1113.604) [-1110.513] (-1113.886) (-1120.652) -- 0:02:26
      227500 -- (-1111.136) [-1115.462] (-1122.232) (-1114.761) * (-1128.987) [-1112.483] (-1118.802) (-1115.020) -- 0:02:26
      228000 -- [-1115.918] (-1111.624) (-1116.993) (-1118.244) * (-1120.054) (-1112.000) (-1119.037) [-1116.865] -- 0:02:25
      228500 -- [-1110.080] (-1113.829) (-1114.677) (-1119.375) * (-1116.542) (-1121.389) [-1112.534] (-1114.701) -- 0:02:25
      229000 -- [-1111.118] (-1112.011) (-1116.459) (-1111.075) * (-1114.843) (-1118.733) [-1111.288] (-1114.668) -- 0:02:24
      229500 -- (-1115.009) [-1115.524] (-1120.642) (-1113.928) * (-1111.425) [-1113.748] (-1115.790) (-1110.718) -- 0:02:24
      230000 -- [-1121.167] (-1123.503) (-1118.991) (-1119.818) * [-1113.572] (-1112.848) (-1111.284) (-1117.986) -- 0:02:23

      Average standard deviation of split frequencies: 0.001362

      230500 -- (-1115.880) [-1117.938] (-1125.715) (-1115.698) * (-1124.284) (-1119.022) (-1118.132) [-1109.772] -- 0:02:23
      231000 -- [-1114.412] (-1119.715) (-1119.456) (-1112.586) * (-1124.378) [-1110.628] (-1114.309) (-1119.286) -- 0:02:23
      231500 -- (-1117.682) (-1116.940) (-1121.150) [-1113.023] * [-1121.298] (-1118.527) (-1119.426) (-1111.581) -- 0:02:22
      232000 -- [-1120.132] (-1113.076) (-1116.782) (-1109.566) * (-1114.989) [-1115.498] (-1116.260) (-1116.641) -- 0:02:25
      232500 -- (-1112.215) [-1107.975] (-1122.192) (-1113.897) * (-1120.182) [-1113.652] (-1119.215) (-1113.205) -- 0:02:25
      233000 -- (-1113.817) (-1109.777) [-1114.070] (-1114.632) * (-1117.650) (-1113.020) [-1118.281] (-1119.647) -- 0:02:24
      233500 -- (-1113.609) (-1118.114) [-1116.804] (-1120.764) * (-1119.578) [-1110.068] (-1118.892) (-1111.973) -- 0:02:24
      234000 -- (-1110.413) (-1108.624) [-1117.560] (-1120.931) * (-1112.443) [-1114.540] (-1115.132) (-1118.589) -- 0:02:24
      234500 -- (-1110.970) (-1114.444) (-1114.176) [-1120.076] * (-1114.153) (-1116.523) (-1115.673) [-1110.992] -- 0:02:23
      235000 -- [-1106.460] (-1114.968) (-1117.432) (-1122.775) * (-1114.243) (-1118.815) (-1120.567) [-1118.928] -- 0:02:23

      Average standard deviation of split frequencies: 0.002663

      235500 -- [-1112.711] (-1119.120) (-1112.097) (-1116.332) * (-1115.965) (-1116.178) [-1108.987] (-1116.216) -- 0:02:22
      236000 -- (-1111.247) (-1129.283) (-1119.154) [-1117.381] * (-1117.026) (-1117.077) [-1116.015] (-1111.657) -- 0:02:22
      236500 -- (-1113.155) (-1110.741) [-1117.437] (-1116.712) * (-1121.980) (-1115.043) (-1116.893) [-1108.972] -- 0:02:22
      237000 -- [-1114.503] (-1118.021) (-1123.568) (-1120.035) * (-1119.109) (-1118.694) (-1114.746) [-1112.472] -- 0:02:24
      237500 -- (-1114.822) (-1114.839) (-1117.630) [-1110.833] * [-1112.830] (-1114.545) (-1116.914) (-1115.410) -- 0:02:24
      238000 -- [-1115.651] (-1117.993) (-1120.389) (-1115.177) * (-1120.242) [-1112.092] (-1122.752) (-1119.060) -- 0:02:24
      238500 -- (-1113.876) (-1117.181) [-1114.861] (-1117.140) * [-1109.401] (-1115.600) (-1114.773) (-1114.475) -- 0:02:23
      239000 -- (-1112.540) (-1115.007) (-1114.148) [-1115.180] * (-1120.190) (-1116.279) (-1116.284) [-1116.082] -- 0:02:23
      239500 -- [-1116.872] (-1124.007) (-1113.742) (-1118.250) * (-1119.253) (-1112.088) [-1110.830] (-1115.523) -- 0:02:22
      240000 -- (-1114.582) (-1121.349) (-1115.608) [-1116.953] * (-1113.864) [-1118.673] (-1108.878) (-1112.312) -- 0:02:22

      Average standard deviation of split frequencies: 0.002612

      240500 -- [-1109.316] (-1119.958) (-1120.834) (-1118.437) * (-1113.567) [-1113.765] (-1115.937) (-1119.856) -- 0:02:22
      241000 -- (-1119.368) (-1114.100) (-1119.844) [-1111.865] * (-1116.367) (-1109.759) [-1111.420] (-1111.058) -- 0:02:21
      241500 -- (-1123.875) (-1122.516) (-1114.611) [-1116.814] * (-1113.076) [-1109.579] (-1119.149) (-1122.177) -- 0:02:21
      242000 -- [-1114.633] (-1117.088) (-1119.862) (-1114.795) * [-1109.736] (-1115.853) (-1113.467) (-1124.733) -- 0:02:20
      242500 -- [-1113.750] (-1112.799) (-1115.161) (-1115.229) * (-1114.019) [-1118.277] (-1111.674) (-1115.851) -- 0:02:23
      243000 -- (-1118.869) (-1114.994) (-1116.275) [-1113.506] * (-1114.502) (-1121.520) [-1115.085] (-1112.504) -- 0:02:23
      243500 -- [-1110.947] (-1109.108) (-1116.705) (-1128.174) * (-1120.264) (-1120.236) [-1114.490] (-1113.582) -- 0:02:22
      244000 -- [-1117.230] (-1126.522) (-1124.563) (-1120.198) * (-1126.588) (-1122.027) (-1111.600) [-1114.315] -- 0:02:22
      244500 -- (-1113.509) (-1118.811) [-1121.166] (-1110.867) * (-1126.943) (-1123.822) (-1112.302) [-1110.345] -- 0:02:22
      245000 -- (-1113.880) (-1118.899) [-1126.008] (-1114.982) * (-1116.034) (-1117.826) (-1114.409) [-1115.981] -- 0:02:21

      Average standard deviation of split frequencies: 0.003194

      245500 -- [-1117.933] (-1113.948) (-1114.194) (-1117.940) * [-1114.400] (-1122.586) (-1112.623) (-1114.468) -- 0:02:21
      246000 -- (-1117.017) [-1118.014] (-1124.839) (-1110.961) * (-1117.978) (-1116.081) (-1118.791) [-1109.808] -- 0:02:20
      246500 -- (-1124.554) [-1121.324] (-1116.610) (-1110.696) * (-1124.152) (-1115.524) (-1114.774) [-1112.699] -- 0:02:20
      247000 -- (-1116.717) [-1119.491] (-1124.078) (-1117.257) * (-1116.480) (-1115.089) [-1118.445] (-1122.163) -- 0:02:20
      247500 -- (-1123.310) [-1115.777] (-1109.981) (-1122.234) * [-1113.832] (-1112.291) (-1112.238) (-1119.993) -- 0:02:19
      248000 -- (-1116.893) [-1113.530] (-1114.463) (-1116.631) * (-1111.670) (-1117.035) [-1109.171] (-1117.196) -- 0:02:22
      248500 -- (-1116.359) [-1111.922] (-1111.884) (-1115.645) * (-1119.058) (-1117.789) [-1113.382] (-1119.733) -- 0:02:22
      249000 -- (-1124.450) (-1111.537) [-1111.103] (-1109.276) * (-1120.402) [-1112.905] (-1108.965) (-1115.046) -- 0:02:21
      249500 -- (-1115.336) (-1114.683) [-1113.663] (-1115.761) * (-1120.859) (-1119.957) [-1114.529] (-1115.519) -- 0:02:21
      250000 -- (-1115.472) [-1111.474] (-1117.650) (-1112.117) * (-1117.762) (-1115.983) [-1110.821] (-1115.882) -- 0:02:21

      Average standard deviation of split frequencies: 0.003134

      250500 -- (-1111.824) (-1113.117) [-1113.789] (-1113.898) * (-1112.541) (-1117.036) (-1111.756) [-1112.648] -- 0:02:20
      251000 -- (-1116.649) [-1117.531] (-1117.410) (-1120.001) * (-1122.698) (-1114.818) [-1107.769] (-1114.865) -- 0:02:20
      251500 -- (-1113.363) (-1110.643) [-1111.517] (-1114.455) * (-1110.912) (-1112.921) [-1111.585] (-1115.622) -- 0:02:19
      252000 -- (-1115.619) [-1111.464] (-1124.187) (-1112.831) * (-1122.886) (-1121.408) (-1114.329) [-1114.540] -- 0:02:19
      252500 -- (-1116.265) (-1114.941) [-1117.768] (-1112.576) * (-1117.628) (-1114.209) (-1113.895) [-1113.333] -- 0:02:19
      253000 -- (-1118.534) (-1112.507) (-1113.104) [-1113.803] * (-1125.250) (-1111.011) (-1110.780) [-1118.286] -- 0:02:21
      253500 -- (-1114.741) (-1114.101) (-1123.048) [-1118.142] * (-1117.919) (-1115.661) (-1110.291) [-1113.059] -- 0:02:21
      254000 -- (-1118.939) [-1116.215] (-1114.912) (-1111.774) * (-1112.540) (-1115.680) (-1122.234) [-1114.571] -- 0:02:20
      254500 -- [-1114.243] (-1115.918) (-1118.967) (-1110.633) * (-1123.295) (-1112.719) (-1114.338) [-1113.501] -- 0:02:20
      255000 -- (-1116.187) (-1119.792) (-1124.017) [-1117.449] * (-1112.424) [-1112.029] (-1113.844) (-1123.439) -- 0:02:20

      Average standard deviation of split frequencies: 0.002455

      255500 -- (-1108.135) (-1112.313) [-1115.089] (-1118.206) * [-1120.018] (-1116.742) (-1112.938) (-1118.767) -- 0:02:19
      256000 -- (-1112.166) [-1113.746] (-1115.181) (-1125.474) * (-1116.995) [-1109.957] (-1121.551) (-1123.408) -- 0:02:19
      256500 -- (-1113.662) (-1113.872) (-1111.090) [-1112.073] * [-1115.690] (-1115.483) (-1115.455) (-1133.094) -- 0:02:19
      257000 -- (-1115.902) (-1117.685) [-1115.080] (-1116.164) * (-1119.251) (-1111.062) (-1108.404) [-1117.869] -- 0:02:18
      257500 -- (-1113.184) (-1109.579) [-1115.127] (-1117.476) * [-1113.663] (-1109.964) (-1118.468) (-1118.532) -- 0:02:18
      258000 -- (-1118.762) (-1112.891) (-1112.729) [-1117.212] * (-1114.831) (-1121.311) (-1111.649) [-1111.377] -- 0:02:18
      258500 -- (-1116.299) (-1114.386) [-1109.867] (-1120.915) * (-1118.393) (-1116.594) (-1114.926) [-1112.571] -- 0:02:20
      259000 -- [-1111.313] (-1109.715) (-1115.400) (-1115.588) * (-1126.553) (-1117.174) [-1115.123] (-1115.811) -- 0:02:20
      259500 -- (-1119.251) [-1112.773] (-1116.516) (-1120.029) * (-1120.142) (-1111.683) [-1121.745] (-1110.408) -- 0:02:19
      260000 -- (-1116.268) [-1117.763] (-1116.085) (-1125.754) * [-1112.564] (-1117.272) (-1115.410) (-1118.972) -- 0:02:19

      Average standard deviation of split frequencies: 0.003617

      260500 -- (-1110.192) [-1123.676] (-1111.728) (-1120.599) * (-1120.326) (-1120.734) [-1114.700] (-1118.311) -- 0:02:19
      261000 -- (-1117.597) (-1117.139) (-1128.830) [-1114.660] * (-1112.889) (-1108.403) (-1113.414) [-1113.243] -- 0:02:18
      261500 -- (-1117.408) [-1109.660] (-1125.184) (-1115.110) * (-1116.189) (-1110.148) (-1114.491) [-1114.820] -- 0:02:18
      262000 -- (-1118.498) (-1114.630) (-1115.965) [-1112.116] * (-1117.913) (-1109.890) (-1113.117) [-1108.203] -- 0:02:18
      262500 -- (-1111.800) [-1120.758] (-1120.888) (-1109.445) * (-1114.246) (-1112.079) [-1119.221] (-1119.301) -- 0:02:17
      263000 -- (-1114.898) [-1112.671] (-1120.222) (-1114.346) * [-1113.325] (-1112.274) (-1118.317) (-1115.134) -- 0:02:17
      263500 -- [-1123.542] (-1113.785) (-1121.155) (-1111.970) * (-1117.310) [-1115.482] (-1111.751) (-1112.507) -- 0:02:19
      264000 -- (-1118.166) [-1109.481] (-1125.636) (-1121.908) * (-1112.255) (-1112.600) [-1113.121] (-1113.271) -- 0:02:19
      264500 -- (-1111.441) [-1120.249] (-1117.288) (-1124.214) * [-1113.874] (-1113.345) (-1109.386) (-1109.573) -- 0:02:19
      265000 -- (-1114.451) [-1111.352] (-1111.888) (-1115.913) * (-1112.071) (-1112.978) [-1112.787] (-1112.094) -- 0:02:18

      Average standard deviation of split frequencies: 0.002954

      265500 -- (-1117.218) (-1116.245) (-1115.341) [-1118.764] * [-1113.970] (-1118.214) (-1119.527) (-1118.845) -- 0:02:18
      266000 -- [-1116.615] (-1124.672) (-1112.439) (-1117.663) * [-1113.762] (-1113.810) (-1114.508) (-1123.061) -- 0:02:17
      266500 -- [-1111.094] (-1117.210) (-1117.932) (-1112.945) * (-1115.391) (-1119.119) (-1111.670) [-1119.522] -- 0:02:17
      267000 -- (-1116.159) (-1119.428) [-1115.025] (-1119.353) * (-1112.595) (-1120.792) [-1118.241] (-1114.276) -- 0:02:17
      267500 -- (-1114.941) (-1125.287) [-1117.722] (-1118.624) * [-1114.714] (-1108.521) (-1123.603) (-1115.884) -- 0:02:16
      268000 -- [-1114.526] (-1121.977) (-1112.563) (-1115.122) * (-1119.645) (-1113.640) [-1117.014] (-1120.484) -- 0:02:16
      268500 -- (-1115.383) [-1121.906] (-1117.004) (-1115.826) * (-1126.429) [-1112.887] (-1118.899) (-1112.823) -- 0:02:16
      269000 -- [-1110.442] (-1119.943) (-1114.433) (-1121.143) * (-1118.820) [-1121.295] (-1115.353) (-1112.441) -- 0:02:18
      269500 -- (-1117.829) (-1122.910) [-1122.096] (-1124.227) * (-1114.827) (-1114.630) [-1112.894] (-1112.769) -- 0:02:18
      270000 -- [-1110.922] (-1114.391) (-1113.843) (-1121.874) * (-1118.884) (-1112.202) [-1115.284] (-1111.049) -- 0:02:17

      Average standard deviation of split frequencies: 0.002903

      270500 -- (-1118.302) (-1121.289) [-1112.114] (-1120.556) * (-1119.376) (-1116.011) [-1110.207] (-1117.097) -- 0:02:17
      271000 -- (-1115.750) (-1114.070) [-1116.482] (-1117.163) * [-1115.461] (-1124.081) (-1112.037) (-1115.812) -- 0:02:17
      271500 -- (-1119.015) [-1114.429] (-1120.343) (-1112.365) * (-1107.893) (-1120.604) (-1115.011) [-1117.271] -- 0:02:16
      272000 -- (-1115.437) [-1111.066] (-1119.677) (-1111.080) * (-1109.009) (-1112.254) (-1114.141) [-1116.750] -- 0:02:16
      272500 -- (-1123.099) [-1111.610] (-1117.578) (-1114.935) * (-1113.262) [-1110.738] (-1119.557) (-1110.129) -- 0:02:16
      273000 -- (-1118.846) [-1111.519] (-1117.249) (-1109.807) * (-1118.434) (-1118.480) (-1118.429) [-1108.589] -- 0:02:15
      273500 -- (-1114.597) (-1114.206) [-1121.731] (-1122.229) * (-1118.753) (-1118.908) (-1128.411) [-1114.775] -- 0:02:15
      274000 -- (-1111.687) (-1120.201) [-1114.517] (-1117.536) * [-1116.939] (-1116.689) (-1112.370) (-1118.644) -- 0:02:17
      274500 -- (-1111.765) (-1115.438) [-1116.866] (-1111.890) * (-1108.662) [-1111.192] (-1120.564) (-1122.313) -- 0:02:17
      275000 -- [-1113.934] (-1117.667) (-1124.530) (-1121.733) * (-1120.568) [-1112.091] (-1121.633) (-1119.304) -- 0:02:17

      Average standard deviation of split frequencies: 0.002847

      275500 -- (-1119.903) (-1118.909) [-1111.701] (-1124.153) * (-1117.776) [-1112.626] (-1119.917) (-1115.719) -- 0:02:16
      276000 -- (-1114.639) (-1115.125) [-1112.451] (-1123.081) * (-1112.030) [-1111.224] (-1121.393) (-1115.891) -- 0:02:16
      276500 -- (-1115.097) (-1113.418) [-1115.334] (-1125.928) * (-1114.110) (-1118.077) [-1111.803] (-1120.008) -- 0:02:16
      277000 -- (-1110.297) (-1110.954) (-1113.079) [-1116.943] * (-1118.807) [-1120.907] (-1113.408) (-1123.142) -- 0:02:15
      277500 -- (-1110.859) (-1116.709) [-1112.432] (-1121.692) * (-1114.194) (-1124.989) (-1119.711) [-1111.914] -- 0:02:15
      278000 -- [-1109.005] (-1114.380) (-1111.043) (-1118.278) * (-1110.696) (-1117.124) [-1113.500] (-1114.574) -- 0:02:15
      278500 -- (-1113.711) (-1119.130) [-1118.455] (-1121.238) * (-1117.138) (-1117.922) [-1112.271] (-1121.329) -- 0:02:14
      279000 -- (-1117.233) [-1113.478] (-1117.352) (-1114.542) * (-1116.845) (-1131.020) (-1113.608) [-1114.922] -- 0:02:14
      279500 -- (-1119.695) (-1123.778) [-1110.379] (-1125.657) * [-1108.880] (-1120.078) (-1116.919) (-1115.474) -- 0:02:16
      280000 -- (-1106.076) (-1111.402) [-1116.822] (-1118.034) * (-1109.508) [-1116.400] (-1114.935) (-1109.749) -- 0:02:16

      Average standard deviation of split frequencies: 0.002239

      280500 -- (-1111.267) (-1117.597) [-1112.246] (-1124.375) * (-1118.029) (-1117.827) (-1112.863) [-1111.099] -- 0:02:15
      281000 -- [-1111.404] (-1112.280) (-1111.265) (-1126.407) * (-1117.932) [-1118.988] (-1116.159) (-1110.314) -- 0:02:15
      281500 -- (-1115.048) (-1120.562) (-1116.391) [-1123.756] * (-1114.371) (-1118.864) [-1116.620] (-1121.165) -- 0:02:15
      282000 -- (-1114.921) [-1112.884] (-1112.956) (-1117.303) * (-1119.910) (-1115.086) (-1111.822) [-1114.160] -- 0:02:14
      282500 -- (-1117.288) (-1110.393) [-1109.191] (-1116.330) * (-1114.429) (-1119.312) [-1110.308] (-1118.132) -- 0:02:14
      283000 -- (-1117.453) [-1107.185] (-1114.919) (-1118.682) * (-1112.780) (-1125.228) [-1115.953] (-1115.308) -- 0:02:14
      283500 -- (-1115.749) (-1115.465) [-1109.768] (-1110.788) * (-1119.828) (-1116.296) [-1106.957] (-1115.176) -- 0:02:13
      284000 -- (-1125.922) (-1116.108) (-1109.918) [-1118.532] * (-1111.443) (-1120.681) [-1112.598] (-1113.510) -- 0:02:13
      284500 -- (-1111.756) (-1112.709) (-1109.347) [-1110.867] * (-1110.120) [-1111.495] (-1119.703) (-1122.939) -- 0:02:13
      285000 -- (-1112.299) (-1116.743) (-1112.347) [-1117.156] * (-1115.044) (-1121.555) [-1116.855] (-1115.207) -- 0:02:15

      Average standard deviation of split frequencies: 0.004395

      285500 -- (-1112.399) [-1114.106] (-1112.290) (-1113.433) * (-1116.620) (-1118.413) (-1113.673) [-1110.943] -- 0:02:15
      286000 -- (-1116.203) [-1109.784] (-1117.922) (-1113.183) * (-1115.473) [-1113.922] (-1113.772) (-1120.037) -- 0:02:14
      286500 -- (-1112.412) (-1113.943) [-1112.091] (-1112.575) * (-1125.728) (-1113.696) (-1114.868) [-1109.081] -- 0:02:14
      287000 -- (-1117.619) (-1112.245) (-1117.104) [-1116.742] * (-1113.074) (-1117.009) [-1116.068] (-1119.450) -- 0:02:14
      287500 -- (-1114.430) (-1116.597) (-1114.197) [-1112.473] * (-1124.086) (-1115.991) [-1113.608] (-1115.763) -- 0:02:13
      288000 -- [-1108.900] (-1116.296) (-1117.253) (-1112.503) * (-1112.670) (-1117.797) (-1113.886) [-1116.991] -- 0:02:13
      288500 -- (-1112.432) [-1112.505] (-1107.076) (-1122.108) * [-1115.128] (-1111.823) (-1117.122) (-1118.967) -- 0:02:13
      289000 -- (-1113.263) [-1112.175] (-1111.560) (-1112.822) * (-1110.801) (-1115.503) (-1119.908) [-1118.420] -- 0:02:12
      289500 -- (-1119.009) (-1114.596) (-1114.216) [-1115.171] * [-1110.482] (-1116.705) (-1115.228) (-1119.868) -- 0:02:12
      290000 -- (-1118.411) [-1114.605] (-1116.600) (-1116.957) * [-1116.295] (-1115.902) (-1114.011) (-1112.906) -- 0:02:14

      Average standard deviation of split frequencies: 0.002162

      290500 -- (-1124.094) [-1115.378] (-1111.430) (-1112.542) * (-1115.789) (-1112.180) (-1109.180) [-1119.491] -- 0:02:14
      291000 -- (-1115.281) (-1121.072) (-1114.741) [-1114.536] * (-1111.742) (-1118.751) (-1123.591) [-1116.967] -- 0:02:14
      291500 -- (-1115.156) (-1112.992) [-1113.172] (-1116.143) * [-1113.893] (-1112.215) (-1117.101) (-1119.476) -- 0:02:13
      292000 -- (-1113.709) [-1113.265] (-1119.289) (-1111.772) * (-1110.735) (-1116.188) (-1115.973) [-1119.079] -- 0:02:13
      292500 -- [-1115.639] (-1111.512) (-1116.812) (-1114.426) * (-1113.918) [-1114.530] (-1109.489) (-1115.829) -- 0:02:13
      293000 -- (-1115.930) (-1111.056) [-1110.360] (-1117.138) * [-1116.009] (-1120.966) (-1114.068) (-1119.573) -- 0:02:12
      293500 -- (-1110.655) (-1118.093) [-1110.252] (-1120.467) * (-1119.310) (-1127.362) (-1109.750) [-1117.133] -- 0:02:12
      294000 -- [-1112.395] (-1115.436) (-1113.354) (-1121.178) * (-1115.901) (-1125.939) [-1109.314] (-1117.872) -- 0:02:12
      294500 -- (-1115.000) (-1117.027) [-1111.601] (-1115.711) * [-1112.769] (-1121.622) (-1114.251) (-1124.035) -- 0:02:11
      295000 -- (-1115.603) (-1110.085) [-1111.004] (-1107.764) * (-1124.530) [-1119.383] (-1113.011) (-1116.818) -- 0:02:11

      Average standard deviation of split frequencies: 0.004247

      295500 -- (-1111.706) [-1114.611] (-1119.824) (-1109.766) * (-1118.392) [-1111.411] (-1113.433) (-1118.328) -- 0:02:13
      296000 -- (-1115.752) (-1117.443) (-1114.927) [-1111.678] * [-1115.147] (-1114.367) (-1124.356) (-1116.901) -- 0:02:13
      296500 -- (-1116.567) (-1119.953) (-1112.848) [-1110.409] * (-1125.672) (-1109.240) (-1116.850) [-1113.826] -- 0:02:12
      297000 -- (-1128.238) (-1119.839) [-1110.810] (-1121.016) * (-1116.931) (-1111.723) [-1111.143] (-1115.633) -- 0:02:12
      297500 -- [-1113.417] (-1117.024) (-1116.742) (-1119.913) * (-1113.815) [-1116.671] (-1122.054) (-1115.207) -- 0:02:12
      298000 -- (-1117.519) (-1117.030) (-1108.801) [-1113.177] * (-1118.412) (-1111.308) [-1114.040] (-1110.160) -- 0:02:11
      298500 -- [-1113.993] (-1117.698) (-1120.916) (-1119.497) * (-1116.209) [-1111.153] (-1110.742) (-1119.172) -- 0:02:11
      299000 -- [-1112.370] (-1117.813) (-1109.723) (-1122.613) * (-1114.643) [-1120.878] (-1114.585) (-1111.926) -- 0:02:11
      299500 -- (-1112.573) (-1119.000) [-1111.579] (-1115.681) * [-1117.199] (-1115.676) (-1119.050) (-1108.741) -- 0:02:10
      300000 -- (-1121.407) [-1116.092] (-1114.728) (-1116.623) * (-1114.381) (-1127.942) [-1111.723] (-1114.010) -- 0:02:10

      Average standard deviation of split frequencies: 0.004704

      300500 -- (-1116.121) [-1111.687] (-1113.818) (-1115.509) * (-1111.322) [-1113.520] (-1108.894) (-1115.092) -- 0:02:12
      301000 -- [-1113.798] (-1113.545) (-1114.186) (-1115.014) * [-1111.557] (-1112.458) (-1115.740) (-1113.292) -- 0:02:12
      301500 -- (-1113.871) [-1112.741] (-1108.593) (-1111.082) * [-1111.885] (-1126.181) (-1116.878) (-1110.914) -- 0:02:12
      302000 -- (-1114.360) (-1110.905) (-1111.373) [-1113.785] * (-1118.379) (-1115.268) (-1113.131) [-1117.219] -- 0:02:11
      302500 -- (-1108.026) (-1114.618) (-1117.799) [-1112.730] * (-1114.839) (-1118.742) [-1114.664] (-1126.288) -- 0:02:11
      303000 -- (-1112.828) (-1121.072) [-1115.706] (-1121.105) * [-1110.202] (-1114.570) (-1117.235) (-1124.871) -- 0:02:11
      303500 -- (-1120.756) (-1111.595) (-1118.651) [-1113.545] * (-1112.569) (-1120.130) (-1117.320) [-1114.181] -- 0:02:10
      304000 -- (-1112.945) [-1110.655] (-1122.602) (-1117.077) * [-1115.892] (-1119.944) (-1115.718) (-1113.239) -- 0:02:10
      304500 -- [-1111.429] (-1110.203) (-1116.863) (-1116.878) * (-1110.732) (-1113.157) (-1122.017) [-1112.574] -- 0:02:10
      305000 -- (-1114.482) (-1117.100) (-1115.384) [-1116.087] * (-1114.853) (-1114.539) [-1113.160] (-1124.772) -- 0:02:09

      Average standard deviation of split frequencies: 0.005135

      305500 -- (-1113.698) (-1120.682) (-1116.067) [-1114.621] * [-1114.445] (-1114.367) (-1114.121) (-1121.392) -- 0:02:09
      306000 -- (-1115.766) (-1119.283) [-1110.055] (-1114.790) * (-1116.482) (-1115.481) (-1107.863) [-1110.671] -- 0:02:11
      306500 -- (-1116.186) (-1121.595) [-1115.042] (-1115.855) * (-1130.181) (-1117.954) [-1115.882] (-1117.572) -- 0:02:11
      307000 -- (-1113.742) (-1116.223) (-1117.569) [-1117.800] * (-1121.236) [-1111.795] (-1116.396) (-1125.495) -- 0:02:10
      307500 -- [-1112.017] (-1116.775) (-1119.250) (-1112.690) * (-1114.650) (-1113.805) [-1115.643] (-1117.917) -- 0:02:10
      308000 -- (-1112.861) (-1120.503) [-1113.893] (-1116.767) * [-1110.815] (-1113.244) (-1110.582) (-1111.377) -- 0:02:10
      308500 -- (-1120.983) (-1111.736) (-1116.771) [-1116.924] * (-1113.307) (-1113.547) (-1118.300) [-1111.431] -- 0:02:10
      309000 -- (-1120.864) (-1117.980) [-1120.659] (-1112.510) * (-1117.330) (-1114.615) [-1116.561] (-1116.293) -- 0:02:09
      309500 -- [-1114.793] (-1114.491) (-1121.420) (-1111.905) * [-1118.289] (-1117.560) (-1115.160) (-1113.023) -- 0:02:09
      310000 -- [-1118.226] (-1113.776) (-1119.685) (-1125.781) * (-1109.243) (-1109.182) (-1112.940) [-1119.720] -- 0:02:09

      Average standard deviation of split frequencies: 0.005058

      310500 -- [-1114.267] (-1116.212) (-1117.158) (-1113.959) * (-1111.281) (-1113.087) [-1119.083] (-1117.109) -- 0:02:08
      311000 -- (-1115.378) (-1114.554) [-1113.384] (-1117.716) * (-1115.906) (-1119.261) (-1116.199) [-1109.103] -- 0:02:08
      311500 -- (-1114.597) (-1121.577) [-1111.834] (-1111.354) * (-1109.770) (-1117.230) [-1113.049] (-1119.776) -- 0:02:10
      312000 -- (-1114.796) (-1111.529) [-1116.128] (-1112.380) * (-1117.787) [-1113.153] (-1120.538) (-1121.596) -- 0:02:10
      312500 -- (-1123.446) (-1112.648) [-1112.300] (-1114.146) * (-1112.322) [-1120.512] (-1114.155) (-1114.945) -- 0:02:09
      313000 -- (-1122.161) [-1120.396] (-1117.031) (-1116.437) * (-1115.479) (-1115.087) (-1117.462) [-1113.067] -- 0:02:09
      313500 -- (-1118.899) (-1118.194) (-1119.191) [-1111.489] * (-1114.708) [-1108.963] (-1119.290) (-1115.875) -- 0:02:09
      314000 -- [-1114.699] (-1119.419) (-1117.910) (-1117.541) * (-1117.550) (-1109.679) [-1114.210] (-1113.836) -- 0:02:08
      314500 -- (-1116.302) (-1110.244) [-1107.241] (-1110.996) * [-1114.229] (-1111.147) (-1110.550) (-1120.922) -- 0:02:08
      315000 -- (-1112.069) (-1121.042) (-1117.685) [-1111.106] * (-1113.445) (-1112.247) (-1113.915) [-1114.812] -- 0:02:08

      Average standard deviation of split frequencies: 0.003481

      315500 -- (-1116.037) [-1119.421] (-1109.492) (-1119.025) * (-1114.528) [-1107.004] (-1116.040) (-1114.315) -- 0:02:08
      316000 -- (-1117.348) (-1110.820) [-1111.344] (-1118.331) * (-1111.853) (-1110.025) (-1121.321) [-1116.324] -- 0:02:07
      316500 -- (-1113.191) [-1115.562] (-1112.720) (-1118.784) * [-1113.174] (-1116.194) (-1110.019) (-1112.540) -- 0:02:09
      317000 -- (-1114.781) [-1113.436] (-1116.297) (-1109.618) * (-1119.189) (-1115.125) (-1116.549) [-1114.283] -- 0:02:09
      317500 -- [-1116.639] (-1112.187) (-1120.774) (-1111.993) * (-1121.522) (-1118.610) [-1114.095] (-1115.509) -- 0:02:08
      318000 -- (-1118.579) [-1110.481] (-1118.175) (-1115.596) * (-1120.555) (-1122.393) [-1113.920] (-1114.688) -- 0:02:08
      318500 -- (-1121.567) (-1118.240) [-1111.231] (-1114.375) * (-1113.707) (-1117.926) [-1113.825] (-1115.306) -- 0:02:08
      319000 -- [-1113.309] (-1111.583) (-1115.696) (-1115.420) * (-1115.125) (-1111.271) (-1110.169) [-1112.840] -- 0:02:08
      319500 -- (-1124.240) (-1116.347) (-1116.989) [-1109.356] * (-1115.833) [-1113.502] (-1116.513) (-1121.362) -- 0:02:07
      320000 -- (-1116.500) (-1119.750) (-1115.925) [-1111.984] * (-1112.624) (-1117.890) (-1114.323) [-1115.839] -- 0:02:07

      Average standard deviation of split frequencies: 0.003430

      320500 -- (-1117.489) [-1116.735] (-1118.592) (-1114.762) * (-1112.049) [-1115.009] (-1122.935) (-1114.542) -- 0:02:07
      321000 -- (-1114.066) [-1114.676] (-1118.818) (-1116.218) * (-1113.871) [-1117.435] (-1114.898) (-1116.843) -- 0:02:06
      321500 -- (-1115.686) [-1111.989] (-1117.091) (-1120.497) * (-1110.116) (-1117.645) [-1109.128] (-1115.003) -- 0:02:06
      322000 -- (-1116.220) (-1113.310) [-1111.957] (-1118.529) * [-1113.152] (-1110.067) (-1113.644) (-1113.254) -- 0:02:08
      322500 -- (-1110.736) (-1110.688) (-1116.189) [-1115.691] * (-1115.570) (-1118.177) [-1110.065] (-1121.606) -- 0:02:08
      323000 -- (-1116.420) (-1117.891) (-1116.923) [-1110.012] * (-1115.694) (-1117.729) [-1114.663] (-1113.387) -- 0:02:07
      323500 -- (-1113.850) (-1113.987) [-1115.730] (-1113.382) * (-1113.917) (-1118.396) [-1112.728] (-1116.373) -- 0:02:07
      324000 -- [-1112.220] (-1116.158) (-1123.478) (-1117.563) * (-1113.404) (-1118.051) [-1109.642] (-1114.025) -- 0:02:07
      324500 -- (-1109.390) [-1116.489] (-1115.464) (-1118.097) * [-1115.547] (-1110.708) (-1123.254) (-1112.285) -- 0:02:06
      325000 -- [-1113.324] (-1116.777) (-1121.790) (-1112.154) * [-1114.155] (-1113.205) (-1120.628) (-1114.537) -- 0:02:06

      Average standard deviation of split frequencies: 0.003374

      325500 -- (-1114.757) (-1112.843) (-1117.755) [-1121.880] * [-1113.785] (-1110.754) (-1114.557) (-1113.823) -- 0:02:06
      326000 -- (-1119.532) (-1116.072) (-1116.235) [-1119.274] * [-1107.482] (-1113.623) (-1118.125) (-1121.839) -- 0:02:06
      326500 -- (-1120.209) [-1117.067] (-1122.399) (-1123.834) * (-1118.464) [-1111.037] (-1121.830) (-1112.639) -- 0:02:05
      327000 -- [-1111.703] (-1126.122) (-1121.243) (-1116.576) * (-1113.770) (-1110.087) (-1119.103) [-1109.931] -- 0:02:05
      327500 -- (-1114.584) (-1117.297) [-1112.834] (-1114.699) * (-1115.437) (-1117.985) (-1115.625) [-1119.352] -- 0:02:07
      328000 -- [-1110.788] (-1117.424) (-1121.405) (-1115.925) * (-1115.468) (-1114.817) (-1115.742) [-1117.295] -- 0:02:07
      328500 -- (-1114.738) [-1120.695] (-1115.048) (-1118.206) * (-1110.380) (-1119.405) [-1111.071] (-1115.568) -- 0:02:06
      329000 -- [-1111.326] (-1116.588) (-1114.442) (-1115.017) * [-1109.702] (-1118.994) (-1112.344) (-1118.418) -- 0:02:06
      329500 -- (-1113.388) (-1115.462) (-1113.161) [-1118.862] * (-1115.193) (-1118.442) (-1115.417) [-1110.850] -- 0:02:06
      330000 -- (-1116.051) (-1109.842) [-1113.687] (-1122.977) * (-1119.106) [-1111.024] (-1115.743) (-1113.054) -- 0:02:05

      Average standard deviation of split frequencies: 0.004277

      330500 -- (-1121.024) (-1113.459) (-1120.764) [-1117.220] * (-1114.201) (-1113.972) [-1112.358] (-1110.218) -- 0:02:05
      331000 -- (-1120.624) [-1110.779] (-1119.398) (-1110.757) * (-1116.441) (-1115.054) (-1116.951) [-1113.791] -- 0:02:05
      331500 -- (-1119.577) (-1114.163) (-1117.391) [-1113.985] * (-1112.811) (-1112.981) [-1114.761] (-1119.917) -- 0:02:05
      332000 -- [-1123.254] (-1111.928) (-1111.611) (-1114.823) * (-1120.563) [-1117.327] (-1110.361) (-1115.366) -- 0:02:04
      332500 -- (-1120.479) (-1115.917) (-1117.009) [-1110.417] * (-1114.961) (-1120.462) (-1115.301) [-1112.076] -- 0:02:06
      333000 -- (-1122.414) (-1111.739) (-1113.542) [-1116.081] * (-1113.665) (-1113.793) (-1111.548) [-1116.225] -- 0:02:06
      333500 -- (-1119.129) [-1117.610] (-1109.303) (-1119.434) * (-1116.677) [-1117.823] (-1116.601) (-1120.665) -- 0:02:05
      334000 -- [-1114.250] (-1110.614) (-1115.738) (-1114.303) * [-1110.711] (-1118.476) (-1115.027) (-1116.857) -- 0:02:05
      334500 -- (-1116.525) [-1111.729] (-1111.704) (-1123.492) * (-1121.645) [-1115.422] (-1113.755) (-1116.389) -- 0:02:05
      335000 -- [-1110.357] (-1112.009) (-1114.887) (-1117.277) * [-1110.583] (-1112.041) (-1114.503) (-1118.276) -- 0:02:05

      Average standard deviation of split frequencies: 0.004209

      335500 -- (-1114.651) [-1109.478] (-1114.928) (-1112.503) * (-1113.222) (-1118.633) [-1114.521] (-1111.710) -- 0:02:04
      336000 -- [-1108.582] (-1117.882) (-1109.578) (-1113.371) * (-1116.010) (-1119.508) [-1111.474] (-1116.776) -- 0:02:04
      336500 -- (-1119.826) (-1121.742) (-1111.660) [-1116.234] * (-1117.236) [-1110.485] (-1125.098) (-1113.225) -- 0:02:04
      337000 -- (-1118.455) (-1119.471) (-1109.615) [-1114.203] * [-1115.261] (-1119.851) (-1118.602) (-1116.193) -- 0:02:03
      337500 -- [-1120.958] (-1113.461) (-1112.992) (-1120.579) * (-1113.191) (-1112.657) (-1120.676) [-1115.505] -- 0:02:03
      338000 -- (-1117.678) (-1116.792) (-1115.327) [-1117.022] * (-1113.135) [-1118.968] (-1114.556) (-1110.576) -- 0:02:05
      338500 -- (-1119.473) (-1118.072) [-1111.313] (-1128.274) * [-1112.396] (-1117.434) (-1114.911) (-1117.535) -- 0:02:05
      339000 -- (-1116.836) [-1112.823] (-1114.115) (-1122.559) * [-1117.070] (-1114.714) (-1121.489) (-1121.722) -- 0:02:04
      339500 -- [-1113.353] (-1115.555) (-1116.501) (-1118.486) * [-1117.027] (-1115.725) (-1119.202) (-1115.885) -- 0:02:04
      340000 -- (-1118.223) [-1112.168] (-1117.110) (-1119.157) * (-1117.560) (-1119.431) (-1120.428) [-1112.015] -- 0:02:04

      Average standard deviation of split frequencies: 0.004151

      340500 -- [-1112.466] (-1113.738) (-1115.966) (-1121.408) * (-1107.981) (-1110.652) (-1116.486) [-1114.596] -- 0:02:03
      341000 -- (-1116.223) (-1111.685) [-1118.873] (-1115.109) * [-1109.797] (-1114.886) (-1117.624) (-1110.291) -- 0:02:03
      341500 -- [-1116.607] (-1116.333) (-1112.862) (-1117.520) * (-1112.663) [-1118.432] (-1114.359) (-1113.753) -- 0:02:03
      342000 -- (-1113.391) [-1116.643] (-1122.924) (-1121.623) * (-1113.116) [-1119.528] (-1119.388) (-1122.801) -- 0:02:03
      342500 -- (-1127.696) (-1112.277) [-1112.460] (-1126.038) * (-1115.609) (-1110.463) (-1119.703) [-1117.377] -- 0:02:02
      343000 -- (-1115.469) (-1113.088) (-1112.752) [-1116.230] * (-1108.264) (-1114.837) (-1122.923) [-1113.785] -- 0:02:04
      343500 -- (-1118.968) [-1118.034] (-1110.093) (-1123.865) * [-1111.206] (-1112.061) (-1119.280) (-1121.002) -- 0:02:04
      344000 -- (-1110.496) (-1111.972) (-1111.201) [-1119.297] * (-1117.730) [-1118.792] (-1112.451) (-1110.520) -- 0:02:03
      344500 -- (-1115.573) [-1110.907] (-1112.060) (-1124.881) * (-1122.675) (-1117.619) [-1113.235] (-1122.948) -- 0:02:03
      345000 -- (-1114.194) [-1109.180] (-1113.408) (-1114.438) * (-1110.988) (-1117.467) [-1113.337] (-1111.888) -- 0:02:03

      Average standard deviation of split frequencies: 0.002271

      345500 -- (-1113.779) [-1115.025] (-1118.071) (-1124.839) * (-1117.179) (-1118.228) [-1116.154] (-1119.029) -- 0:02:03
      346000 -- (-1116.647) [-1114.503] (-1114.441) (-1118.282) * [-1116.376] (-1121.718) (-1115.162) (-1111.269) -- 0:02:02
      346500 -- (-1122.206) (-1111.425) (-1116.110) [-1114.021] * [-1114.786] (-1117.305) (-1111.746) (-1115.089) -- 0:02:02
      347000 -- (-1120.387) (-1109.614) (-1120.686) [-1117.625] * (-1117.842) (-1115.587) [-1106.839] (-1114.225) -- 0:02:02
      347500 -- [-1113.696] (-1112.577) (-1118.358) (-1116.647) * (-1111.264) (-1115.685) (-1110.938) [-1111.610] -- 0:02:02
      348000 -- (-1110.366) (-1118.705) (-1126.505) [-1120.248] * [-1109.383] (-1110.785) (-1113.183) (-1114.245) -- 0:02:01
      348500 -- (-1112.285) (-1122.817) (-1113.672) [-1115.127] * (-1110.607) [-1115.832] (-1116.925) (-1113.856) -- 0:02:03
      349000 -- (-1111.568) (-1116.280) [-1115.453] (-1110.884) * (-1110.289) (-1111.840) [-1112.480] (-1113.249) -- 0:02:03
      349500 -- (-1109.962) [-1110.543] (-1119.411) (-1118.572) * (-1117.880) (-1111.740) [-1116.059] (-1109.762) -- 0:02:02
      350000 -- [-1113.724] (-1119.847) (-1114.394) (-1122.615) * (-1112.823) [-1109.162] (-1114.731) (-1121.529) -- 0:02:02

      Average standard deviation of split frequencies: 0.002241

      350500 -- (-1120.222) [-1115.096] (-1114.751) (-1119.410) * (-1111.985) (-1115.734) [-1117.480] (-1116.508) -- 0:02:02
      351000 -- (-1115.864) [-1112.948] (-1117.100) (-1116.370) * (-1117.267) (-1115.080) [-1113.537] (-1116.235) -- 0:02:02
      351500 -- (-1114.390) [-1108.954] (-1115.128) (-1115.588) * [-1115.828] (-1123.104) (-1115.027) (-1117.382) -- 0:02:01
      352000 -- (-1121.365) (-1117.575) (-1116.760) [-1110.231] * (-1112.956) (-1118.602) (-1117.451) [-1123.730] -- 0:02:01
      352500 -- (-1115.847) (-1115.365) [-1117.661] (-1109.301) * (-1114.233) (-1115.332) [-1119.449] (-1113.639) -- 0:02:01
      353000 -- (-1125.917) (-1126.114) [-1112.835] (-1111.919) * (-1115.580) [-1107.977] (-1112.643) (-1111.076) -- 0:02:00
      353500 -- (-1117.557) (-1110.127) [-1112.829] (-1109.670) * (-1120.280) [-1114.123] (-1109.754) (-1118.584) -- 0:02:00
      354000 -- (-1115.737) (-1111.584) [-1110.654] (-1113.854) * (-1117.166) [-1115.327] (-1112.158) (-1112.454) -- 0:02:02
      354500 -- [-1116.568] (-1115.416) (-1118.776) (-1121.984) * (-1112.683) (-1120.601) (-1110.411) [-1112.763] -- 0:02:01
      355000 -- [-1118.820] (-1118.583) (-1117.478) (-1115.231) * (-1116.558) [-1113.261] (-1121.472) (-1120.391) -- 0:02:01

      Average standard deviation of split frequencies: 0.003090

      355500 -- (-1119.884) (-1117.999) [-1116.790] (-1115.509) * [-1113.573] (-1115.699) (-1117.634) (-1118.844) -- 0:02:01
      356000 -- (-1117.122) (-1117.055) [-1121.439] (-1114.966) * [-1115.534] (-1112.818) (-1115.889) (-1120.946) -- 0:02:01
      356500 -- (-1114.182) (-1111.097) [-1114.795] (-1122.195) * (-1118.023) (-1114.289) [-1113.834] (-1119.057) -- 0:02:00
      357000 -- [-1114.084] (-1110.264) (-1111.266) (-1113.284) * [-1115.613] (-1119.356) (-1117.105) (-1113.239) -- 0:02:00
      357500 -- (-1112.443) (-1114.073) (-1116.002) [-1110.093] * [-1117.029] (-1119.279) (-1110.859) (-1111.607) -- 0:02:00
      358000 -- (-1117.340) (-1116.529) (-1116.337) [-1112.035] * (-1114.309) (-1115.325) [-1111.923] (-1114.347) -- 0:02:00
      358500 -- [-1112.909] (-1114.654) (-1118.445) (-1110.738) * (-1112.467) [-1113.205] (-1115.667) (-1120.770) -- 0:01:59
      359000 -- (-1119.712) (-1117.356) [-1122.351] (-1118.114) * (-1120.822) [-1112.774] (-1116.474) (-1118.169) -- 0:02:01
      359500 -- (-1116.388) (-1112.416) [-1109.069] (-1110.516) * [-1117.087] (-1119.359) (-1115.919) (-1114.481) -- 0:02:01
      360000 -- [-1111.016] (-1114.872) (-1112.757) (-1112.237) * (-1110.336) [-1111.286] (-1118.126) (-1111.583) -- 0:02:00

      Average standard deviation of split frequencies: 0.001743

      360500 -- [-1114.629] (-1120.701) (-1116.848) (-1109.925) * [-1115.898] (-1114.537) (-1116.379) (-1121.663) -- 0:02:00
      361000 -- (-1122.173) (-1108.571) [-1114.367] (-1113.777) * (-1117.641) (-1118.784) (-1124.778) [-1112.291] -- 0:02:00
      361500 -- [-1116.397] (-1108.716) (-1112.113) (-1109.944) * [-1109.328] (-1120.670) (-1115.037) (-1114.782) -- 0:02:00
      362000 -- (-1109.436) (-1120.886) (-1120.850) [-1114.125] * [-1112.175] (-1115.796) (-1118.479) (-1119.300) -- 0:01:59
      362500 -- (-1110.942) [-1112.276] (-1119.925) (-1115.581) * (-1114.571) (-1112.267) [-1118.382] (-1118.570) -- 0:01:59
      363000 -- (-1113.435) (-1114.569) [-1110.719] (-1112.197) * [-1114.402] (-1114.036) (-1116.403) (-1124.368) -- 0:01:59
      363500 -- (-1110.832) (-1118.791) [-1117.903] (-1112.675) * (-1112.484) [-1108.920] (-1116.918) (-1119.409) -- 0:01:59
      364000 -- (-1112.904) (-1122.526) [-1112.990] (-1117.082) * (-1112.517) (-1109.921) (-1116.172) [-1111.420] -- 0:01:58
      364500 -- [-1112.024] (-1121.577) (-1117.408) (-1124.590) * (-1116.401) [-1116.445] (-1116.514) (-1111.038) -- 0:02:00
      365000 -- (-1120.240) (-1121.030) [-1111.465] (-1110.995) * (-1116.315) [-1115.564] (-1117.256) (-1112.490) -- 0:02:00

      Average standard deviation of split frequencies: 0.002576

      365500 -- [-1113.927] (-1122.925) (-1110.678) (-1109.455) * (-1110.779) (-1113.593) [-1113.182] (-1111.412) -- 0:01:59
      366000 -- (-1110.491) (-1118.082) [-1111.412] (-1117.839) * (-1109.371) (-1117.244) [-1111.933] (-1109.037) -- 0:01:59
      366500 -- [-1111.364] (-1117.619) (-1114.136) (-1109.940) * (-1117.090) (-1114.528) (-1114.736) [-1114.673] -- 0:01:59
      367000 -- (-1111.966) (-1122.392) (-1112.526) [-1110.147] * [-1109.096] (-1116.068) (-1114.597) (-1114.973) -- 0:01:59
      367500 -- (-1119.289) (-1134.301) [-1115.507] (-1125.415) * (-1119.323) (-1121.443) [-1111.971] (-1115.847) -- 0:01:58
      368000 -- [-1114.398] (-1127.991) (-1111.593) (-1117.405) * (-1118.392) [-1117.816] (-1112.910) (-1114.041) -- 0:01:58
      368500 -- (-1114.660) (-1117.920) [-1114.118] (-1117.959) * (-1118.942) [-1117.468] (-1113.028) (-1118.971) -- 0:01:58
      369000 -- [-1113.481] (-1114.085) (-1113.981) (-1113.933) * [-1114.472] (-1122.811) (-1119.753) (-1123.156) -- 0:01:57
      369500 -- (-1114.123) (-1121.744) (-1121.373) [-1112.175] * (-1113.570) (-1133.098) [-1112.450] (-1116.075) -- 0:01:59
      370000 -- (-1113.315) (-1111.839) [-1114.224] (-1120.970) * (-1113.201) [-1123.349] (-1113.374) (-1109.684) -- 0:01:59

      Average standard deviation of split frequencies: 0.002120

      370500 -- (-1118.792) [-1117.489] (-1122.698) (-1122.821) * (-1114.053) (-1124.932) [-1110.611] (-1109.980) -- 0:01:58
      371000 -- (-1114.261) [-1119.276] (-1121.900) (-1117.149) * (-1118.391) (-1117.754) (-1115.896) [-1116.338] -- 0:01:58
      371500 -- [-1113.049] (-1119.890) (-1115.493) (-1113.033) * (-1123.355) (-1118.799) (-1119.197) [-1109.798] -- 0:01:58
      372000 -- [-1114.911] (-1111.750) (-1113.767) (-1116.223) * (-1123.330) (-1122.383) (-1116.410) [-1112.315] -- 0:01:58
      372500 -- (-1115.545) (-1115.247) [-1110.939] (-1126.164) * (-1119.765) (-1128.861) [-1111.892] (-1115.545) -- 0:01:57
      373000 -- (-1117.490) (-1117.350) (-1117.645) [-1111.284] * (-1113.436) (-1119.253) (-1113.044) [-1111.645] -- 0:01:57
      373500 -- (-1114.148) [-1119.677] (-1120.131) (-1118.325) * (-1117.576) (-1109.744) [-1115.265] (-1119.510) -- 0:01:57
      374000 -- (-1112.635) [-1112.763] (-1113.081) (-1115.509) * (-1114.660) [-1116.584] (-1125.159) (-1118.103) -- 0:01:57
      374500 -- (-1119.491) (-1116.894) (-1113.098) [-1118.501] * (-1112.078) [-1113.664] (-1121.829) (-1114.735) -- 0:01:56
      375000 -- [-1117.433] (-1120.347) (-1117.786) (-1113.140) * (-1113.042) (-1121.583) [-1117.858] (-1111.254) -- 0:01:58

      Average standard deviation of split frequencies: 0.004179

      375500 -- (-1112.768) (-1120.632) (-1119.921) [-1116.435] * (-1118.380) [-1113.973] (-1116.865) (-1112.284) -- 0:01:58
      376000 -- [-1107.359] (-1117.614) (-1111.840) (-1119.764) * (-1117.372) [-1115.668] (-1113.569) (-1110.014) -- 0:01:57
      376500 -- (-1118.432) [-1114.340] (-1112.263) (-1116.349) * [-1115.945] (-1116.160) (-1113.304) (-1114.791) -- 0:01:57
      377000 -- (-1117.654) (-1109.729) (-1114.981) [-1116.029] * (-1123.593) (-1119.982) (-1119.646) [-1110.289] -- 0:01:57
      377500 -- (-1115.544) [-1118.833] (-1117.638) (-1118.544) * [-1113.881] (-1108.726) (-1120.316) (-1112.771) -- 0:01:57
      378000 -- [-1116.244] (-1112.041) (-1115.414) (-1118.318) * (-1113.249) [-1113.923] (-1126.044) (-1124.004) -- 0:01:56
      378500 -- [-1116.532] (-1117.592) (-1114.303) (-1112.985) * (-1115.258) (-1115.535) (-1121.033) [-1111.505] -- 0:01:56
      379000 -- (-1115.666) [-1111.407] (-1116.922) (-1113.499) * (-1114.246) (-1116.825) (-1113.105) [-1108.292] -- 0:01:56
      379500 -- (-1119.593) [-1111.463] (-1115.210) (-1118.037) * (-1116.126) [-1116.293] (-1115.086) (-1114.107) -- 0:01:56
      380000 -- (-1114.921) (-1116.622) [-1113.529] (-1114.801) * [-1112.626] (-1111.821) (-1116.314) (-1113.007) -- 0:01:55

      Average standard deviation of split frequencies: 0.002477

      380500 -- (-1112.605) (-1111.383) (-1113.800) [-1122.565] * (-1114.060) (-1120.863) (-1121.943) [-1110.830] -- 0:01:57
      381000 -- [-1109.981] (-1111.995) (-1116.847) (-1128.803) * (-1115.326) [-1110.607] (-1119.086) (-1118.241) -- 0:01:56
      381500 -- (-1107.496) [-1117.864] (-1123.493) (-1116.755) * [-1109.943] (-1120.672) (-1116.492) (-1115.790) -- 0:01:56
      382000 -- (-1112.269) [-1111.596] (-1118.556) (-1122.022) * [-1110.580] (-1120.524) (-1123.660) (-1114.711) -- 0:01:56
      382500 -- (-1113.980) (-1111.619) (-1125.657) [-1118.756] * (-1109.721) [-1113.931] (-1116.842) (-1122.553) -- 0:01:56
      383000 -- (-1113.475) (-1120.792) [-1116.509] (-1109.397) * (-1113.578) (-1118.660) (-1121.615) [-1116.901] -- 0:01:55
      383500 -- (-1113.455) [-1111.765] (-1112.838) (-1118.146) * (-1117.399) [-1114.221] (-1114.361) (-1114.292) -- 0:01:55
      384000 -- (-1117.134) (-1110.025) [-1109.887] (-1119.236) * [-1114.549] (-1122.545) (-1122.891) (-1115.666) -- 0:01:55
      384500 -- [-1117.544] (-1112.078) (-1117.700) (-1115.102) * [-1109.664] (-1116.905) (-1115.684) (-1113.164) -- 0:01:55
      385000 -- (-1117.074) [-1109.542] (-1111.992) (-1119.382) * [-1112.135] (-1120.509) (-1119.303) (-1109.345) -- 0:01:55

      Average standard deviation of split frequencies: 0.002443

      385500 -- (-1110.105) [-1115.056] (-1112.807) (-1118.965) * (-1117.303) (-1116.558) (-1114.221) [-1118.333] -- 0:01:56
      386000 -- (-1115.549) [-1113.391] (-1119.920) (-1109.712) * [-1114.663] (-1115.355) (-1108.463) (-1114.971) -- 0:01:56
      386500 -- (-1111.082) (-1114.709) (-1117.913) [-1115.538] * [-1115.298] (-1116.165) (-1115.155) (-1115.693) -- 0:01:55
      387000 -- (-1116.901) (-1111.659) [-1114.951] (-1114.710) * (-1114.776) (-1119.446) [-1111.053] (-1116.065) -- 0:01:55
      387500 -- (-1113.899) (-1115.237) (-1109.470) [-1119.459] * (-1115.997) (-1117.494) [-1120.671] (-1120.344) -- 0:01:55
      388000 -- (-1117.154) (-1113.969) [-1115.807] (-1115.206) * (-1109.194) [-1116.653] (-1110.833) (-1128.713) -- 0:01:55
      388500 -- (-1116.112) [-1112.702] (-1113.208) (-1116.855) * (-1114.185) (-1117.451) (-1107.334) [-1111.866] -- 0:01:54
      389000 -- (-1116.940) (-1114.313) [-1112.985] (-1113.067) * [-1117.076] (-1116.027) (-1119.090) (-1121.476) -- 0:01:54
      389500 -- (-1117.266) (-1115.673) [-1111.839] (-1113.305) * [-1111.433] (-1120.182) (-1116.885) (-1112.833) -- 0:01:54
      390000 -- [-1110.404] (-1111.503) (-1109.752) (-1116.174) * (-1111.936) [-1112.709] (-1115.011) (-1109.803) -- 0:01:54

      Average standard deviation of split frequencies: 0.002816

      390500 -- (-1113.110) [-1111.334] (-1114.053) (-1112.927) * [-1110.020] (-1122.872) (-1129.792) (-1115.757) -- 0:01:55
      391000 -- [-1111.111] (-1113.596) (-1114.087) (-1116.187) * (-1117.596) (-1113.879) [-1110.221] (-1116.627) -- 0:01:55
      391500 -- (-1112.992) (-1109.307) (-1114.281) [-1109.434] * (-1113.920) (-1111.587) [-1117.956] (-1118.210) -- 0:01:55
      392000 -- (-1112.845) (-1115.273) (-1119.967) [-1112.288] * [-1103.547] (-1113.489) (-1116.599) (-1118.860) -- 0:01:54
      392500 -- (-1112.981) [-1114.608] (-1108.584) (-1114.307) * (-1117.837) [-1113.198] (-1116.708) (-1111.965) -- 0:01:54
      393000 -- (-1107.867) (-1112.368) (-1113.900) [-1110.122] * (-1107.551) (-1110.297) [-1113.354] (-1121.046) -- 0:01:54
      393500 -- (-1118.067) [-1108.798] (-1110.693) (-1110.747) * (-1112.111) [-1110.535] (-1113.662) (-1120.453) -- 0:01:54
      394000 -- (-1115.653) (-1110.705) [-1110.709] (-1110.561) * (-1118.830) (-1112.535) (-1118.864) [-1113.862] -- 0:01:53
      394500 -- (-1114.703) [-1113.559] (-1117.854) (-1121.754) * (-1112.176) (-1125.347) (-1111.502) [-1115.025] -- 0:01:53
      395000 -- [-1113.022] (-1114.877) (-1121.965) (-1122.986) * [-1112.683] (-1119.743) (-1115.692) (-1130.518) -- 0:01:53

      Average standard deviation of split frequencies: 0.003174

      395500 -- (-1109.646) (-1126.786) (-1122.851) [-1115.871] * (-1114.609) (-1112.142) (-1110.921) [-1111.343] -- 0:01:53
      396000 -- [-1113.522] (-1119.994) (-1120.008) (-1114.608) * (-1113.451) (-1109.853) [-1109.137] (-1115.481) -- 0:01:54
      396500 -- (-1122.369) (-1110.964) [-1113.609] (-1110.013) * (-1113.119) (-1110.524) [-1111.965] (-1115.364) -- 0:01:54
      397000 -- (-1112.698) [-1118.134] (-1119.659) (-1115.745) * (-1120.823) [-1112.585] (-1111.720) (-1115.324) -- 0:01:53
      397500 -- [-1111.172] (-1114.785) (-1119.066) (-1116.952) * (-1114.512) [-1114.099] (-1112.406) (-1115.336) -- 0:01:53
      398000 -- (-1107.324) [-1110.676] (-1116.153) (-1119.223) * (-1115.743) (-1115.433) [-1112.094] (-1112.418) -- 0:01:53
      398500 -- (-1130.733) [-1110.854] (-1117.192) (-1113.388) * (-1121.770) [-1109.309] (-1123.663) (-1112.827) -- 0:01:53
      399000 -- (-1119.542) [-1116.919] (-1115.620) (-1114.330) * (-1122.608) (-1117.577) (-1124.283) [-1108.331] -- 0:01:52
      399500 -- (-1121.573) (-1118.879) (-1114.578) [-1117.157] * (-1122.625) [-1112.271] (-1124.401) (-1119.959) -- 0:01:52
      400000 -- [-1115.196] (-1117.182) (-1115.649) (-1123.031) * [-1120.747] (-1112.729) (-1116.528) (-1119.071) -- 0:01:52

      Average standard deviation of split frequencies: 0.003530

      400500 -- (-1125.472) [-1111.819] (-1117.602) (-1119.960) * (-1115.833) [-1107.308] (-1121.185) (-1115.274) -- 0:01:52
      401000 -- (-1118.662) (-1112.729) (-1113.628) [-1116.747] * [-1114.010] (-1110.372) (-1114.025) (-1114.521) -- 0:01:52
      401500 -- (-1115.162) (-1113.381) (-1117.801) [-1117.297] * [-1115.191] (-1114.669) (-1109.347) (-1110.060) -- 0:01:53
      402000 -- (-1122.761) [-1114.259] (-1115.475) (-1117.996) * (-1112.162) (-1114.615) [-1119.224] (-1109.110) -- 0:01:53
      402500 -- [-1119.904] (-1122.447) (-1115.494) (-1113.476) * (-1117.438) (-1111.811) [-1112.392] (-1115.196) -- 0:01:52
      403000 -- (-1117.745) (-1117.634) [-1114.721] (-1114.236) * [-1111.957] (-1110.851) (-1110.073) (-1111.951) -- 0:01:52
      403500 -- (-1116.137) (-1122.492) (-1113.157) [-1116.730] * [-1111.899] (-1119.715) (-1116.292) (-1117.647) -- 0:01:52
      404000 -- (-1119.735) (-1112.246) [-1115.755] (-1119.437) * [-1114.616] (-1109.742) (-1117.798) (-1117.117) -- 0:01:52
      404500 -- [-1117.636] (-1114.638) (-1112.064) (-1119.309) * (-1122.573) (-1114.094) [-1116.930] (-1114.040) -- 0:01:51
      405000 -- (-1117.023) [-1113.646] (-1114.231) (-1115.370) * (-1123.221) (-1119.166) (-1120.108) [-1116.476] -- 0:01:51

      Average standard deviation of split frequencies: 0.003870

      405500 -- [-1113.391] (-1116.645) (-1111.133) (-1119.908) * (-1120.503) (-1120.979) [-1115.912] (-1119.949) -- 0:01:51
      406000 -- (-1120.711) (-1116.527) [-1108.455] (-1108.734) * (-1118.318) (-1112.117) [-1111.326] (-1117.543) -- 0:01:51
      406500 -- (-1118.087) (-1125.410) (-1110.109) [-1110.299] * (-1117.332) (-1118.437) [-1118.188] (-1116.249) -- 0:01:52
      407000 -- (-1111.907) (-1111.575) (-1111.989) [-1112.662] * [-1117.363] (-1109.175) (-1114.434) (-1115.858) -- 0:01:52
      407500 -- [-1110.925] (-1129.979) (-1115.158) (-1119.932) * [-1109.433] (-1117.321) (-1110.060) (-1115.852) -- 0:01:51
      408000 -- (-1111.184) (-1119.897) (-1117.736) [-1113.066] * [-1112.866] (-1112.525) (-1108.203) (-1111.993) -- 0:01:51
      408500 -- [-1108.031] (-1111.289) (-1123.558) (-1113.384) * (-1118.532) (-1110.717) [-1116.237] (-1121.193) -- 0:01:51
      409000 -- (-1116.874) (-1115.767) (-1119.833) [-1117.307] * (-1114.854) [-1118.337] (-1110.971) (-1122.992) -- 0:01:51
      409500 -- (-1108.418) [-1112.054] (-1123.343) (-1117.848) * (-1116.396) [-1114.445] (-1115.096) (-1113.669) -- 0:01:51
      410000 -- (-1107.366) [-1112.496] (-1118.546) (-1112.841) * (-1120.342) (-1120.130) (-1115.372) [-1113.451] -- 0:01:50

      Average standard deviation of split frequencies: 0.003826

      410500 -- (-1112.422) [-1113.607] (-1111.119) (-1114.977) * (-1110.786) (-1124.584) [-1110.440] (-1116.167) -- 0:01:50
      411000 -- (-1119.462) (-1115.220) [-1108.470] (-1113.229) * (-1113.628) [-1117.004] (-1117.980) (-1113.683) -- 0:01:50
      411500 -- [-1115.799] (-1114.561) (-1122.801) (-1115.012) * (-1112.300) [-1118.031] (-1113.354) (-1111.569) -- 0:01:50
      412000 -- (-1108.937) (-1113.058) (-1115.539) [-1107.324] * (-1116.357) [-1113.867] (-1112.035) (-1115.187) -- 0:01:51
      412500 -- (-1110.489) [-1114.749] (-1117.356) (-1119.696) * (-1125.665) [-1109.943] (-1116.360) (-1115.544) -- 0:01:51
      413000 -- (-1110.859) (-1106.075) (-1113.696) [-1117.175] * (-1116.085) (-1113.691) [-1117.953] (-1119.018) -- 0:01:50
      413500 -- (-1111.063) [-1114.667] (-1117.181) (-1108.355) * (-1120.748) (-1115.994) (-1111.649) [-1115.337] -- 0:01:50
      414000 -- [-1114.071] (-1114.574) (-1119.377) (-1113.920) * [-1120.209] (-1120.305) (-1114.671) (-1113.761) -- 0:01:50
      414500 -- [-1115.571] (-1122.188) (-1118.196) (-1114.545) * (-1112.489) (-1111.247) [-1110.990] (-1113.552) -- 0:01:50
      415000 -- (-1110.667) (-1115.463) [-1114.401] (-1113.941) * (-1116.383) (-1116.404) [-1113.140] (-1119.944) -- 0:01:49

      Average standard deviation of split frequencies: 0.003400

      415500 -- (-1109.149) (-1113.772) [-1113.931] (-1113.717) * (-1110.800) [-1114.204] (-1112.451) (-1118.096) -- 0:01:49
      416000 -- (-1112.666) [-1114.352] (-1111.697) (-1115.730) * (-1112.433) [-1113.142] (-1115.316) (-1113.397) -- 0:01:49
      416500 -- (-1116.562) [-1114.486] (-1114.468) (-1111.202) * [-1112.858] (-1118.917) (-1113.463) (-1109.973) -- 0:01:49
      417000 -- (-1119.356) (-1123.496) (-1114.923) [-1115.624] * (-1116.695) [-1108.906] (-1126.894) (-1117.673) -- 0:01:50
      417500 -- (-1117.169) (-1114.931) [-1111.120] (-1127.241) * (-1112.235) (-1117.193) (-1123.444) [-1108.781] -- 0:01:50
      418000 -- (-1110.269) (-1112.375) (-1113.708) [-1114.886] * [-1118.413] (-1114.445) (-1113.001) (-1107.026) -- 0:01:49
      418500 -- [-1121.065] (-1120.614) (-1113.200) (-1110.993) * [-1118.400] (-1118.966) (-1117.236) (-1107.883) -- 0:01:49
      419000 -- [-1112.423] (-1113.489) (-1114.687) (-1112.579) * (-1126.694) (-1115.545) [-1112.533] (-1111.275) -- 0:01:49
      419500 -- (-1115.868) [-1113.539] (-1122.303) (-1110.121) * (-1117.173) [-1116.638] (-1108.917) (-1119.308) -- 0:01:49
      420000 -- (-1120.535) (-1119.466) [-1111.425] (-1108.749) * [-1115.728] (-1110.671) (-1115.617) (-1113.292) -- 0:01:49

      Average standard deviation of split frequencies: 0.003362

      420500 -- (-1123.889) [-1115.808] (-1118.841) (-1118.098) * (-1119.515) (-1111.276) [-1114.821] (-1116.064) -- 0:01:48
      421000 -- [-1115.798] (-1112.639) (-1109.828) (-1115.309) * (-1116.037) (-1118.454) (-1122.930) [-1111.353] -- 0:01:48
      421500 -- (-1114.275) (-1114.531) [-1122.394] (-1119.218) * [-1119.928] (-1112.985) (-1120.442) (-1114.381) -- 0:01:48
      422000 -- (-1121.838) (-1118.558) (-1117.591) [-1122.402] * [-1114.076] (-1128.440) (-1110.744) (-1111.213) -- 0:01:48
      422500 -- (-1117.361) [-1110.520] (-1116.843) (-1121.426) * (-1117.179) [-1115.608] (-1111.162) (-1112.048) -- 0:01:49
      423000 -- (-1113.166) [-1106.282] (-1109.779) (-1122.318) * (-1122.261) [-1113.448] (-1115.328) (-1116.615) -- 0:01:49
      423500 -- [-1109.858] (-1111.401) (-1110.190) (-1113.444) * [-1113.416] (-1116.953) (-1113.898) (-1113.775) -- 0:01:48
      424000 -- (-1108.166) [-1109.400] (-1110.525) (-1116.446) * (-1122.007) [-1123.459] (-1120.112) (-1115.444) -- 0:01:48
      424500 -- [-1113.768] (-1115.293) (-1115.045) (-1122.278) * (-1118.367) (-1113.816) (-1115.203) [-1113.313] -- 0:01:48
      425000 -- (-1113.094) [-1110.031] (-1111.223) (-1114.697) * (-1118.682) [-1111.581] (-1124.860) (-1119.252) -- 0:01:48

      Average standard deviation of split frequencies: 0.004057

      425500 -- (-1113.572) [-1120.465] (-1111.841) (-1115.293) * (-1110.041) (-1113.240) (-1111.581) [-1115.675] -- 0:01:48
      426000 -- [-1121.297] (-1114.131) (-1115.537) (-1124.686) * (-1112.934) [-1106.283] (-1114.528) (-1116.976) -- 0:01:47
      426500 -- (-1115.889) (-1115.342) [-1112.555] (-1116.975) * [-1109.403] (-1111.187) (-1114.222) (-1112.433) -- 0:01:47
      427000 -- (-1115.354) [-1110.845] (-1115.716) (-1111.572) * (-1116.092) (-1108.792) [-1112.025] (-1114.580) -- 0:01:47
      427500 -- (-1111.617) (-1116.106) [-1110.764] (-1120.562) * (-1115.553) [-1118.127] (-1113.679) (-1117.970) -- 0:01:48
      428000 -- (-1113.655) (-1124.232) (-1119.618) [-1113.271] * (-1115.797) [-1111.068] (-1114.351) (-1114.177) -- 0:01:48
      428500 -- [-1110.745] (-1117.493) (-1114.160) (-1113.236) * (-1115.393) (-1110.992) (-1114.498) [-1119.535] -- 0:01:48
      429000 -- (-1111.587) (-1117.322) (-1112.028) [-1112.007] * (-1123.832) [-1112.282] (-1115.380) (-1116.160) -- 0:01:47
      429500 -- (-1122.002) (-1116.074) [-1119.909] (-1117.439) * (-1109.995) (-1113.923) [-1110.470] (-1119.940) -- 0:01:47
      430000 -- [-1115.179] (-1117.455) (-1115.166) (-1124.419) * [-1114.703] (-1118.213) (-1115.330) (-1111.915) -- 0:01:47

      Average standard deviation of split frequencies: 0.004743

      430500 -- (-1121.357) (-1118.002) [-1112.656] (-1117.204) * (-1110.239) (-1121.406) (-1117.371) [-1116.956] -- 0:01:47
      431000 -- (-1111.620) [-1117.588] (-1113.322) (-1115.318) * [-1115.735] (-1126.468) (-1119.633) (-1112.139) -- 0:01:46
      431500 -- [-1113.691] (-1111.914) (-1114.242) (-1118.161) * (-1113.178) [-1115.550] (-1118.758) (-1118.714) -- 0:01:46
      432000 -- (-1118.347) [-1118.162] (-1120.203) (-1109.869) * (-1110.972) [-1109.053] (-1112.600) (-1119.484) -- 0:01:46
      432500 -- (-1112.286) (-1113.081) [-1112.403] (-1113.837) * (-1112.322) (-1119.952) (-1114.368) [-1111.774] -- 0:01:46
      433000 -- (-1115.697) (-1115.781) [-1111.624] (-1114.800) * (-1114.220) [-1112.024] (-1117.594) (-1113.128) -- 0:01:47
      433500 -- [-1115.486] (-1116.975) (-1116.870) (-1117.866) * [-1109.771] (-1115.565) (-1113.394) (-1114.445) -- 0:01:47
      434000 -- (-1117.666) (-1118.743) [-1111.701] (-1121.285) * [-1117.450] (-1115.658) (-1110.469) (-1116.616) -- 0:01:46
      434500 -- (-1118.277) (-1111.156) [-1110.608] (-1119.863) * (-1116.893) [-1121.638] (-1112.894) (-1120.919) -- 0:01:46
      435000 -- (-1116.829) (-1117.895) (-1112.034) [-1120.110] * [-1112.705] (-1113.727) (-1112.246) (-1116.403) -- 0:01:46

      Average standard deviation of split frequencies: 0.004685

      435500 -- (-1120.917) [-1116.355] (-1107.778) (-1117.928) * (-1120.679) (-1115.181) (-1106.384) [-1111.123] -- 0:01:46
      436000 -- (-1118.759) (-1110.246) [-1113.474] (-1115.357) * (-1113.010) (-1114.160) [-1113.624] (-1113.612) -- 0:01:46
      436500 -- (-1117.472) [-1113.387] (-1118.895) (-1119.200) * (-1117.829) (-1115.171) (-1111.789) [-1117.103] -- 0:01:45
      437000 -- [-1116.602] (-1116.209) (-1112.249) (-1119.095) * (-1120.157) (-1109.886) [-1118.386] (-1112.781) -- 0:01:45
      437500 -- (-1123.928) [-1117.389] (-1115.112) (-1115.948) * (-1111.928) [-1110.009] (-1116.132) (-1118.544) -- 0:01:45
      438000 -- (-1116.303) (-1112.019) [-1115.969] (-1120.068) * [-1114.797] (-1111.519) (-1110.941) (-1113.034) -- 0:01:46
      438500 -- (-1114.588) (-1115.145) (-1117.793) [-1119.556] * (-1113.521) (-1117.347) (-1117.276) [-1113.604] -- 0:01:46
      439000 -- (-1113.985) (-1118.240) [-1111.914] (-1118.351) * (-1116.958) (-1112.607) (-1115.885) [-1112.441] -- 0:01:46
      439500 -- [-1113.812] (-1120.047) (-1118.708) (-1129.447) * [-1112.900] (-1117.418) (-1115.721) (-1116.668) -- 0:01:45
      440000 -- (-1120.836) (-1113.967) [-1120.656] (-1117.225) * (-1116.637) (-1116.876) [-1112.828] (-1122.960) -- 0:01:45

      Average standard deviation of split frequencies: 0.005349

      440500 -- [-1115.341] (-1117.122) (-1115.039) (-1120.364) * (-1118.025) (-1115.308) (-1120.154) [-1121.351] -- 0:01:45
      441000 -- (-1116.274) [-1113.877] (-1120.437) (-1117.869) * (-1119.138) [-1120.062] (-1117.278) (-1129.764) -- 0:01:45
      441500 -- (-1121.724) (-1117.606) (-1114.623) [-1116.456] * (-1116.487) [-1119.228] (-1114.649) (-1116.394) -- 0:01:44
      442000 -- [-1113.386] (-1112.760) (-1112.186) (-1110.381) * (-1112.111) (-1115.523) (-1116.254) [-1111.366] -- 0:01:44
      442500 -- (-1116.109) (-1121.372) (-1118.068) [-1111.691] * [-1110.023] (-1116.822) (-1123.049) (-1113.070) -- 0:01:44
      443000 -- (-1120.127) (-1125.311) (-1114.447) [-1109.422] * (-1114.977) (-1111.966) [-1118.323] (-1120.590) -- 0:01:44
      443500 -- (-1118.709) (-1119.085) (-1118.461) [-1107.119] * [-1114.284] (-1119.363) (-1109.045) (-1117.373) -- 0:01:45
      444000 -- [-1112.398] (-1116.452) (-1118.300) (-1113.933) * [-1112.555] (-1120.151) (-1112.469) (-1114.268) -- 0:01:45
      444500 -- (-1112.689) (-1118.620) (-1118.836) [-1117.241] * (-1113.050) (-1121.579) (-1118.978) [-1121.080] -- 0:01:44
      445000 -- (-1111.379) (-1118.527) (-1116.669) [-1111.702] * [-1120.523] (-1118.674) (-1117.840) (-1115.960) -- 0:01:44

      Average standard deviation of split frequencies: 0.005637

      445500 -- (-1113.250) [-1126.963] (-1115.516) (-1112.494) * (-1113.578) (-1119.948) [-1116.777] (-1115.556) -- 0:01:44
      446000 -- [-1117.886] (-1114.155) (-1120.663) (-1119.297) * [-1111.682] (-1111.988) (-1108.777) (-1114.935) -- 0:01:44
      446500 -- [-1110.527] (-1113.774) (-1119.653) (-1119.307) * [-1114.983] (-1123.522) (-1113.221) (-1118.630) -- 0:01:44
      447000 -- (-1111.748) (-1114.692) [-1113.716] (-1122.429) * (-1120.846) (-1124.819) (-1115.872) [-1111.073] -- 0:01:43
      447500 -- (-1109.605) [-1112.881] (-1110.953) (-1138.061) * [-1122.507] (-1128.500) (-1118.051) (-1113.145) -- 0:01:43
      448000 -- (-1114.426) [-1108.000] (-1120.078) (-1119.158) * [-1115.517] (-1119.247) (-1117.261) (-1121.537) -- 0:01:43
      448500 -- (-1113.030) [-1116.607] (-1125.772) (-1118.072) * (-1111.872) (-1111.718) [-1108.202] (-1120.843) -- 0:01:44
      449000 -- [-1115.531] (-1113.886) (-1114.582) (-1125.084) * (-1114.231) (-1120.149) [-1115.260] (-1109.275) -- 0:01:44
      449500 -- [-1112.287] (-1114.812) (-1113.180) (-1116.709) * (-1114.459) [-1120.006] (-1110.300) (-1119.559) -- 0:01:44
      450000 -- (-1114.747) (-1120.384) [-1117.196] (-1114.183) * (-1125.295) (-1123.059) (-1110.251) [-1117.311] -- 0:01:43

      Average standard deviation of split frequencies: 0.003487

      450500 -- [-1115.693] (-1109.058) (-1111.478) (-1113.316) * [-1111.379] (-1115.310) (-1111.351) (-1118.643) -- 0:01:43
      451000 -- [-1116.529] (-1113.720) (-1117.409) (-1115.884) * [-1114.447] (-1116.306) (-1117.203) (-1112.539) -- 0:01:43
      451500 -- (-1113.891) (-1110.789) (-1114.096) [-1107.959] * (-1117.939) [-1109.352] (-1113.859) (-1113.932) -- 0:01:43
      452000 -- (-1113.541) (-1123.750) [-1111.472] (-1107.185) * (-1117.255) [-1120.167] (-1116.778) (-1110.093) -- 0:01:43
      452500 -- [-1116.550] (-1112.159) (-1119.287) (-1105.944) * (-1116.491) (-1116.642) [-1111.276] (-1115.411) -- 0:01:42
      453000 -- (-1123.654) (-1112.464) (-1117.390) [-1118.704] * (-1118.103) [-1110.580] (-1125.745) (-1124.741) -- 0:01:42
      453500 -- (-1109.891) (-1112.406) [-1115.519] (-1120.388) * (-1112.900) [-1112.275] (-1113.214) (-1115.675) -- 0:01:42
      454000 -- [-1114.631] (-1108.348) (-1112.205) (-1129.764) * [-1114.733] (-1111.984) (-1112.295) (-1113.921) -- 0:01:43
      454500 -- (-1117.252) (-1110.503) (-1113.042) [-1125.117] * [-1118.612] (-1112.896) (-1118.709) (-1115.059) -- 0:01:43
      455000 -- (-1121.721) (-1111.741) [-1115.129] (-1117.050) * [-1112.440] (-1117.570) (-1121.368) (-1113.215) -- 0:01:43

      Average standard deviation of split frequencies: 0.004824

      455500 -- (-1117.515) (-1112.013) [-1115.726] (-1111.681) * [-1110.969] (-1123.809) (-1123.754) (-1112.285) -- 0:01:42
      456000 -- (-1117.243) (-1109.394) [-1116.583] (-1121.679) * [-1110.892] (-1114.727) (-1119.451) (-1121.423) -- 0:01:42
      456500 -- [-1115.526] (-1121.157) (-1117.592) (-1112.973) * (-1117.975) (-1119.012) (-1126.483) [-1113.958] -- 0:01:42
      457000 -- (-1115.921) (-1111.628) [-1114.325] (-1114.404) * (-1124.510) (-1115.099) (-1123.937) [-1114.558] -- 0:01:42
      457500 -- (-1115.711) (-1116.827) [-1113.722] (-1108.240) * (-1112.431) (-1121.481) [-1114.966] (-1120.710) -- 0:01:41
      458000 -- (-1116.854) [-1113.082] (-1110.949) (-1110.175) * (-1116.452) (-1119.291) (-1112.424) [-1112.553] -- 0:01:41
      458500 -- (-1117.542) (-1117.179) [-1112.883] (-1121.961) * (-1119.474) (-1115.905) [-1110.698] (-1115.233) -- 0:01:41
      459000 -- (-1113.148) (-1114.796) [-1110.726] (-1117.600) * (-1110.615) [-1118.538] (-1118.791) (-1108.038) -- 0:01:42
      459500 -- (-1114.421) (-1118.643) (-1112.918) [-1118.990] * (-1116.536) [-1114.276] (-1116.192) (-1107.479) -- 0:01:42
      460000 -- (-1118.152) (-1116.325) (-1115.924) [-1119.904] * (-1118.455) [-1114.030] (-1116.523) (-1115.922) -- 0:01:42

      Average standard deviation of split frequencies: 0.005458

      460500 -- (-1119.084) (-1114.065) [-1115.544] (-1118.072) * (-1114.820) (-1116.059) [-1118.081] (-1125.243) -- 0:01:41
      461000 -- (-1117.439) (-1109.999) [-1108.787] (-1112.446) * (-1115.969) (-1115.387) (-1121.497) [-1113.860] -- 0:01:41
      461500 -- (-1119.166) (-1120.211) [-1109.883] (-1111.391) * (-1129.743) (-1119.160) (-1123.842) [-1114.186] -- 0:01:41
      462000 -- (-1116.109) [-1112.087] (-1118.655) (-1109.376) * (-1122.275) (-1113.154) [-1115.163] (-1118.841) -- 0:01:41
      462500 -- (-1121.104) (-1115.838) (-1112.213) [-1115.499] * (-1117.344) (-1113.619) [-1111.954] (-1110.997) -- 0:01:41
      463000 -- [-1112.696] (-1112.083) (-1112.014) (-1109.054) * (-1119.600) (-1119.346) [-1111.050] (-1117.257) -- 0:01:40
      463500 -- (-1112.932) (-1122.174) (-1118.960) [-1112.072] * (-1117.217) [-1111.135] (-1114.187) (-1113.717) -- 0:01:40
      464000 -- (-1111.457) (-1110.864) [-1121.941] (-1116.907) * (-1115.367) (-1110.654) [-1112.012] (-1115.869) -- 0:01:41
      464500 -- (-1114.351) (-1113.880) (-1114.936) [-1114.133] * (-1116.631) [-1111.588] (-1115.829) (-1119.967) -- 0:01:41
      465000 -- (-1114.641) (-1113.635) (-1113.361) [-1114.369] * (-1115.449) (-1118.757) (-1112.715) [-1115.281] -- 0:01:41

      Average standard deviation of split frequencies: 0.005395

      465500 -- (-1122.350) (-1118.279) (-1117.898) [-1110.971] * [-1117.218] (-1114.240) (-1115.978) (-1113.900) -- 0:01:41
      466000 -- (-1112.646) (-1113.455) [-1112.079] (-1118.138) * [-1120.754] (-1119.864) (-1113.376) (-1111.455) -- 0:01:40
      466500 -- (-1112.483) [-1110.218] (-1111.362) (-1117.356) * (-1115.984) (-1117.776) [-1112.831] (-1117.972) -- 0:01:40
      467000 -- (-1116.766) [-1110.518] (-1115.646) (-1116.945) * (-1107.825) [-1111.063] (-1117.127) (-1111.439) -- 0:01:40
      467500 -- (-1111.491) [-1116.864] (-1124.036) (-1124.405) * (-1112.366) (-1109.036) (-1112.543) [-1111.787] -- 0:01:40
      468000 -- [-1116.773] (-1119.311) (-1109.506) (-1115.132) * [-1110.472] (-1112.651) (-1117.866) (-1122.925) -- 0:01:40
      468500 -- (-1109.940) (-1119.248) [-1112.892] (-1125.636) * (-1108.797) (-1112.808) (-1119.147) [-1119.152] -- 0:01:39
      469000 -- (-1118.742) (-1112.099) (-1122.650) [-1113.810] * (-1115.677) (-1112.945) (-1119.053) [-1117.332] -- 0:01:39
      469500 -- (-1122.469) (-1116.805) [-1122.555] (-1118.764) * (-1116.650) (-1119.934) (-1114.448) [-1111.188] -- 0:01:40
      470000 -- (-1120.150) [-1112.853] (-1112.026) (-1112.593) * (-1118.009) (-1113.132) [-1115.072] (-1118.244) -- 0:01:40

      Average standard deviation of split frequencies: 0.006009

      470500 -- (-1116.183) (-1122.200) [-1108.431] (-1116.603) * (-1122.127) (-1116.252) [-1111.770] (-1112.650) -- 0:01:40
      471000 -- (-1116.820) (-1117.853) (-1117.531) [-1117.549] * (-1116.685) [-1121.244] (-1117.582) (-1114.290) -- 0:01:39
      471500 -- (-1130.193) [-1109.361] (-1118.455) (-1110.882) * (-1123.372) [-1111.013] (-1109.727) (-1114.001) -- 0:01:39
      472000 -- (-1121.643) (-1115.657) (-1117.734) [-1111.247] * (-1119.460) [-1114.994] (-1118.387) (-1121.647) -- 0:01:39
      472500 -- (-1119.420) (-1110.454) [-1111.205] (-1110.303) * (-1116.106) (-1114.825) (-1110.634) [-1117.737] -- 0:01:39
      473000 -- (-1118.257) (-1111.927) [-1112.514] (-1118.925) * (-1114.458) (-1120.972) [-1111.764] (-1121.010) -- 0:01:39
      473500 -- (-1115.455) [-1110.412] (-1113.328) (-1119.274) * (-1114.512) (-1116.283) [-1116.050] (-1117.564) -- 0:01:38
      474000 -- (-1114.896) (-1113.474) (-1114.433) [-1116.956] * (-1113.489) [-1114.841] (-1107.118) (-1120.114) -- 0:01:38
      474500 -- (-1114.120) [-1113.255] (-1113.916) (-1114.835) * (-1111.650) (-1112.645) (-1118.860) [-1125.625] -- 0:01:39
      475000 -- (-1118.173) (-1107.345) [-1109.096] (-1113.447) * (-1110.102) (-1118.815) [-1110.649] (-1118.309) -- 0:01:39

      Average standard deviation of split frequencies: 0.005612

      475500 -- (-1115.933) (-1117.496) [-1112.885] (-1114.515) * [-1110.122] (-1112.153) (-1112.984) (-1123.014) -- 0:01:39
      476000 -- (-1110.591) (-1111.100) [-1115.327] (-1111.778) * (-1118.504) (-1113.544) (-1114.371) [-1110.633] -- 0:01:39
      476500 -- (-1115.108) (-1117.999) [-1111.279] (-1112.511) * (-1114.322) [-1116.765] (-1126.365) (-1112.827) -- 0:01:38
      477000 -- (-1115.052) (-1111.010) [-1118.148] (-1112.011) * (-1111.963) (-1117.405) [-1118.633] (-1115.498) -- 0:01:38
      477500 -- (-1112.556) (-1111.155) (-1108.250) [-1116.978] * [-1113.167] (-1113.786) (-1108.348) (-1117.428) -- 0:01:38
      478000 -- (-1116.935) [-1109.900] (-1113.416) (-1123.699) * [-1112.841] (-1114.724) (-1116.456) (-1112.360) -- 0:01:38
      478500 -- [-1117.701] (-1113.481) (-1110.981) (-1116.154) * (-1114.548) [-1112.897] (-1112.495) (-1112.729) -- 0:01:38
      479000 -- (-1116.069) (-1113.180) (-1110.618) [-1118.136] * [-1114.914] (-1115.742) (-1117.292) (-1116.979) -- 0:01:37
      479500 -- [-1109.627] (-1122.220) (-1115.744) (-1120.178) * (-1123.681) (-1115.116) [-1117.264] (-1116.577) -- 0:01:37
      480000 -- [-1114.700] (-1119.734) (-1131.083) (-1110.285) * (-1111.394) (-1110.924) [-1111.823] (-1113.853) -- 0:01:38

      Average standard deviation of split frequencies: 0.006211

      480500 -- (-1114.880) (-1112.101) [-1115.688] (-1107.230) * (-1110.428) [-1110.737] (-1113.782) (-1109.447) -- 0:01:38
      481000 -- (-1111.224) (-1117.158) [-1110.374] (-1112.838) * (-1120.867) [-1112.113] (-1115.631) (-1114.423) -- 0:01:38
      481500 -- [-1110.165] (-1115.313) (-1119.074) (-1123.160) * (-1118.266) (-1118.586) (-1118.768) [-1120.603] -- 0:01:37
      482000 -- [-1113.469] (-1112.256) (-1116.604) (-1115.771) * (-1115.822) (-1120.373) (-1119.964) [-1111.385] -- 0:01:37
      482500 -- (-1122.347) (-1116.015) (-1115.364) [-1119.125] * (-1123.617) (-1115.623) [-1110.571] (-1125.127) -- 0:01:37
      483000 -- (-1118.861) (-1109.219) [-1113.278] (-1119.155) * (-1117.790) (-1114.532) [-1112.462] (-1124.218) -- 0:01:37
      483500 -- (-1114.765) (-1113.356) [-1110.025] (-1116.200) * (-1119.939) [-1117.940] (-1115.952) (-1114.339) -- 0:01:37
      484000 -- (-1116.160) (-1118.237) [-1117.745] (-1116.318) * (-1119.048) (-1119.714) (-1114.632) [-1116.559] -- 0:01:37
      484500 -- (-1113.782) (-1115.409) [-1109.229] (-1118.315) * (-1117.906) (-1114.808) (-1119.591) [-1118.981] -- 0:01:36
      485000 -- (-1106.820) (-1117.794) [-1109.931] (-1120.183) * (-1123.053) (-1113.745) (-1123.664) [-1112.142] -- 0:01:37

      Average standard deviation of split frequencies: 0.006143

      485500 -- (-1113.207) (-1116.842) (-1112.196) [-1110.685] * [-1112.595] (-1110.921) (-1116.701) (-1114.948) -- 0:01:37
      486000 -- (-1117.431) (-1110.120) (-1112.849) [-1116.817] * (-1116.238) (-1119.828) (-1116.081) [-1116.808] -- 0:01:37
      486500 -- (-1122.568) (-1110.391) [-1118.775] (-1112.212) * (-1116.678) [-1109.874] (-1112.989) (-1127.145) -- 0:01:37
      487000 -- (-1117.193) (-1118.226) (-1115.325) [-1114.814] * (-1125.156) (-1112.726) [-1114.856] (-1119.175) -- 0:01:36
      487500 -- (-1116.451) (-1120.636) [-1113.883] (-1115.638) * [-1112.550] (-1118.269) (-1115.489) (-1118.196) -- 0:01:36
      488000 -- [-1114.488] (-1128.026) (-1113.378) (-1112.202) * (-1119.816) (-1114.084) (-1111.991) [-1112.360] -- 0:01:36
      488500 -- [-1113.969] (-1112.420) (-1118.834) (-1116.871) * (-1114.915) (-1121.049) (-1116.924) [-1117.276] -- 0:01:36
      489000 -- [-1109.252] (-1118.357) (-1119.825) (-1117.087) * (-1114.521) [-1115.362] (-1116.555) (-1112.080) -- 0:01:36
      489500 -- [-1113.659] (-1116.261) (-1122.380) (-1107.746) * (-1114.760) (-1108.544) [-1111.679] (-1112.656) -- 0:01:35
      490000 -- (-1111.726) (-1114.047) [-1113.193] (-1109.909) * [-1120.824] (-1118.497) (-1113.211) (-1113.646) -- 0:01:35

      Average standard deviation of split frequencies: 0.006725

      490500 -- (-1119.948) (-1109.919) [-1113.660] (-1116.589) * (-1111.125) (-1118.069) (-1116.029) [-1111.171] -- 0:01:36
      4910