--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Nov 12 06:20:08 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/2/Acam-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1110.56 -1122.48
2 -1110.39 -1119.91
--------------------------------------
TOTAL -1110.47 -1121.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.594192 0.014355 0.370684 0.816880 0.577600 846.10 982.31 1.000
r(A<->C){all} 0.066901 0.001130 0.007743 0.131574 0.063217 596.73 665.19 1.000
r(A<->G){all} 0.114560 0.001481 0.050063 0.196252 0.109525 570.93 694.39 1.000
r(A<->T){all} 0.143289 0.002627 0.047122 0.243359 0.138426 763.70 791.44 1.000
r(C<->G){all} 0.073510 0.000811 0.022915 0.129814 0.070676 772.72 886.10 1.000
r(C<->T){all} 0.541517 0.005377 0.392300 0.674869 0.542034 580.82 591.67 1.000
r(G<->T){all} 0.060224 0.000896 0.005079 0.118287 0.056525 853.26 932.66 1.000
pi(A){all} 0.256444 0.000388 0.216810 0.294496 0.255909 891.48 1055.47 1.000
pi(C){all} 0.234852 0.000332 0.198324 0.269051 0.234726 999.41 1154.48 1.001
pi(G){all} 0.316632 0.000435 0.276391 0.356971 0.316422 1237.77 1278.29 1.000
pi(T){all} 0.192072 0.000288 0.158985 0.225398 0.191393 1237.59 1274.76 1.000
alpha{1,2} 0.098261 0.002036 0.002442 0.170310 0.100684 1203.31 1352.15 1.000
alpha{3} 1.986478 0.617666 0.634869 3.552134 1.848621 1501.00 1501.00 1.000
pinvar{all} 0.382179 0.010600 0.168103 0.565538 0.393649 1018.70 1095.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1014.050256
Model 2: PositiveSelection -1014.049666
Model 0: one-ratio -1014.049666
Model 3: discrete -1012.263531
Model 7: beta -1012.456943
Model 8: beta&w>1 -1012.458344
Model 0 vs 1 0.0011799999999766442
Model 2 vs 1 0.0011799999999766442
Model 8 vs 7 0.002801999999974214
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=148
C1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C2 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C3 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C4 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C5 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
C6 MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
*********************:***** :**************:*.****
C1 LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C2 LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C3 LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C4 LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C5 LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
C6 LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
*:*:.:.*.:* *:*:***.******************************
C1 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C2 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C3 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C4 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C5 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
C6 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4440]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4440]--->[4440]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.311 Mb, Max= 30.535 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
FORMAT of file /tmp/tmp1103344606009295275aln Not Supported[FATAL:T-COFFEE]
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:148 S:100 BS:148
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.32 C1 C2 99.32
TOP 1 0 99.32 C2 C1 99.32
BOT 0 2 99.32 C1 C3 99.32
TOP 2 0 99.32 C3 C1 99.32
BOT 0 3 97.30 C1 C4 97.30
TOP 3 0 97.30 C4 C1 97.30
BOT 0 4 97.30 C1 C5 97.30
TOP 4 0 97.30 C5 C1 97.30
BOT 0 5 91.22 C1 C6 91.22
TOP 5 0 91.22 C6 C1 91.22
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 96.62 C2 C4 96.62
TOP 3 1 96.62 C4 C2 96.62
BOT 1 4 96.62 C2 C5 96.62
TOP 4 1 96.62 C5 C2 96.62
BOT 1 5 90.54 C2 C6 90.54
TOP 5 1 90.54 C6 C2 90.54
BOT 2 3 96.62 C3 C4 96.62
TOP 3 2 96.62 C4 C3 96.62
BOT 2 4 96.62 C3 C5 96.62
TOP 4 2 96.62 C5 C3 96.62
BOT 2 5 90.54 C3 C6 90.54
TOP 5 2 90.54 C6 C3 90.54
BOT 3 4 98.65 C4 C5 98.65
TOP 4 3 98.65 C5 C4 98.65
BOT 3 5 92.57 C4 C6 92.57
TOP 5 3 92.57 C6 C4 92.57
BOT 4 5 91.22 C5 C6 91.22
TOP 5 4 91.22 C6 C5 91.22
AVG 0 C1 * 96.89
AVG 1 C2 * 96.62
AVG 2 C3 * 96.62
AVG 3 C4 * 96.35
AVG 4 C5 * 96.08
AVG 5 C6 * 91.22
TOT TOT * 95.63
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCCGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
C2 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
C3 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
C4 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTCGT
C5 ATGTCGGAACTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTCGT
C6 ATGTCCGAGCTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTTGT
***** **.*****************:******************** **
C1 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
C2 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACTCGTGAGCTGGGCA
C3 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
C4 GCAGTTCGACAAGGAGGGAACCGGCAAGATAGCCACCCGTGAGCTGGGCA
C5 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
C6 GCAGTTCGATAAGGACGGAACCGGGAAGATAAACAGCCGTGAGTTGGGCA
******** ***** ******** *****...** ****** ******
C1 CATTGATGCGCACCTTGGGCCAGAATCCAACGGAGGCCGAGTTGCAAGAT
C2 CCTTGATGCGCACCTTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
C3 CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
C4 CTTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAC
C5 CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
C6 CCTTGATGCGCACCCTTGGCCAGAATCCCTCGGAGGGCGAGCTGCAGGAC
* ************ * ***********.:****** **** ****.**
C1 TTGATAGCTGAGGCCGAGAACAACAACAATGGCCAACTGAACTTCACTGA
C2 TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
C3 TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
C4 TTGATTGCTGAGGCCGACAACAACAGCAATGGCCAACTGGACTTCAGTGA
C5 TTAATTGCCGATGCCGACAATAACAGCAATGGCCAACTGGACTTCACTGA
C6 CTGATGGCCGAGGTCGAGAACAACAGCGAGGGGCTACTGGACTTCAGTGA
*.** ** ** * *** *. ****.*.* ** *:****.****** **
C1 GTTCTGCGGTATAATGGCCAAGCAAATGCGGGAAACTGACACTGAGGAGG
C2 GTTTTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
C3 GTTCTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
C4 GTTCTGTGGCATTATGGCCAAGCAGATGCGCGAAACGGATACTGAGGAGG
C5 GTTCTGTGGTATCATGGCAAAGCAAATGCGTGAAACGGATACGGAGGAGG
C6 GTTCTGTGCCATCATGGCCAAGCAGATGCGCGAAACCGATACCGAGGAGG
*** ** * ** *****.*****.***** ***** ** ** *******
C1 AAATGCGTGAGGCATTCAAGATTTTTGATCGTGATGGCGATGGCTTTATA
C2 AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C3 AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C4 AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C5 AAATGCGGGAGGCTTTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
C6 AGATGCGCGAGGCCTTTAAGATCTTCGATCGCGATGGGGATGGCTTTATA
*.***** ***** ** ***** ** ***** ***** ************
C1 TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C2 TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C3 TCACCAGCCGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C4 TCGCCAGCTGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
C5 TCACCAGCTGAGCTTCGCTTTGTAATGATTAATCTCGGCGAGAAGGTCAC
C6 TCGCCGGCTGAGCTCCGCTTTGTGATGATCAATCTGGGAGAAAAGGTCAC
**.**.** ***** ********.***** ***** **.**.********
C1 CGACGAGGAGATCGATGAGATGATTCGCGAGGCTGATTTTGATGGGGATG
C2 CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
C3 CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
C4 CGACGAGGAGATCGACGAGATGATACGCGAGGCGGATTTTGATGGAGATG
C5 CGATGAAGAGATCGACGAGATGATACGCGAGGCTGATTTTGATGGGGATG
C6 CGACGAGGAGATCGACGAGATGATCCGCGAGGCCGATTTCGATGGCGACG
*** **.******** ******** ** ***** ***** ***** ** *
C1 GCATGATCAACTACGAGGAATTCGTATGGATGATAAGCCAGAAG
C2 GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
C3 GCATGATCAACTACGAGGAATTCGTTTGGATGATTAGCCAGAAG
C4 GCATGATCAACTACGAGGAGTTCGTTTGGATGATAAGCCAGAAG
C5 GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
C6 GTATGATCAACTACGAGGAGTTCGTCTGGATGATCAGCCAGAAG
* *****************.***** ******** *********
>C1
ATGTCCGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
CATTGATGCGCACCTTGGGCCAGAATCCAACGGAGGCCGAGTTGCAAGAT
TTGATAGCTGAGGCCGAGAACAACAACAATGGCCAACTGAACTTCACTGA
GTTCTGCGGTATAATGGCCAAGCAAATGCGGGAAACTGACACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGTGATGGCGATGGCTTTATA
TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGATGAGATGATTCGCGAGGCTGATTTTGATGGGGATG
GCATGATCAACTACGAGGAATTCGTATGGATGATAAGCCAGAAG
>C2
ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACTCGTGAGCTGGGCA
CCTTGATGCGCACCTTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
GTTTTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
>C3
ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA
GTTCTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCACCAGCCGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG
GCATGATCAACTACGAGGAATTCGTTTGGATGATTAGCCAGAAG
>C4
ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTCGT
GCAGTTCGACAAGGAGGGAACCGGCAAGATAGCCACCCGTGAGCTGGGCA
CTTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAC
TTGATTGCTGAGGCCGACAACAACAGCAATGGCCAACTGGACTTCAGTGA
GTTCTGTGGCATTATGGCCAAGCAGATGCGCGAAACGGATACTGAGGAGG
AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCGCCAGCTGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC
CGACGAGGAGATCGACGAGATGATACGCGAGGCGGATTTTGATGGAGATG
GCATGATCAACTACGAGGAGTTCGTTTGGATGATAAGCCAGAAG
>C5
ATGTCGGAACTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTCGT
CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA
CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT
TTAATTGCCGATGCCGACAATAACAGCAATGGCCAACTGGACTTCACTGA
GTTCTGTGGTATCATGGCAAAGCAAATGCGTGAAACGGATACGGAGGAGG
AAATGCGGGAGGCTTTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA
TCACCAGCTGAGCTTCGCTTTGTAATGATTAATCTCGGCGAGAAGGTCAC
CGATGAAGAGATCGACGAGATGATACGCGAGGCTGATTTTGATGGGGATG
GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG
>C6
ATGTCCGAGCTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTTGT
GCAGTTCGATAAGGACGGAACCGGGAAGATAAACAGCCGTGAGTTGGGCA
CCTTGATGCGCACCCTTGGCCAGAATCCCTCGGAGGGCGAGCTGCAGGAC
CTGATGGCCGAGGTCGAGAACAACAGCGAGGGGCTACTGGACTTCAGTGA
GTTCTGTGCCATCATGGCCAAGCAGATGCGCGAAACCGATACCGAGGAGG
AGATGCGCGAGGCCTTTAAGATCTTCGATCGCGATGGGGATGGCTTTATA
TCGCCGGCTGAGCTCCGCTTTGTGATGATCAATCTGGGAGAAAAGGTCAC
CGACGAGGAGATCGACGAGATGATCCGCGAGGCCGATTTCGATGGCGACG
GTATGATCAACTACGAGGAGTTCGTCTGGATGATCAGCCAGAAG
>C1
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C2
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C3
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C4
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C5
MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
>C6
MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 444 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478931315
Setting output file names to "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1442698259
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 6977031477
Seed = 342288503
Swapseed = 1478931315
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 52 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1405.225762 -- -24.965149
Chain 2 -- -1356.074043 -- -24.965149
Chain 3 -- -1386.309770 -- -24.965149
Chain 4 -- -1406.723757 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1391.640676 -- -24.965149
Chain 2 -- -1372.697897 -- -24.965149
Chain 3 -- -1350.064742 -- -24.965149
Chain 4 -- -1384.100425 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1405.226] (-1356.074) (-1386.310) (-1406.724) * [-1391.641] (-1372.698) (-1350.065) (-1384.100)
500 -- (-1152.355) [-1154.883] (-1157.420) (-1151.673) * [-1132.267] (-1152.197) (-1158.459) (-1153.613) -- 0:00:00
1000 -- (-1138.930) [-1148.002] (-1150.916) (-1148.252) * [-1124.434] (-1142.814) (-1159.062) (-1146.987) -- 0:00:00
1500 -- (-1143.605) [-1141.882] (-1148.726) (-1135.175) * [-1117.493] (-1131.805) (-1152.266) (-1137.626) -- 0:00:00
2000 -- (-1135.121) [-1132.419] (-1155.477) (-1121.183) * [-1117.784] (-1121.915) (-1140.739) (-1123.078) -- 0:00:00
2500 -- (-1122.701) (-1132.821) (-1146.755) [-1119.765] * (-1113.303) [-1117.321] (-1138.671) (-1118.743) -- 0:06:39
3000 -- [-1118.572] (-1126.776) (-1147.572) (-1112.189) * (-1113.196) (-1122.169) [-1133.273] (-1120.137) -- 0:05:32
3500 -- [-1110.256] (-1129.690) (-1126.634) (-1111.358) * [-1117.623] (-1116.599) (-1138.706) (-1115.337) -- 0:04:44
4000 -- [-1113.451] (-1115.561) (-1138.056) (-1110.200) * [-1115.139] (-1120.179) (-1124.107) (-1114.380) -- 0:04:09
4500 -- [-1110.743] (-1117.858) (-1126.899) (-1120.842) * (-1120.338) (-1118.653) (-1131.861) [-1121.962] -- 0:03:41
5000 -- (-1117.436) (-1117.077) [-1115.299] (-1116.790) * (-1116.929) (-1124.972) (-1127.555) [-1107.907] -- 0:03:19
Average standard deviation of split frequencies: 0.062854
5500 -- (-1113.903) (-1125.315) [-1115.470] (-1126.596) * [-1115.076] (-1118.928) (-1122.222) (-1110.316) -- 0:03:00
6000 -- (-1116.319) [-1113.823] (-1114.566) (-1118.500) * [-1115.135] (-1118.710) (-1128.535) (-1112.859) -- 0:02:45
6500 -- [-1115.338] (-1113.911) (-1111.578) (-1118.993) * [-1111.713] (-1113.184) (-1132.039) (-1114.045) -- 0:02:32
7000 -- (-1112.977) (-1118.851) [-1118.933] (-1114.515) * (-1112.527) (-1113.591) [-1121.922] (-1113.127) -- 0:02:21
7500 -- [-1112.099] (-1111.916) (-1111.901) (-1113.861) * (-1119.175) [-1112.639] (-1123.627) (-1112.730) -- 0:02:12
8000 -- (-1112.957) (-1121.341) (-1115.196) [-1111.403] * (-1116.891) (-1112.325) (-1122.875) [-1111.571] -- 0:04:08
8500 -- [-1109.645] (-1117.004) (-1116.275) (-1118.349) * (-1114.246) [-1121.146] (-1120.584) (-1113.173) -- 0:03:53
9000 -- [-1113.832] (-1112.030) (-1120.503) (-1111.367) * [-1115.274] (-1118.273) (-1122.403) (-1111.693) -- 0:03:40
9500 -- (-1113.404) (-1116.923) (-1118.086) [-1111.748] * (-1113.177) [-1115.166] (-1118.570) (-1114.433) -- 0:03:28
10000 -- [-1108.278] (-1111.561) (-1113.758) (-1109.532) * [-1114.859] (-1123.066) (-1120.857) (-1118.028) -- 0:03:18
Average standard deviation of split frequencies: 0.079550
10500 -- [-1117.705] (-1118.580) (-1114.316) (-1108.520) * (-1120.304) [-1118.062] (-1117.020) (-1114.900) -- 0:03:08
11000 -- (-1117.679) [-1112.402] (-1110.891) (-1115.916) * (-1121.901) (-1115.742) [-1117.542] (-1115.874) -- 0:02:59
11500 -- (-1119.789) (-1112.932) [-1115.287] (-1123.926) * (-1114.623) (-1122.886) [-1111.461] (-1119.909) -- 0:02:51
12000 -- [-1109.421] (-1114.196) (-1117.090) (-1112.969) * (-1111.825) (-1115.600) [-1111.676] (-1114.045) -- 0:02:44
12500 -- (-1113.015) [-1116.354] (-1111.060) (-1116.083) * (-1109.206) (-1115.658) (-1116.128) [-1118.453] -- 0:02:38
13000 -- (-1116.331) (-1124.255) (-1113.522) [-1110.406] * (-1116.323) (-1126.248) [-1111.983] (-1111.625) -- 0:03:47
13500 -- (-1116.785) (-1121.224) (-1112.508) [-1115.355] * (-1123.796) (-1115.048) [-1112.050] (-1114.346) -- 0:03:39
14000 -- [-1114.661] (-1124.114) (-1108.401) (-1115.749) * (-1114.984) (-1116.653) (-1115.032) [-1112.820] -- 0:03:31
14500 -- [-1113.981] (-1116.167) (-1111.345) (-1113.857) * (-1111.747) (-1116.898) (-1111.068) [-1115.372] -- 0:03:23
15000 -- (-1119.403) [-1116.805] (-1114.174) (-1121.496) * (-1111.600) [-1126.311] (-1122.481) (-1123.172) -- 0:03:17
Average standard deviation of split frequencies: 0.051560
15500 -- (-1112.619) (-1117.699) (-1120.698) [-1120.675] * (-1114.415) [-1114.152] (-1116.999) (-1118.591) -- 0:03:10
16000 -- (-1119.093) (-1113.655) (-1116.287) [-1120.636] * [-1114.807] (-1118.005) (-1115.503) (-1121.746) -- 0:03:04
16500 -- (-1118.623) [-1110.918] (-1113.828) (-1118.970) * (-1118.960) [-1119.211] (-1114.258) (-1125.036) -- 0:02:58
17000 -- (-1116.196) (-1110.406) [-1116.756] (-1121.105) * (-1119.053) (-1117.775) (-1114.132) [-1117.970] -- 0:02:53
17500 -- (-1118.629) (-1115.705) (-1112.113) [-1118.996] * (-1118.861) (-1126.224) (-1122.835) [-1114.321] -- 0:02:48
18000 -- (-1115.815) (-1114.600) (-1120.331) [-1118.665] * (-1115.052) (-1117.581) [-1110.418] (-1114.269) -- 0:02:43
18500 -- [-1117.346] (-1114.773) (-1113.531) (-1123.268) * (-1115.106) (-1114.259) (-1118.778) [-1115.389] -- 0:03:32
19000 -- [-1110.659] (-1113.464) (-1118.235) (-1116.968) * [-1115.380] (-1123.404) (-1113.035) (-1122.748) -- 0:03:26
19500 -- (-1116.303) (-1113.669) (-1114.005) [-1116.395] * (-1112.811) (-1118.661) (-1124.144) [-1116.629] -- 0:03:21
20000 -- (-1121.634) (-1115.796) [-1110.257] (-1116.299) * (-1115.646) (-1117.166) [-1110.745] (-1121.804) -- 0:03:16
Average standard deviation of split frequencies: 0.022810
20500 -- [-1114.749] (-1117.684) (-1112.371) (-1114.531) * [-1113.029] (-1114.351) (-1110.004) (-1116.323) -- 0:03:11
21000 -- [-1118.880] (-1114.057) (-1114.328) (-1114.361) * (-1115.970) (-1126.838) (-1113.484) [-1114.872] -- 0:03:06
21500 -- (-1122.340) (-1113.576) [-1112.892] (-1110.844) * [-1119.116] (-1120.655) (-1113.862) (-1113.681) -- 0:03:02
22000 -- [-1123.272] (-1111.955) (-1115.205) (-1118.077) * (-1119.462) (-1118.813) (-1114.305) [-1109.758] -- 0:02:57
22500 -- [-1113.785] (-1111.206) (-1114.652) (-1117.279) * (-1121.913) (-1119.665) (-1116.825) [-1113.249] -- 0:02:53
23000 -- (-1114.303) [-1108.833] (-1112.816) (-1120.057) * (-1114.146) (-1116.578) [-1111.991] (-1115.547) -- 0:02:49
23500 -- (-1117.472) (-1110.102) (-1122.648) [-1113.201] * [-1114.153] (-1121.047) (-1109.305) (-1111.686) -- 0:03:27
24000 -- (-1117.703) [-1111.106] (-1120.663) (-1114.824) * (-1119.446) [-1113.938] (-1115.398) (-1114.549) -- 0:03:23
24500 -- (-1118.540) (-1117.487) (-1112.942) [-1111.029] * (-1110.639) [-1109.911] (-1115.331) (-1112.169) -- 0:03:19
25000 -- [-1108.925] (-1114.815) (-1112.543) (-1114.858) * [-1108.525] (-1115.651) (-1122.180) (-1114.567) -- 0:03:15
Average standard deviation of split frequencies: 0.018131
25500 -- [-1118.147] (-1112.981) (-1112.885) (-1118.071) * (-1111.370) (-1113.946) (-1119.882) [-1110.939] -- 0:03:11
26000 -- (-1113.666) (-1112.619) [-1114.433] (-1114.870) * [-1114.828] (-1110.067) (-1109.978) (-1113.691) -- 0:03:07
26500 -- (-1115.517) (-1115.192) (-1113.378) [-1115.511] * [-1118.430] (-1111.005) (-1116.931) (-1114.831) -- 0:03:03
27000 -- (-1118.473) (-1111.713) [-1115.824] (-1116.043) * (-1118.378) (-1119.472) [-1113.817] (-1112.602) -- 0:03:00
27500 -- (-1114.370) (-1114.252) [-1117.266] (-1118.921) * (-1121.154) (-1113.809) [-1112.667] (-1115.578) -- 0:02:56
28000 -- [-1110.514] (-1112.107) (-1118.336) (-1123.078) * (-1119.649) (-1113.168) [-1117.593] (-1112.696) -- 0:02:53
28500 -- [-1115.697] (-1115.558) (-1121.915) (-1115.376) * (-1115.211) (-1112.233) (-1119.462) [-1116.771] -- 0:02:50
29000 -- (-1119.232) (-1115.273) (-1120.717) [-1117.307] * (-1113.183) (-1118.237) [-1119.103] (-1112.523) -- 0:03:20
29500 -- (-1123.385) [-1111.185] (-1112.839) (-1116.743) * (-1117.648) (-1108.060) [-1116.577] (-1112.810) -- 0:03:17
30000 -- (-1119.895) (-1113.411) [-1114.760] (-1127.108) * [-1119.128] (-1115.660) (-1127.180) (-1120.741) -- 0:03:14
Average standard deviation of split frequencies: 0.020496
30500 -- (-1119.958) [-1114.504] (-1120.454) (-1124.364) * (-1123.075) [-1114.896] (-1123.156) (-1110.314) -- 0:03:10
31000 -- [-1112.503] (-1114.500) (-1119.476) (-1118.757) * (-1127.298) (-1117.965) [-1116.418] (-1113.983) -- 0:03:07
31500 -- [-1113.733] (-1113.036) (-1119.195) (-1114.971) * (-1118.584) [-1115.746] (-1116.590) (-1127.512) -- 0:03:04
32000 -- (-1119.151) [-1110.964] (-1115.802) (-1114.133) * [-1113.088] (-1111.655) (-1110.720) (-1114.838) -- 0:03:01
32500 -- [-1112.858] (-1111.687) (-1115.828) (-1117.773) * [-1114.591] (-1114.222) (-1116.659) (-1117.124) -- 0:02:58
33000 -- [-1113.093] (-1118.783) (-1121.935) (-1114.633) * [-1112.458] (-1113.178) (-1121.092) (-1119.368) -- 0:02:55
33500 -- (-1124.770) [-1114.605] (-1117.600) (-1125.859) * (-1124.680) (-1115.685) (-1109.663) [-1113.229] -- 0:02:53
34000 -- (-1110.630) (-1115.191) [-1114.087] (-1118.363) * (-1116.578) [-1113.096] (-1108.812) (-1115.473) -- 0:03:18
34500 -- (-1118.510) (-1119.681) [-1123.758] (-1116.959) * (-1109.811) (-1112.815) [-1114.134] (-1116.297) -- 0:03:15
35000 -- [-1118.526] (-1119.758) (-1116.670) (-1124.171) * [-1118.295] (-1117.843) (-1117.650) (-1114.105) -- 0:03:13
Average standard deviation of split frequencies: 0.013095
35500 -- (-1111.473) (-1114.502) [-1114.612] (-1117.956) * (-1116.822) [-1113.995] (-1117.587) (-1113.640) -- 0:03:10
36000 -- [-1110.588] (-1115.065) (-1117.766) (-1121.358) * (-1113.554) [-1110.109] (-1113.212) (-1119.185) -- 0:03:07
36500 -- (-1108.565) [-1111.539] (-1125.483) (-1113.432) * [-1114.864] (-1112.195) (-1119.338) (-1122.040) -- 0:03:04
37000 -- (-1114.978) (-1115.043) [-1118.710] (-1116.295) * (-1115.728) (-1121.052) (-1111.149) [-1111.553] -- 0:03:02
37500 -- (-1110.337) [-1118.766] (-1129.968) (-1118.112) * (-1111.924) (-1112.764) (-1116.453) [-1111.668] -- 0:02:59
38000 -- (-1113.836) (-1114.394) [-1118.612] (-1114.553) * [-1113.367] (-1116.773) (-1113.913) (-1116.773) -- 0:02:57
38500 -- (-1119.190) (-1117.643) (-1123.075) [-1108.522] * (-1116.248) [-1116.413] (-1114.311) (-1115.002) -- 0:02:54
39000 -- (-1117.464) (-1115.459) [-1120.851] (-1114.655) * (-1107.567) [-1116.379] (-1120.204) (-1116.566) -- 0:02:52
39500 -- (-1117.435) (-1124.268) (-1119.098) [-1118.954] * (-1110.004) (-1123.884) [-1111.210] (-1114.478) -- 0:03:14
40000 -- (-1116.383) [-1111.919] (-1117.980) (-1117.515) * [-1118.425] (-1117.877) (-1115.455) (-1114.823) -- 0:03:12
Average standard deviation of split frequencies: 0.015456
40500 -- (-1111.970) (-1111.054) (-1119.413) [-1108.447] * (-1116.679) [-1113.768] (-1120.880) (-1110.076) -- 0:03:09
41000 -- (-1111.679) (-1113.395) [-1118.950] (-1110.368) * (-1111.139) [-1116.728] (-1117.198) (-1111.316) -- 0:03:07
41500 -- [-1115.112] (-1116.083) (-1122.204) (-1109.876) * (-1113.271) (-1120.072) [-1114.640] (-1119.589) -- 0:03:04
42000 -- [-1112.722] (-1121.175) (-1126.095) (-1116.138) * (-1120.335) (-1117.417) [-1113.526] (-1114.022) -- 0:03:02
42500 -- [-1117.305] (-1118.291) (-1121.031) (-1117.623) * [-1116.280] (-1113.140) (-1128.975) (-1116.378) -- 0:03:00
43000 -- (-1114.525) [-1113.469] (-1119.402) (-1111.159) * [-1113.023] (-1113.368) (-1118.945) (-1113.190) -- 0:02:58
43500 -- (-1112.515) (-1117.743) [-1113.015] (-1110.783) * (-1118.855) [-1111.276] (-1122.483) (-1116.600) -- 0:02:55
44000 -- [-1111.458] (-1116.032) (-1118.890) (-1116.956) * (-1119.440) (-1110.844) [-1114.699] (-1112.949) -- 0:02:53
44500 -- (-1112.478) [-1110.745] (-1113.081) (-1116.665) * (-1109.250) (-1113.495) (-1121.016) [-1114.703] -- 0:02:51
45000 -- (-1121.808) (-1116.165) (-1113.365) [-1115.618] * (-1115.674) (-1116.296) (-1112.912) [-1115.506] -- 0:03:11
Average standard deviation of split frequencies: 0.010248
45500 -- (-1120.289) [-1108.507] (-1112.789) (-1114.889) * [-1109.937] (-1114.831) (-1115.829) (-1115.878) -- 0:03:08
46000 -- (-1108.207) [-1111.610] (-1116.266) (-1117.726) * [-1115.284] (-1117.923) (-1108.211) (-1124.982) -- 0:03:06
46500 -- (-1115.049) (-1119.511) (-1112.658) [-1110.338] * (-1113.077) (-1117.622) [-1110.781] (-1118.150) -- 0:03:04
47000 -- [-1115.789] (-1114.584) (-1113.983) (-1122.825) * (-1119.808) (-1113.339) [-1111.797] (-1114.374) -- 0:03:02
47500 -- [-1106.546] (-1111.951) (-1119.925) (-1117.101) * [-1120.027] (-1114.694) (-1114.510) (-1118.648) -- 0:03:00
48000 -- [-1112.761] (-1117.226) (-1120.654) (-1109.875) * (-1112.941) [-1119.258] (-1118.264) (-1116.322) -- 0:02:58
48500 -- (-1110.912) (-1120.667) (-1127.454) [-1111.269] * (-1119.075) (-1117.330) (-1111.654) [-1111.590] -- 0:02:56
49000 -- [-1113.784] (-1124.942) (-1113.183) (-1113.394) * (-1112.720) [-1111.372] (-1116.016) (-1118.284) -- 0:02:54
49500 -- (-1112.364) (-1122.238) [-1113.067] (-1113.048) * [-1116.704] (-1112.849) (-1112.162) (-1113.779) -- 0:02:52
50000 -- [-1113.654] (-1121.841) (-1118.802) (-1113.019) * (-1115.755) (-1125.173) (-1111.402) [-1113.822] -- 0:03:10
Average standard deviation of split frequencies: 0.009304
50500 -- [-1113.712] (-1113.879) (-1109.994) (-1116.704) * (-1113.622) [-1110.695] (-1114.265) (-1117.279) -- 0:03:08
51000 -- [-1120.126] (-1123.143) (-1111.247) (-1115.698) * (-1112.319) (-1111.459) [-1112.965] (-1113.145) -- 0:03:06
51500 -- (-1120.845) [-1117.336] (-1115.472) (-1123.415) * (-1122.622) (-1114.593) (-1118.764) [-1111.951] -- 0:03:04
52000 -- (-1113.698) (-1120.834) [-1113.117] (-1113.643) * [-1113.228] (-1109.859) (-1115.915) (-1112.999) -- 0:03:02
52500 -- (-1123.748) (-1123.809) [-1110.632] (-1109.959) * (-1115.435) (-1117.557) (-1117.397) [-1113.435] -- 0:03:00
53000 -- (-1122.351) (-1118.641) (-1115.237) [-1115.920] * (-1113.846) [-1108.701] (-1112.944) (-1122.501) -- 0:02:58
53500 -- (-1115.352) (-1116.498) (-1125.132) [-1112.537] * (-1110.128) [-1114.456] (-1109.685) (-1122.661) -- 0:02:56
54000 -- (-1117.698) (-1116.675) (-1120.959) [-1114.966] * [-1114.336] (-1113.197) (-1124.438) (-1122.188) -- 0:02:55
54500 -- (-1115.260) [-1111.238] (-1119.999) (-1111.962) * (-1112.732) (-1111.267) (-1122.547) [-1110.109] -- 0:02:53
55000 -- [-1111.441] (-1115.921) (-1119.110) (-1112.070) * (-1123.097) (-1107.784) (-1117.291) [-1110.088] -- 0:02:51
Average standard deviation of split frequencies: 0.016836
55500 -- [-1113.802] (-1118.217) (-1123.268) (-1114.200) * (-1115.660) (-1112.892) (-1116.988) [-1109.606] -- 0:03:07
56000 -- [-1114.068] (-1120.094) (-1117.873) (-1112.456) * [-1111.533] (-1110.287) (-1110.313) (-1109.488) -- 0:03:05
56500 -- [-1113.110] (-1113.593) (-1114.047) (-1110.346) * (-1116.516) (-1110.103) [-1108.868] (-1111.247) -- 0:03:03
57000 -- (-1113.478) (-1117.519) (-1112.952) [-1113.028] * (-1116.024) [-1113.221] (-1117.488) (-1110.870) -- 0:03:01
57500 -- [-1118.385] (-1115.772) (-1109.444) (-1112.947) * (-1117.332) (-1110.365) [-1110.515] (-1112.900) -- 0:03:00
58000 -- (-1118.156) [-1111.415] (-1111.268) (-1120.629) * (-1111.412) [-1114.897] (-1126.345) (-1117.789) -- 0:02:58
58500 -- (-1114.940) [-1114.528] (-1115.575) (-1110.339) * (-1118.277) (-1115.335) (-1115.061) [-1106.396] -- 0:02:57
59000 -- (-1112.923) (-1112.926) (-1116.519) [-1112.786] * [-1119.931] (-1113.246) (-1122.717) (-1112.001) -- 0:02:55
59500 -- [-1110.708] (-1119.335) (-1113.011) (-1118.974) * (-1112.431) (-1120.307) [-1115.202] (-1109.765) -- 0:02:53
60000 -- [-1113.486] (-1115.113) (-1115.976) (-1112.636) * [-1117.725] (-1113.592) (-1113.131) (-1113.299) -- 0:02:52
Average standard deviation of split frequencies: 0.015541
60500 -- (-1119.308) [-1112.979] (-1112.822) (-1114.204) * (-1109.423) (-1110.720) [-1116.900] (-1119.578) -- 0:03:06
61000 -- (-1117.283) (-1113.521) (-1119.476) [-1112.778] * (-1114.018) [-1111.965] (-1122.207) (-1109.994) -- 0:03:04
61500 -- (-1121.830) (-1119.808) [-1112.515] (-1114.302) * (-1116.260) [-1114.116] (-1123.506) (-1109.344) -- 0:03:03
62000 -- [-1120.156] (-1114.486) (-1119.520) (-1112.394) * (-1115.186) (-1113.165) (-1116.871) [-1111.979] -- 0:03:01
62500 -- [-1112.779] (-1123.181) (-1120.452) (-1119.650) * (-1122.778) (-1115.967) [-1116.836] (-1110.843) -- 0:03:00
63000 -- (-1119.656) (-1122.715) (-1115.276) [-1118.479] * (-1112.245) (-1117.657) [-1118.481] (-1111.061) -- 0:02:58
63500 -- (-1117.417) (-1109.203) (-1114.630) [-1115.874] * (-1118.708) [-1112.592] (-1121.581) (-1109.460) -- 0:02:56
64000 -- (-1115.837) (-1110.151) [-1112.846] (-1116.603) * (-1115.072) (-1123.071) (-1115.418) [-1116.199] -- 0:02:55
64500 -- [-1117.091] (-1112.774) (-1110.269) (-1115.797) * (-1118.409) (-1114.093) (-1115.804) [-1111.409] -- 0:02:54
65000 -- (-1116.750) (-1114.227) (-1110.974) [-1116.923] * (-1120.965) (-1113.859) (-1115.620) [-1114.593] -- 0:02:52
Average standard deviation of split frequencies: 0.019047
65500 -- [-1116.917] (-1116.217) (-1117.093) (-1118.695) * (-1118.860) (-1113.028) [-1118.933] (-1117.788) -- 0:02:51
66000 -- (-1117.642) (-1108.990) (-1110.025) [-1117.850] * (-1115.133) (-1117.279) [-1110.647] (-1116.708) -- 0:03:03
66500 -- [-1114.507] (-1118.051) (-1121.236) (-1121.257) * (-1121.836) [-1115.654] (-1115.553) (-1116.527) -- 0:03:02
67000 -- (-1116.116) (-1121.913) [-1117.965] (-1119.886) * (-1116.903) (-1118.980) (-1113.723) [-1109.491] -- 0:03:01
67500 -- [-1115.552] (-1113.760) (-1112.470) (-1117.158) * (-1119.149) (-1118.605) [-1119.194] (-1125.327) -- 0:02:59
68000 -- (-1115.711) (-1115.937) (-1113.528) [-1114.459] * [-1115.754] (-1117.740) (-1110.901) (-1114.462) -- 0:02:58
68500 -- [-1114.266] (-1115.222) (-1110.629) (-1115.758) * [-1113.419] (-1119.430) (-1111.022) (-1115.918) -- 0:02:56
69000 -- (-1119.349) [-1116.993] (-1112.885) (-1118.840) * (-1116.341) (-1113.270) (-1113.135) [-1119.194] -- 0:02:55
69500 -- (-1125.737) (-1109.341) (-1112.747) [-1115.258] * (-1118.387) [-1114.412] (-1118.304) (-1114.047) -- 0:02:54
70000 -- (-1116.057) [-1114.116] (-1117.658) (-1111.447) * (-1119.970) [-1112.840] (-1120.914) (-1110.246) -- 0:02:52
Average standard deviation of split frequencies: 0.020012
70500 -- (-1109.480) [-1115.649] (-1119.802) (-1114.361) * [-1114.005] (-1112.319) (-1118.998) (-1116.250) -- 0:02:51
71000 -- [-1114.768] (-1113.332) (-1120.332) (-1108.690) * (-1119.088) (-1118.154) [-1110.394] (-1109.656) -- 0:03:03
71500 -- (-1113.027) (-1117.779) [-1111.274] (-1113.869) * (-1115.060) (-1117.797) [-1108.308] (-1112.422) -- 0:03:01
72000 -- [-1117.442] (-1106.741) (-1113.832) (-1110.994) * (-1121.128) [-1113.847] (-1111.850) (-1113.862) -- 0:03:00
72500 -- (-1116.283) (-1116.562) [-1112.617] (-1123.140) * (-1119.880) (-1114.110) (-1118.320) [-1115.078] -- 0:02:59
73000 -- [-1112.652] (-1113.481) (-1118.742) (-1119.174) * (-1115.735) [-1112.866] (-1115.424) (-1113.542) -- 0:02:57
73500 -- (-1116.544) (-1115.455) (-1108.764) [-1117.546] * (-1116.663) (-1124.282) [-1118.667] (-1110.630) -- 0:02:56
74000 -- [-1112.210] (-1111.215) (-1111.643) (-1120.345) * (-1107.441) (-1128.950) [-1116.680] (-1115.025) -- 0:02:55
74500 -- (-1112.068) [-1110.271] (-1113.345) (-1116.858) * [-1109.726] (-1126.376) (-1118.135) (-1109.491) -- 0:02:53
75000 -- (-1111.918) (-1109.260) (-1115.636) [-1118.928] * (-1120.001) [-1120.334] (-1113.020) (-1112.867) -- 0:02:52
Average standard deviation of split frequencies: 0.016541
75500 -- (-1116.360) (-1110.562) [-1117.826] (-1123.224) * (-1116.853) [-1116.520] (-1119.577) (-1122.661) -- 0:02:51
76000 -- (-1117.391) (-1110.217) (-1119.237) [-1120.153] * (-1115.462) [-1112.150] (-1116.916) (-1120.936) -- 0:02:50
76500 -- (-1114.306) [-1119.112] (-1115.286) (-1117.559) * (-1114.644) (-1116.940) [-1112.547] (-1119.996) -- 0:03:01
77000 -- (-1118.113) [-1115.762] (-1111.818) (-1121.328) * (-1114.696) (-1121.120) (-1118.014) [-1114.677] -- 0:02:59
77500 -- (-1119.451) (-1119.665) [-1115.788] (-1116.924) * [-1111.584] (-1117.353) (-1117.779) (-1115.009) -- 0:02:58
78000 -- [-1109.647] (-1122.683) (-1117.037) (-1113.282) * [-1108.646] (-1118.368) (-1117.128) (-1115.308) -- 0:02:57
78500 -- (-1122.699) (-1115.436) [-1112.756] (-1123.678) * (-1112.501) (-1119.849) [-1112.328] (-1110.687) -- 0:02:56
79000 -- (-1118.930) (-1112.019) [-1114.462] (-1111.556) * [-1110.622] (-1112.871) (-1113.738) (-1108.985) -- 0:02:54
79500 -- (-1114.867) (-1112.362) (-1117.916) [-1109.379] * (-1118.249) (-1114.743) (-1112.446) [-1112.394] -- 0:02:53
80000 -- (-1112.499) [-1111.299] (-1111.683) (-1115.890) * (-1116.444) (-1114.500) [-1118.910] (-1118.902) -- 0:02:52
Average standard deviation of split frequencies: 0.015584
80500 -- (-1119.138) (-1117.671) (-1110.463) [-1111.445] * (-1112.242) (-1111.633) [-1112.392] (-1115.749) -- 0:02:51
81000 -- (-1124.072) (-1116.217) (-1115.669) [-1110.122] * [-1112.028] (-1108.853) (-1120.336) (-1120.759) -- 0:02:50
81500 -- (-1119.362) (-1114.408) (-1113.180) [-1117.540] * (-1117.974) (-1121.940) [-1115.853] (-1113.666) -- 0:03:00
82000 -- (-1118.611) (-1113.000) [-1113.735] (-1121.561) * (-1118.980) [-1118.672] (-1115.913) (-1114.011) -- 0:02:59
82500 -- (-1116.706) (-1113.615) [-1112.329] (-1127.176) * (-1113.585) [-1109.946] (-1117.067) (-1115.575) -- 0:02:57
83000 -- (-1120.259) (-1112.406) [-1114.140] (-1123.855) * (-1122.852) [-1114.233] (-1113.283) (-1114.252) -- 0:02:56
83500 -- (-1112.578) (-1112.703) [-1114.102] (-1111.651) * (-1121.511) [-1108.370] (-1114.376) (-1120.884) -- 0:02:55
84000 -- [-1108.100] (-1117.850) (-1114.446) (-1112.455) * (-1112.128) (-1112.210) [-1113.829] (-1107.222) -- 0:02:54
84500 -- (-1117.521) (-1114.768) [-1115.594] (-1114.620) * [-1110.327] (-1114.471) (-1119.707) (-1119.199) -- 0:02:53
85000 -- [-1113.861] (-1107.604) (-1118.166) (-1112.968) * (-1115.177) [-1112.416] (-1118.747) (-1112.985) -- 0:02:52
Average standard deviation of split frequencies: 0.014617
85500 -- (-1114.585) (-1113.536) (-1118.041) [-1108.729] * (-1110.805) (-1115.660) (-1115.808) [-1112.826] -- 0:02:51
86000 -- [-1110.968] (-1112.737) (-1111.842) (-1117.553) * [-1111.792] (-1118.203) (-1115.940) (-1118.950) -- 0:02:50
86500 -- (-1114.789) (-1113.833) (-1115.240) [-1111.888] * (-1111.127) [-1112.606] (-1129.382) (-1119.310) -- 0:02:59
87000 -- (-1113.544) (-1117.244) (-1121.765) [-1110.353] * [-1119.809] (-1109.876) (-1127.775) (-1128.969) -- 0:02:58
87500 -- (-1120.518) (-1120.041) (-1114.563) [-1117.038] * (-1115.727) (-1114.292) (-1128.499) [-1113.170] -- 0:02:57
88000 -- [-1120.278] (-1113.901) (-1114.049) (-1119.310) * (-1118.813) [-1113.283] (-1124.835) (-1118.979) -- 0:02:56
88500 -- (-1129.204) (-1115.665) (-1117.305) [-1111.783] * (-1118.818) [-1114.399] (-1121.697) (-1115.426) -- 0:02:55
89000 -- (-1128.706) (-1119.736) [-1111.737] (-1116.985) * (-1111.915) [-1113.167] (-1122.868) (-1109.631) -- 0:02:54
89500 -- (-1120.652) (-1116.087) [-1107.747] (-1119.164) * (-1113.626) [-1115.865] (-1120.431) (-1118.973) -- 0:02:52
90000 -- (-1115.103) [-1115.270] (-1114.751) (-1118.300) * (-1117.878) [-1113.359] (-1119.849) (-1116.457) -- 0:02:51
Average standard deviation of split frequencies: 0.015598
90500 -- (-1115.528) (-1113.754) [-1116.238] (-1115.114) * (-1120.135) [-1114.029] (-1115.029) (-1115.797) -- 0:02:50
91000 -- (-1114.309) (-1119.463) (-1122.061) [-1113.871] * (-1116.606) [-1113.227] (-1116.876) (-1110.905) -- 0:02:49
91500 -- [-1115.960] (-1117.016) (-1119.286) (-1112.107) * (-1120.914) (-1115.254) [-1110.630] (-1115.697) -- 0:02:48
92000 -- (-1124.634) (-1115.873) (-1113.670) [-1122.331] * (-1122.612) (-1117.080) (-1111.215) [-1110.076] -- 0:02:57
92500 -- [-1114.488] (-1113.613) (-1115.855) (-1117.642) * (-1124.478) (-1114.083) [-1111.368] (-1114.969) -- 0:02:56
93000 -- (-1115.113) [-1112.349] (-1121.657) (-1115.175) * (-1114.382) [-1118.432] (-1115.004) (-1114.659) -- 0:02:55
93500 -- (-1114.666) [-1110.943] (-1119.927) (-1116.110) * (-1118.388) (-1113.145) (-1113.828) [-1114.288] -- 0:02:54
94000 -- (-1116.708) (-1110.438) (-1118.932) [-1108.982] * [-1116.860] (-1114.576) (-1111.540) (-1111.874) -- 0:02:53
94500 -- (-1120.360) [-1116.291] (-1134.301) (-1109.135) * (-1116.886) [-1115.893] (-1119.031) (-1115.711) -- 0:02:52
95000 -- (-1120.212) (-1116.472) [-1117.728] (-1119.752) * (-1112.301) (-1121.750) (-1117.979) [-1110.677] -- 0:02:51
Average standard deviation of split frequencies: 0.014731
95500 -- [-1112.301] (-1109.931) (-1117.268) (-1119.722) * [-1113.018] (-1121.516) (-1113.901) (-1114.014) -- 0:02:50
96000 -- (-1113.524) (-1112.054) (-1118.139) [-1117.922] * (-1116.337) (-1115.002) (-1116.278) [-1113.931] -- 0:02:49
96500 -- (-1113.512) (-1108.352) (-1125.163) [-1118.124] * (-1109.689) (-1113.569) (-1114.055) [-1114.024] -- 0:02:48
97000 -- (-1115.098) [-1111.724] (-1124.150) (-1116.084) * (-1120.119) (-1128.261) [-1115.458] (-1118.955) -- 0:02:56
97500 -- (-1111.005) [-1110.424] (-1120.432) (-1116.917) * [-1118.626] (-1119.684) (-1117.951) (-1113.564) -- 0:02:55
98000 -- (-1116.541) (-1115.881) [-1117.018] (-1113.112) * (-1115.309) (-1120.531) [-1116.765] (-1115.581) -- 0:02:54
98500 -- (-1119.228) (-1119.577) [-1119.837] (-1114.447) * [-1109.396] (-1112.423) (-1114.176) (-1121.760) -- 0:02:53
99000 -- (-1112.851) [-1113.586] (-1125.306) (-1118.247) * [-1112.391] (-1113.461) (-1111.287) (-1121.842) -- 0:02:52
99500 -- (-1111.834) (-1112.152) [-1117.879] (-1117.101) * (-1113.518) (-1122.770) [-1107.787] (-1117.348) -- 0:02:51
100000 -- (-1111.289) [-1115.549] (-1122.549) (-1118.168) * (-1113.501) (-1110.639) (-1111.891) [-1114.319] -- 0:02:51
Average standard deviation of split frequencies: 0.014048
100500 -- (-1116.792) [-1116.028] (-1120.133) (-1115.908) * (-1121.558) (-1114.157) [-1113.566] (-1111.636) -- 0:02:50
101000 -- (-1116.747) (-1113.112) [-1118.153] (-1117.352) * (-1112.890) (-1113.792) [-1114.774] (-1112.087) -- 0:02:49
101500 -- (-1119.080) (-1119.984) (-1117.389) [-1112.585] * (-1119.314) [-1117.338] (-1109.564) (-1122.902) -- 0:02:48
102000 -- (-1116.830) (-1109.160) (-1118.109) [-1113.096] * (-1108.944) [-1113.879] (-1116.758) (-1108.943) -- 0:02:56
102500 -- [-1114.025] (-1117.107) (-1112.129) (-1114.812) * (-1112.801) (-1121.161) (-1113.960) [-1108.883] -- 0:02:55
103000 -- (-1114.335) (-1112.863) (-1115.951) [-1114.828] * (-1115.802) (-1118.038) (-1113.520) [-1110.385] -- 0:02:54
103500 -- [-1117.437] (-1119.854) (-1122.766) (-1112.366) * (-1115.170) (-1115.301) [-1116.017] (-1113.288) -- 0:02:53
104000 -- (-1116.115) [-1111.463] (-1117.935) (-1116.785) * (-1111.820) (-1116.356) (-1117.347) [-1107.531] -- 0:02:52
104500 -- (-1113.297) (-1116.202) (-1118.985) [-1114.909] * (-1113.950) (-1114.053) [-1112.195] (-1110.488) -- 0:02:51
105000 -- (-1114.576) (-1116.990) (-1111.672) [-1110.519] * (-1111.220) (-1121.024) [-1113.521] (-1119.662) -- 0:02:50
Average standard deviation of split frequencies: 0.014824
105500 -- (-1109.811) [-1114.042] (-1112.968) (-1122.646) * (-1116.601) (-1116.973) (-1113.782) [-1113.927] -- 0:02:49
106000 -- (-1118.579) (-1109.417) [-1117.783] (-1116.727) * (-1116.950) [-1107.949] (-1112.370) (-1119.921) -- 0:02:48
106500 -- (-1113.799) (-1120.706) (-1116.076) [-1117.387] * (-1119.060) [-1115.420] (-1114.308) (-1121.690) -- 0:02:47
107000 -- [-1116.199] (-1119.265) (-1118.101) (-1112.701) * (-1111.320) [-1112.767] (-1116.970) (-1120.415) -- 0:02:46
107500 -- (-1114.397) (-1115.033) (-1116.219) [-1113.199] * (-1117.094) [-1110.916] (-1112.582) (-1114.082) -- 0:02:54
108000 -- (-1115.198) [-1112.170] (-1112.859) (-1113.103) * (-1113.880) (-1118.523) [-1115.827] (-1118.515) -- 0:02:53
108500 -- (-1115.329) (-1115.529) [-1114.332] (-1116.796) * (-1121.976) (-1109.752) [-1112.582] (-1111.542) -- 0:02:52
109000 -- (-1117.113) (-1116.043) [-1113.822] (-1112.449) * (-1117.473) [-1110.849] (-1116.323) (-1111.575) -- 0:02:51
109500 -- (-1112.287) (-1117.033) [-1110.152] (-1112.532) * (-1128.166) [-1114.802] (-1113.832) (-1112.478) -- 0:02:50
110000 -- (-1115.440) (-1117.700) (-1112.032) [-1108.663] * (-1125.847) [-1110.927] (-1112.648) (-1117.107) -- 0:02:49
Average standard deviation of split frequencies: 0.012779
110500 -- (-1114.168) (-1110.593) [-1116.552] (-1118.563) * (-1125.406) (-1109.479) [-1111.768] (-1115.657) -- 0:02:49
111000 -- (-1113.269) [-1112.693] (-1116.231) (-1113.831) * (-1109.556) (-1112.562) [-1112.019] (-1111.846) -- 0:02:48
111500 -- (-1113.859) (-1116.966) (-1114.634) [-1113.899] * [-1111.623] (-1108.869) (-1117.998) (-1112.628) -- 0:02:47
112000 -- (-1117.726) (-1113.484) (-1119.831) [-1112.603] * (-1111.376) [-1109.412] (-1117.250) (-1112.770) -- 0:02:46
112500 -- (-1116.690) (-1116.967) (-1125.680) [-1111.044] * (-1114.357) [-1115.096] (-1113.179) (-1111.176) -- 0:02:53
113000 -- (-1117.526) (-1110.924) (-1120.873) [-1110.933] * [-1113.008] (-1113.833) (-1117.146) (-1116.524) -- 0:02:52
113500 -- (-1115.725) [-1115.108] (-1119.135) (-1112.737) * [-1112.687] (-1116.199) (-1122.006) (-1115.365) -- 0:02:51
114000 -- (-1116.606) (-1116.307) (-1116.847) [-1114.676] * (-1112.597) [-1110.406] (-1120.284) (-1115.632) -- 0:02:50
114500 -- [-1115.472] (-1111.580) (-1116.614) (-1112.465) * (-1112.685) (-1113.548) (-1115.578) [-1116.202] -- 0:02:50
115000 -- [-1112.674] (-1109.816) (-1119.416) (-1116.062) * (-1121.990) (-1112.752) (-1117.872) [-1113.399] -- 0:02:49
Average standard deviation of split frequencies: 0.013546
115500 -- (-1111.555) (-1116.972) (-1114.480) [-1116.115] * (-1109.601) (-1116.169) (-1116.625) [-1112.500] -- 0:02:48
116000 -- (-1111.841) (-1117.511) (-1124.631) [-1112.768] * (-1113.400) [-1108.142] (-1120.221) (-1114.269) -- 0:02:47
116500 -- [-1116.779] (-1121.913) (-1120.384) (-1121.605) * [-1112.902] (-1110.950) (-1122.010) (-1115.006) -- 0:02:46
117000 -- (-1122.503) (-1116.354) (-1117.834) [-1108.548] * (-1111.537) (-1110.893) (-1121.872) [-1119.462] -- 0:02:46
117500 -- (-1122.951) [-1116.034] (-1120.544) (-1114.283) * (-1114.721) [-1114.147] (-1116.443) (-1116.634) -- 0:02:52
118000 -- (-1119.754) [-1109.722] (-1123.376) (-1112.686) * (-1114.018) (-1115.435) [-1110.017] (-1115.265) -- 0:02:51
118500 -- [-1120.257] (-1116.943) (-1119.532) (-1112.649) * (-1115.254) (-1111.886) [-1110.075] (-1111.114) -- 0:02:51
119000 -- [-1113.069] (-1113.117) (-1118.929) (-1118.961) * (-1114.369) [-1111.004] (-1115.407) (-1108.071) -- 0:02:50
119500 -- (-1120.895) (-1113.872) [-1113.900] (-1120.157) * (-1116.891) [-1111.190] (-1108.709) (-1107.733) -- 0:02:49
120000 -- (-1117.850) (-1118.501) [-1117.943] (-1116.689) * (-1119.720) (-1118.974) [-1114.577] (-1114.420) -- 0:02:48
Average standard deviation of split frequencies: 0.013022
120500 -- [-1111.501] (-1114.145) (-1118.315) (-1115.238) * (-1114.072) (-1112.948) [-1109.469] (-1109.910) -- 0:02:47
121000 -- (-1115.228) [-1107.322] (-1118.263) (-1119.555) * (-1119.005) [-1114.463] (-1115.229) (-1116.098) -- 0:02:47
121500 -- (-1112.116) (-1110.787) [-1111.248] (-1122.205) * (-1113.250) (-1110.495) [-1117.190] (-1113.344) -- 0:02:46
122000 -- (-1118.701) (-1114.387) [-1117.635] (-1118.470) * (-1120.477) (-1119.534) (-1115.379) [-1108.423] -- 0:02:45
122500 -- [-1110.418] (-1114.188) (-1114.909) (-1116.097) * (-1108.548) (-1114.815) [-1108.177] (-1118.509) -- 0:02:44
123000 -- (-1119.897) [-1110.418] (-1115.417) (-1113.753) * (-1109.771) (-1116.491) (-1113.593) [-1111.083] -- 0:02:51
123500 -- (-1119.977) (-1109.691) (-1121.490) [-1113.617] * [-1111.833] (-1118.640) (-1108.828) (-1112.921) -- 0:02:50
124000 -- (-1112.534) [-1108.531] (-1111.149) (-1110.851) * (-1115.489) (-1118.322) (-1111.915) [-1118.705] -- 0:02:49
124500 -- [-1115.980] (-1114.001) (-1113.619) (-1118.821) * (-1113.920) [-1118.494] (-1112.198) (-1113.067) -- 0:02:48
125000 -- (-1120.951) (-1120.348) (-1112.798) [-1116.221] * [-1114.087] (-1111.719) (-1115.696) (-1113.862) -- 0:02:48
Average standard deviation of split frequencies: 0.012471
125500 -- (-1108.123) [-1110.848] (-1115.084) (-1113.230) * (-1111.925) (-1118.815) [-1114.084] (-1115.289) -- 0:02:47
126000 -- (-1113.485) (-1116.397) [-1111.623] (-1118.895) * (-1110.704) [-1116.528] (-1116.521) (-1120.299) -- 0:02:46
126500 -- [-1115.664] (-1117.685) (-1114.591) (-1120.676) * [-1109.058] (-1113.717) (-1113.767) (-1118.976) -- 0:02:45
127000 -- (-1123.024) (-1112.738) (-1113.346) [-1111.591] * (-1116.990) (-1117.591) (-1115.155) [-1113.202] -- 0:02:44
127500 -- (-1112.959) (-1115.806) (-1119.942) [-1115.772] * (-1110.463) [-1115.663] (-1118.691) (-1109.070) -- 0:02:44
128000 -- (-1109.749) [-1118.652] (-1113.318) (-1116.229) * (-1114.806) (-1111.441) [-1118.123] (-1109.041) -- 0:02:50
128500 -- [-1113.223] (-1112.356) (-1115.166) (-1119.371) * (-1112.645) (-1108.995) [-1112.738] (-1119.774) -- 0:02:49
129000 -- (-1112.625) [-1111.769] (-1117.476) (-1112.458) * (-1113.340) (-1112.571) (-1112.873) [-1117.550] -- 0:02:48
129500 -- (-1114.850) [-1119.898] (-1127.864) (-1115.654) * (-1115.732) [-1113.149] (-1125.536) (-1113.244) -- 0:02:48
130000 -- (-1110.130) [-1114.550] (-1116.361) (-1121.033) * (-1119.560) (-1119.800) [-1115.639] (-1112.207) -- 0:02:47
Average standard deviation of split frequencies: 0.012026
130500 -- (-1115.799) (-1118.433) [-1117.754] (-1117.102) * [-1114.013] (-1114.646) (-1116.199) (-1113.979) -- 0:02:46
131000 -- [-1114.888] (-1121.482) (-1113.996) (-1116.706) * (-1117.026) (-1111.874) [-1113.081] (-1117.637) -- 0:02:45
131500 -- (-1113.476) (-1111.537) (-1117.945) [-1122.294] * (-1116.891) (-1108.832) (-1125.732) [-1126.393] -- 0:02:45
132000 -- [-1109.202] (-1111.378) (-1116.193) (-1125.438) * (-1117.750) (-1116.931) [-1118.700] (-1115.008) -- 0:02:44
132500 -- [-1113.803] (-1115.072) (-1113.059) (-1113.180) * (-1111.381) (-1120.335) (-1119.979) [-1116.199] -- 0:02:43
133000 -- (-1113.342) (-1118.447) (-1116.114) [-1113.383] * (-1109.141) (-1118.641) [-1111.529] (-1111.654) -- 0:02:49
133500 -- (-1110.733) [-1119.689] (-1113.061) (-1116.676) * (-1113.814) (-1112.756) [-1113.776] (-1113.899) -- 0:02:48
134000 -- (-1113.558) [-1113.732] (-1115.323) (-1108.424) * (-1109.860) [-1111.862] (-1112.236) (-1117.441) -- 0:02:48
134500 -- (-1114.839) (-1115.019) [-1113.280] (-1115.193) * (-1114.725) (-1116.780) (-1109.031) [-1113.622] -- 0:02:47
135000 -- [-1111.213] (-1118.973) (-1123.716) (-1114.418) * (-1117.912) [-1110.674] (-1123.116) (-1116.007) -- 0:02:46
Average standard deviation of split frequencies: 0.013865
135500 -- (-1120.148) (-1116.892) (-1121.918) [-1116.476] * [-1115.511] (-1119.871) (-1116.479) (-1116.145) -- 0:02:45
136000 -- (-1118.401) [-1117.159] (-1117.812) (-1112.035) * (-1130.908) [-1117.952] (-1112.632) (-1112.314) -- 0:02:45
136500 -- [-1115.273] (-1113.716) (-1114.565) (-1115.418) * (-1116.444) (-1112.430) [-1118.711] (-1111.366) -- 0:02:44
137000 -- (-1117.855) (-1117.192) [-1116.851] (-1114.902) * (-1115.229) (-1117.025) (-1119.986) [-1109.201] -- 0:02:43
137500 -- [-1112.249] (-1113.206) (-1112.800) (-1129.027) * (-1112.150) (-1112.412) [-1115.155] (-1113.471) -- 0:02:43
138000 -- (-1118.364) [-1110.533] (-1115.166) (-1121.122) * [-1109.853] (-1114.160) (-1112.960) (-1116.631) -- 0:02:42
138500 -- (-1114.640) [-1111.566] (-1117.651) (-1114.689) * [-1113.589] (-1111.128) (-1116.307) (-1114.262) -- 0:02:47
139000 -- (-1113.528) (-1117.866) (-1112.904) [-1120.692] * [-1114.969] (-1114.136) (-1111.040) (-1113.150) -- 0:02:47
139500 -- (-1118.296) (-1112.245) (-1109.911) [-1120.309] * (-1119.578) (-1110.488) (-1112.642) [-1116.692] -- 0:02:46
140000 -- (-1115.877) (-1116.190) [-1108.806] (-1118.080) * (-1114.950) [-1113.330] (-1118.233) (-1120.112) -- 0:02:45
Average standard deviation of split frequencies: 0.011171
140500 -- (-1113.977) (-1114.828) [-1112.676] (-1117.630) * [-1116.138] (-1112.824) (-1118.529) (-1118.504) -- 0:02:45
141000 -- (-1124.114) [-1111.140] (-1108.069) (-1114.096) * (-1116.519) [-1116.033] (-1119.274) (-1122.679) -- 0:02:44
141500 -- (-1120.618) [-1111.988] (-1118.537) (-1114.845) * [-1113.840] (-1111.419) (-1124.237) (-1116.806) -- 0:02:43
142000 -- (-1117.325) [-1111.978] (-1116.042) (-1114.313) * (-1125.649) (-1114.280) (-1114.908) [-1126.874] -- 0:02:43
142500 -- (-1118.989) (-1123.493) (-1112.429) [-1113.014] * [-1121.086] (-1113.507) (-1112.617) (-1119.119) -- 0:02:42
143000 -- (-1116.616) (-1117.452) (-1114.357) [-1109.556] * [-1108.647] (-1112.465) (-1112.731) (-1119.932) -- 0:02:41
143500 -- [-1116.224] (-1113.590) (-1122.426) (-1116.649) * (-1118.218) (-1120.337) (-1112.812) [-1115.024] -- 0:02:47
144000 -- [-1115.922] (-1111.182) (-1125.329) (-1115.822) * (-1118.793) (-1112.272) [-1111.504] (-1116.920) -- 0:02:46
144500 -- [-1110.707] (-1114.080) (-1113.837) (-1116.319) * (-1127.356) (-1110.599) (-1116.768) [-1117.343] -- 0:02:45
145000 -- (-1115.223) (-1109.479) [-1129.729] (-1117.126) * (-1126.168) [-1113.384] (-1116.094) (-1109.538) -- 0:02:45
Average standard deviation of split frequencies: 0.009686
145500 -- (-1121.347) (-1114.074) [-1114.190] (-1113.063) * (-1120.247) [-1113.144] (-1123.863) (-1110.182) -- 0:02:44
146000 -- (-1115.312) [-1117.877] (-1115.715) (-1117.380) * (-1113.281) [-1111.188] (-1132.097) (-1113.755) -- 0:02:43
146500 -- [-1111.842] (-1121.689) (-1114.469) (-1113.438) * (-1120.911) (-1110.129) [-1116.166] (-1119.193) -- 0:02:43
147000 -- [-1110.578] (-1111.828) (-1115.277) (-1115.031) * [-1111.712] (-1112.569) (-1120.461) (-1118.845) -- 0:02:42
147500 -- [-1110.980] (-1111.883) (-1125.598) (-1108.072) * (-1109.266) (-1109.045) (-1118.290) [-1113.435] -- 0:02:41
148000 -- (-1111.111) (-1113.303) (-1113.922) [-1112.246] * (-1112.260) (-1111.830) (-1120.236) [-1108.598] -- 0:02:41
148500 -- (-1115.416) [-1118.269] (-1112.255) (-1114.451) * (-1109.708) (-1117.162) (-1107.980) [-1109.113] -- 0:02:46
149000 -- [-1115.417] (-1113.023) (-1114.843) (-1122.205) * (-1113.464) [-1115.616] (-1109.873) (-1118.711) -- 0:02:45
149500 -- [-1115.648] (-1113.039) (-1116.964) (-1122.012) * [-1117.313] (-1113.772) (-1115.720) (-1117.590) -- 0:02:44
150000 -- (-1112.089) (-1113.782) (-1110.541) [-1111.207] * (-1115.510) (-1116.453) (-1120.655) [-1113.838] -- 0:02:44
Average standard deviation of split frequencies: 0.008343
150500 -- (-1112.613) [-1111.772] (-1121.820) (-1110.988) * [-1115.004] (-1117.128) (-1113.091) (-1117.258) -- 0:02:43
151000 -- [-1114.054] (-1122.660) (-1120.872) (-1114.022) * (-1126.192) (-1116.321) (-1118.411) [-1115.911] -- 0:02:43
151500 -- (-1113.598) (-1116.025) [-1112.732] (-1118.547) * (-1114.588) (-1123.980) [-1116.214] (-1115.222) -- 0:02:42
152000 -- (-1112.230) (-1120.787) (-1116.230) [-1110.326] * [-1119.061] (-1125.031) (-1113.625) (-1114.525) -- 0:02:41
152500 -- (-1110.576) (-1119.018) (-1122.813) [-1112.207] * [-1121.839] (-1124.371) (-1117.897) (-1114.715) -- 0:02:41
153000 -- (-1116.768) (-1111.486) [-1112.371] (-1112.491) * [-1117.053] (-1115.174) (-1112.900) (-1115.510) -- 0:02:40
153500 -- [-1113.553] (-1110.760) (-1112.793) (-1117.178) * (-1111.378) (-1119.091) [-1117.652] (-1115.569) -- 0:02:39
154000 -- [-1113.134] (-1111.528) (-1110.854) (-1119.888) * (-1116.212) (-1120.883) [-1116.896] (-1121.057) -- 0:02:44
154500 -- (-1120.870) (-1115.138) (-1109.756) [-1112.560] * (-1117.566) (-1111.827) (-1115.428) [-1122.313] -- 0:02:44
155000 -- (-1110.006) [-1117.276] (-1119.014) (-1120.687) * (-1118.380) (-1116.653) (-1112.378) [-1113.296] -- 0:02:43
Average standard deviation of split frequencies: 0.007051
155500 -- (-1113.631) (-1120.800) [-1125.696] (-1118.031) * (-1120.295) (-1118.592) (-1119.146) [-1112.986] -- 0:02:42
156000 -- (-1111.842) [-1113.161] (-1120.204) (-1118.545) * (-1118.045) (-1114.188) (-1114.850) [-1108.208] -- 0:02:42
156500 -- [-1116.167] (-1118.508) (-1121.804) (-1124.380) * (-1114.547) [-1114.128] (-1123.068) (-1116.579) -- 0:02:41
157000 -- (-1113.428) [-1111.766] (-1116.811) (-1120.669) * (-1115.183) (-1116.089) [-1114.951] (-1119.386) -- 0:02:41
157500 -- (-1114.342) [-1111.316] (-1114.111) (-1117.420) * [-1114.952] (-1122.933) (-1110.297) (-1113.348) -- 0:02:40
158000 -- (-1113.018) [-1112.182] (-1120.841) (-1114.149) * (-1114.414) (-1122.938) (-1118.652) [-1112.509] -- 0:02:39
158500 -- (-1115.886) (-1115.061) (-1111.536) [-1110.821] * [-1116.090] (-1119.839) (-1111.727) (-1108.990) -- 0:02:39
159000 -- (-1114.629) (-1122.288) [-1116.305] (-1114.821) * (-1117.214) (-1116.035) (-1109.670) [-1113.535] -- 0:02:43
159500 -- (-1117.387) [-1110.693] (-1115.011) (-1117.810) * [-1111.860] (-1117.400) (-1108.708) (-1117.705) -- 0:02:43
160000 -- [-1114.917] (-1118.088) (-1118.078) (-1118.839) * (-1118.347) [-1111.030] (-1115.495) (-1116.218) -- 0:02:42
Average standard deviation of split frequencies: 0.006846
160500 -- [-1118.317] (-1126.300) (-1113.707) (-1123.482) * (-1117.047) [-1109.543] (-1112.298) (-1110.772) -- 0:02:42
161000 -- (-1111.982) (-1128.341) (-1115.337) [-1118.931] * (-1112.065) [-1112.286] (-1112.203) (-1110.261) -- 0:02:41
161500 -- [-1112.112] (-1115.873) (-1109.254) (-1113.601) * [-1115.983] (-1117.282) (-1115.716) (-1122.728) -- 0:02:40
162000 -- [-1113.211] (-1114.983) (-1113.258) (-1111.617) * (-1124.522) (-1114.579) [-1112.938] (-1128.199) -- 0:02:40
162500 -- (-1119.177) (-1118.240) [-1117.814] (-1118.510) * [-1114.841] (-1115.977) (-1110.468) (-1113.571) -- 0:02:39
163000 -- (-1111.953) (-1112.148) [-1106.123] (-1118.523) * (-1113.873) (-1109.443) [-1115.811] (-1121.392) -- 0:02:39
163500 -- [-1109.559] (-1117.794) (-1111.963) (-1111.384) * (-1121.783) [-1118.140] (-1116.911) (-1117.068) -- 0:02:38
164000 -- (-1110.390) (-1115.559) (-1114.032) [-1110.498] * (-1119.037) (-1111.990) [-1115.866] (-1110.404) -- 0:02:43
164500 -- [-1120.889] (-1113.715) (-1112.074) (-1115.284) * [-1113.294] (-1113.349) (-1116.822) (-1111.889) -- 0:02:42
165000 -- (-1119.205) (-1122.337) [-1109.434] (-1113.750) * (-1113.366) (-1115.213) [-1111.961] (-1107.249) -- 0:02:41
Average standard deviation of split frequencies: 0.010413
165500 -- (-1115.727) (-1129.811) (-1114.660) [-1112.998] * (-1117.262) (-1112.440) [-1112.130] (-1108.282) -- 0:02:41
166000 -- (-1112.284) [-1116.461] (-1116.752) (-1112.022) * (-1119.607) (-1117.324) (-1114.683) [-1112.537] -- 0:02:40
166500 -- (-1117.395) [-1123.368] (-1124.153) (-1109.181) * (-1112.954) (-1117.199) [-1116.137] (-1114.125) -- 0:02:40
167000 -- [-1118.653] (-1118.597) (-1114.473) (-1109.832) * (-1116.252) [-1122.015] (-1122.522) (-1112.599) -- 0:02:39
167500 -- (-1121.157) (-1119.774) [-1111.911] (-1111.063) * (-1117.830) (-1116.561) [-1112.744] (-1112.221) -- 0:02:39
168000 -- (-1110.722) (-1117.239) (-1112.522) [-1109.253] * (-1116.342) (-1114.902) (-1120.532) [-1110.744] -- 0:02:38
168500 -- [-1112.664] (-1115.547) (-1115.866) (-1120.172) * (-1111.173) (-1119.755) [-1109.988] (-1109.119) -- 0:02:37
169000 -- (-1115.314) [-1112.473] (-1113.530) (-1119.911) * (-1113.660) [-1115.095] (-1113.221) (-1117.918) -- 0:02:37
169500 -- (-1112.163) (-1113.970) (-1117.917) [-1114.300] * (-1119.118) (-1115.034) [-1111.242] (-1108.038) -- 0:02:41
170000 -- (-1115.648) (-1118.178) (-1117.303) [-1113.402] * (-1129.428) (-1110.631) [-1114.705] (-1124.661) -- 0:02:41
Average standard deviation of split frequencies: 0.008286
170500 -- (-1112.662) (-1116.384) (-1111.774) [-1112.029] * (-1115.307) [-1113.804] (-1117.146) (-1121.529) -- 0:02:40
171000 -- [-1113.672] (-1110.507) (-1118.278) (-1112.256) * [-1122.974] (-1118.925) (-1113.660) (-1116.900) -- 0:02:39
171500 -- (-1112.361) (-1111.734) [-1114.296] (-1118.529) * [-1108.206] (-1116.107) (-1117.402) (-1121.231) -- 0:02:39
172000 -- (-1109.731) (-1115.723) [-1110.256] (-1112.431) * [-1110.820] (-1116.102) (-1111.826) (-1117.302) -- 0:02:38
172500 -- (-1119.738) [-1116.586] (-1114.521) (-1115.799) * (-1113.041) [-1113.544] (-1112.792) (-1110.902) -- 0:02:38
173000 -- (-1115.276) (-1116.804) [-1113.493] (-1114.642) * (-1115.448) (-1116.121) (-1115.242) [-1107.320] -- 0:02:37
173500 -- (-1110.128) (-1116.173) [-1113.685] (-1110.546) * [-1115.298] (-1115.955) (-1113.909) (-1122.943) -- 0:02:37
174000 -- [-1113.632] (-1111.797) (-1116.669) (-1125.370) * (-1116.023) (-1129.813) [-1110.201] (-1115.087) -- 0:02:36
174500 -- (-1114.133) [-1116.904] (-1116.937) (-1115.906) * [-1112.546] (-1117.702) (-1118.987) (-1124.121) -- 0:02:40
175000 -- (-1116.739) (-1110.387) [-1108.475] (-1115.084) * (-1120.554) (-1118.108) (-1113.545) [-1120.002] -- 0:02:40
Average standard deviation of split frequencies: 0.007142
175500 -- (-1118.855) [-1110.311] (-1117.726) (-1118.954) * (-1113.521) (-1114.848) [-1114.693] (-1113.500) -- 0:02:39
176000 -- (-1113.702) (-1116.292) (-1115.381) [-1118.261] * (-1113.147) (-1116.655) [-1118.888] (-1119.214) -- 0:02:39
176500 -- (-1112.158) [-1113.205] (-1107.967) (-1129.579) * (-1114.623) [-1114.244] (-1118.079) (-1121.559) -- 0:02:38
177000 -- (-1115.401) (-1112.095) (-1120.566) [-1111.968] * (-1111.310) (-1117.231) [-1116.198] (-1118.632) -- 0:02:38
177500 -- (-1112.872) (-1114.536) [-1123.469] (-1116.585) * [-1109.080] (-1113.042) (-1119.659) (-1115.143) -- 0:02:37
178000 -- (-1116.483) (-1113.234) [-1114.611] (-1119.164) * (-1117.318) (-1117.700) [-1117.399] (-1113.384) -- 0:02:37
178500 -- (-1122.717) [-1122.455] (-1116.077) (-1122.171) * (-1115.677) [-1112.939] (-1117.087) (-1113.703) -- 0:02:36
179000 -- (-1115.079) (-1123.050) [-1115.373] (-1113.688) * (-1114.226) [-1115.602] (-1117.554) (-1119.256) -- 0:02:35
179500 -- (-1109.856) [-1121.035] (-1112.088) (-1118.830) * (-1112.820) (-1123.650) (-1119.590) [-1111.998] -- 0:02:39
180000 -- (-1114.475) [-1111.295] (-1123.082) (-1115.579) * (-1118.848) (-1110.996) [-1118.386] (-1116.930) -- 0:02:39
Average standard deviation of split frequencies: 0.006088
180500 -- (-1114.980) [-1114.762] (-1124.892) (-1114.134) * (-1110.518) [-1111.600] (-1119.698) (-1121.108) -- 0:02:38
181000 -- (-1115.821) [-1118.894] (-1113.551) (-1111.184) * (-1112.489) (-1117.546) [-1118.909] (-1116.692) -- 0:02:38
181500 -- (-1115.946) (-1123.763) [-1115.664] (-1116.108) * (-1116.561) (-1110.746) [-1109.064] (-1119.721) -- 0:02:37
182000 -- [-1118.017] (-1113.529) (-1117.792) (-1111.337) * [-1112.629] (-1113.418) (-1112.189) (-1116.432) -- 0:02:37
182500 -- (-1119.275) (-1124.455) (-1116.560) [-1112.438] * (-1121.799) [-1111.563] (-1115.492) (-1113.241) -- 0:02:36
183000 -- (-1123.660) (-1112.692) (-1122.291) [-1109.873] * (-1111.445) (-1112.886) [-1116.700] (-1116.138) -- 0:02:36
183500 -- (-1120.853) [-1110.340] (-1113.678) (-1112.495) * [-1108.131] (-1115.951) (-1127.227) (-1134.106) -- 0:02:35
184000 -- (-1117.157) (-1111.565) (-1112.590) [-1112.982] * (-1111.598) (-1109.024) [-1120.282] (-1121.483) -- 0:02:35
184500 -- (-1114.485) (-1118.593) (-1128.400) [-1112.518] * (-1112.677) [-1110.309] (-1120.053) (-1123.718) -- 0:02:34
185000 -- (-1117.912) (-1126.463) [-1119.905] (-1116.268) * [-1119.063] (-1110.856) (-1114.532) (-1129.234) -- 0:02:38
Average standard deviation of split frequencies: 0.005914
185500 -- (-1116.175) [-1122.250] (-1116.543) (-1122.649) * (-1118.870) (-1114.616) [-1116.351] (-1129.049) -- 0:02:38
186000 -- (-1115.435) (-1124.108) (-1119.775) [-1114.157] * [-1114.955] (-1118.133) (-1113.278) (-1122.374) -- 0:02:37
186500 -- (-1118.934) (-1117.819) [-1120.457] (-1122.114) * [-1114.411] (-1111.699) (-1118.075) (-1114.214) -- 0:02:37
187000 -- (-1123.386) [-1118.443] (-1119.642) (-1121.683) * (-1114.140) (-1110.633) (-1117.044) [-1111.285] -- 0:02:36
187500 -- (-1113.019) [-1114.708] (-1118.728) (-1113.600) * (-1114.043) (-1116.613) [-1118.632] (-1115.484) -- 0:02:36
188000 -- [-1121.026] (-1112.503) (-1117.575) (-1120.565) * [-1114.709] (-1111.059) (-1120.621) (-1118.246) -- 0:02:35
188500 -- (-1116.181) [-1111.195] (-1111.301) (-1117.724) * (-1122.376) (-1118.275) [-1116.765] (-1115.476) -- 0:02:34
189000 -- (-1124.316) (-1115.720) [-1116.442] (-1115.197) * (-1115.878) (-1113.160) (-1113.068) [-1116.489] -- 0:02:34
189500 -- (-1112.612) (-1113.952) [-1112.207] (-1123.264) * (-1119.218) (-1113.304) [-1111.447] (-1116.395) -- 0:02:33
190000 -- [-1118.269] (-1110.640) (-1120.991) (-1115.544) * [-1110.124] (-1120.951) (-1115.116) (-1108.021) -- 0:02:37
Average standard deviation of split frequencies: 0.007417
190500 -- (-1111.623) (-1112.138) [-1124.145] (-1121.520) * (-1117.687) (-1119.346) (-1111.160) [-1109.014] -- 0:02:37
191000 -- (-1124.571) (-1117.143) [-1113.481] (-1121.084) * (-1114.519) (-1113.143) (-1110.653) [-1111.384] -- 0:02:36
191500 -- (-1116.194) (-1111.746) [-1123.413] (-1131.348) * (-1114.414) (-1118.572) (-1111.087) [-1115.988] -- 0:02:36
192000 -- [-1110.918] (-1118.525) (-1111.542) (-1119.167) * [-1111.274] (-1118.482) (-1119.136) (-1109.886) -- 0:02:35
192500 -- (-1109.129) [-1117.237] (-1123.167) (-1122.138) * (-1113.013) [-1112.688] (-1113.774) (-1120.028) -- 0:02:35
193000 -- (-1110.819) (-1120.089) (-1113.353) [-1120.308] * (-1118.047) [-1108.660] (-1111.756) (-1114.150) -- 0:02:34
193500 -- (-1110.097) [-1113.930] (-1115.897) (-1114.886) * [-1112.370] (-1108.177) (-1111.051) (-1121.593) -- 0:02:34
194000 -- [-1112.235] (-1115.391) (-1113.276) (-1126.405) * (-1112.614) (-1117.621) (-1114.392) [-1113.456] -- 0:02:33
194500 -- [-1111.810] (-1109.813) (-1111.473) (-1114.554) * (-1110.632) (-1117.381) [-1114.521] (-1118.868) -- 0:02:33
195000 -- (-1111.938) [-1111.338] (-1115.428) (-1116.483) * (-1112.229) (-1108.671) [-1111.893] (-1120.190) -- 0:02:32
Average standard deviation of split frequencies: 0.006414
195500 -- (-1114.512) (-1112.757) [-1108.306] (-1111.267) * (-1121.954) [-1114.629] (-1120.616) (-1120.495) -- 0:02:36
196000 -- (-1116.509) (-1113.885) [-1116.576] (-1108.715) * (-1109.428) (-1116.924) (-1122.578) [-1113.847] -- 0:02:35
196500 -- (-1118.941) (-1112.188) [-1126.725] (-1114.001) * [-1111.373] (-1117.957) (-1118.911) (-1122.492) -- 0:02:35
197000 -- (-1121.210) (-1112.882) (-1118.878) [-1113.013] * (-1113.386) [-1113.674] (-1116.027) (-1122.512) -- 0:02:34
197500 -- [-1113.139] (-1114.398) (-1122.085) (-1116.248) * [-1114.646] (-1122.633) (-1110.383) (-1134.822) -- 0:02:34
198000 -- (-1114.730) (-1113.482) [-1120.301] (-1121.018) * (-1114.559) [-1113.793] (-1113.925) (-1126.447) -- 0:02:33
198500 -- [-1116.326] (-1112.177) (-1116.939) (-1115.263) * (-1112.803) [-1108.521] (-1114.868) (-1119.934) -- 0:02:33
199000 -- (-1119.392) (-1119.664) [-1118.512] (-1111.926) * (-1113.770) (-1112.362) (-1116.468) [-1111.690] -- 0:02:32
199500 -- [-1117.051] (-1113.923) (-1121.484) (-1116.785) * [-1117.880] (-1111.057) (-1114.206) (-1117.998) -- 0:02:32
200000 -- (-1121.229) (-1113.836) [-1113.936] (-1116.032) * [-1109.695] (-1114.061) (-1115.541) (-1117.124) -- 0:02:32
Average standard deviation of split frequencies: 0.006265
200500 -- (-1116.666) (-1111.836) [-1110.252] (-1113.780) * (-1111.534) (-1114.357) (-1116.355) [-1115.837] -- 0:02:31
201000 -- (-1111.750) (-1109.266) (-1119.638) [-1110.724] * (-1114.138) [-1110.742] (-1109.844) (-1115.240) -- 0:02:35
201500 -- (-1114.548) (-1113.774) (-1130.653) [-1115.478] * (-1111.517) (-1111.895) [-1112.972] (-1116.885) -- 0:02:34
202000 -- [-1115.873] (-1115.395) (-1117.740) (-1110.966) * (-1111.934) (-1116.154) (-1110.882) [-1113.905] -- 0:02:34
202500 -- (-1112.225) [-1114.792] (-1120.180) (-1113.808) * [-1113.499] (-1115.969) (-1118.222) (-1118.487) -- 0:02:33
203000 -- (-1111.139) [-1113.355] (-1112.558) (-1119.122) * (-1113.042) (-1110.274) (-1117.100) [-1111.284] -- 0:02:33
203500 -- (-1114.932) (-1122.562) [-1112.466] (-1110.987) * (-1113.072) [-1115.001] (-1112.606) (-1110.618) -- 0:02:32
204000 -- (-1112.209) [-1113.048] (-1116.184) (-1108.881) * [-1108.651] (-1113.556) (-1111.954) (-1111.633) -- 0:02:32
204500 -- (-1111.014) (-1121.282) (-1116.780) [-1114.084] * (-1110.855) (-1115.963) [-1115.498] (-1118.659) -- 0:02:31
205000 -- (-1114.201) (-1117.350) [-1113.170] (-1120.461) * [-1114.234] (-1113.529) (-1112.358) (-1115.697) -- 0:02:31
Average standard deviation of split frequencies: 0.006102
205500 -- (-1111.030) (-1112.246) (-1115.495) [-1117.988] * [-1108.337] (-1113.829) (-1114.581) (-1116.741) -- 0:02:30
206000 -- [-1115.226] (-1115.597) (-1113.979) (-1112.703) * (-1119.466) (-1116.131) [-1112.759] (-1121.510) -- 0:02:34
206500 -- (-1111.091) (-1116.478) (-1111.943) [-1114.590] * (-1114.214) (-1117.646) (-1108.928) [-1115.650] -- 0:02:33
207000 -- (-1118.728) (-1118.930) [-1118.623] (-1112.686) * (-1119.055) [-1114.975] (-1117.180) (-1115.252) -- 0:02:33
207500 -- (-1117.691) (-1107.224) [-1117.988] (-1117.919) * (-1115.871) (-1118.661) [-1114.901] (-1116.236) -- 0:02:32
208000 -- [-1112.674] (-1119.936) (-1118.957) (-1115.709) * (-1121.014) [-1110.162] (-1119.979) (-1112.450) -- 0:02:32
208500 -- (-1115.187) (-1118.954) (-1114.258) [-1108.026] * (-1123.178) (-1119.911) [-1115.316] (-1117.843) -- 0:02:31
209000 -- (-1114.644) (-1116.180) [-1115.915] (-1112.838) * (-1114.627) [-1111.157] (-1112.066) (-1113.133) -- 0:02:31
209500 -- [-1115.402] (-1111.542) (-1113.432) (-1113.715) * [-1110.948] (-1120.263) (-1115.585) (-1110.280) -- 0:02:30
210000 -- (-1114.210) (-1109.498) (-1115.190) [-1120.047] * (-1116.986) [-1114.803] (-1112.689) (-1114.750) -- 0:02:30
Average standard deviation of split frequencies: 0.003729
210500 -- (-1118.993) [-1112.525] (-1113.990) (-1120.453) * [-1114.288] (-1118.369) (-1115.843) (-1113.508) -- 0:02:30
211000 -- (-1120.333) (-1111.053) (-1116.379) [-1114.412] * [-1114.986] (-1112.302) (-1110.077) (-1117.709) -- 0:02:29
211500 -- (-1110.573) (-1116.611) (-1111.009) [-1112.603] * [-1114.133] (-1115.476) (-1116.212) (-1114.408) -- 0:02:32
212000 -- (-1117.609) (-1111.503) [-1114.446] (-1115.409) * (-1109.006) [-1108.911] (-1108.967) (-1112.235) -- 0:02:32
212500 -- [-1117.510] (-1131.361) (-1119.961) (-1121.870) * [-1113.219] (-1118.867) (-1116.209) (-1112.495) -- 0:02:31
213000 -- (-1119.971) (-1119.244) [-1111.123] (-1131.035) * (-1112.716) (-1114.058) (-1118.958) [-1115.981] -- 0:02:31
213500 -- (-1113.447) [-1119.507] (-1112.986) (-1125.324) * (-1113.811) (-1120.744) (-1113.353) [-1118.935] -- 0:02:31
214000 -- (-1122.733) (-1114.850) [-1111.040] (-1125.442) * (-1117.745) (-1114.199) (-1118.811) [-1116.932] -- 0:02:30
214500 -- (-1116.874) (-1116.952) [-1110.742] (-1116.510) * (-1119.304) [-1109.298] (-1109.778) (-1122.819) -- 0:02:30
215000 -- (-1121.009) [-1110.593] (-1115.638) (-1112.194) * [-1110.318] (-1112.981) (-1114.182) (-1112.974) -- 0:02:29
Average standard deviation of split frequencies: 0.003637
215500 -- (-1113.604) (-1114.483) (-1124.518) [-1114.322] * (-1113.683) (-1117.099) (-1120.327) [-1113.049] -- 0:02:29
216000 -- (-1116.407) (-1126.036) (-1114.068) [-1116.624] * [-1112.823] (-1119.069) (-1112.870) (-1114.901) -- 0:02:28
216500 -- [-1114.816] (-1114.820) (-1116.108) (-1115.356) * (-1111.028) (-1128.888) (-1113.275) [-1110.500] -- 0:02:28
217000 -- (-1110.538) (-1114.494) (-1114.494) [-1116.276] * (-1109.380) (-1111.641) (-1115.453) [-1110.631] -- 0:02:31
217500 -- (-1113.900) [-1118.259] (-1124.397) (-1116.428) * (-1126.435) (-1116.658) [-1111.459] (-1111.768) -- 0:02:31
218000 -- [-1111.725] (-1116.043) (-1115.856) (-1110.861) * (-1113.737) (-1111.606) [-1112.597] (-1120.181) -- 0:02:30
218500 -- (-1114.176) (-1116.830) (-1113.098) [-1110.563] * (-1120.946) (-1115.292) [-1112.974] (-1118.862) -- 0:02:30
219000 -- (-1121.944) (-1113.940) [-1109.177] (-1126.632) * (-1114.682) (-1119.648) [-1122.290] (-1111.231) -- 0:02:29
219500 -- (-1112.487) [-1113.287] (-1117.859) (-1114.150) * (-1125.911) [-1112.965] (-1118.098) (-1114.542) -- 0:02:29
220000 -- [-1114.616] (-1115.963) (-1113.496) (-1110.297) * (-1107.860) [-1115.805] (-1115.050) (-1115.350) -- 0:02:28
Average standard deviation of split frequencies: 0.004985
220500 -- [-1110.303] (-1117.245) (-1117.542) (-1123.423) * [-1117.471] (-1120.484) (-1112.883) (-1115.759) -- 0:02:28
221000 -- [-1112.848] (-1129.302) (-1117.237) (-1116.946) * [-1115.502] (-1117.765) (-1113.458) (-1119.967) -- 0:02:28
221500 -- (-1113.984) (-1112.514) (-1113.515) [-1110.116] * (-1114.962) (-1113.367) (-1113.396) [-1119.442] -- 0:02:27
222000 -- (-1118.302) (-1116.610) (-1111.900) [-1117.151] * (-1110.709) (-1115.461) [-1115.058] (-1127.065) -- 0:02:30
222500 -- (-1123.522) (-1114.435) [-1113.601] (-1121.505) * [-1115.346] (-1116.000) (-1111.146) (-1116.701) -- 0:02:30
223000 -- (-1116.341) (-1116.701) [-1116.311] (-1119.377) * (-1115.307) (-1108.810) [-1113.964] (-1120.444) -- 0:02:29
223500 -- [-1110.327] (-1118.037) (-1111.962) (-1120.352) * [-1118.008] (-1114.489) (-1111.823) (-1112.926) -- 0:02:29
224000 -- (-1117.968) [-1111.012] (-1111.564) (-1109.468) * (-1115.490) (-1109.649) (-1110.428) [-1112.819] -- 0:02:28
224500 -- (-1120.882) (-1115.509) [-1113.610] (-1112.885) * (-1113.878) (-1109.429) [-1110.814] (-1118.660) -- 0:02:28
225000 -- (-1114.210) [-1116.998] (-1117.811) (-1115.696) * (-1113.969) [-1114.680] (-1119.977) (-1119.821) -- 0:02:28
Average standard deviation of split frequencies: 0.004172
225500 -- (-1114.592) (-1117.273) (-1114.369) [-1112.271] * (-1117.959) [-1113.264] (-1117.079) (-1119.135) -- 0:02:27
226000 -- (-1116.572) (-1113.848) [-1112.018] (-1121.906) * (-1116.889) [-1115.567] (-1110.979) (-1115.591) -- 0:02:27
226500 -- (-1117.827) [-1110.910] (-1120.286) (-1118.200) * [-1119.574] (-1116.008) (-1120.245) (-1120.906) -- 0:02:26
227000 -- (-1124.990) (-1114.991) (-1113.587) [-1110.478] * (-1123.700) (-1112.798) (-1113.692) [-1113.078] -- 0:02:26
227500 -- (-1116.788) (-1117.004) [-1112.610] (-1115.134) * (-1120.601) (-1112.136) (-1118.732) [-1112.460] -- 0:02:29
228000 -- (-1115.263) (-1114.141) (-1115.006) [-1112.074] * (-1121.792) (-1116.862) (-1121.096) [-1112.318] -- 0:02:28
228500 -- (-1116.235) (-1109.113) [-1108.344] (-1126.127) * (-1112.800) (-1113.356) (-1112.679) [-1113.122] -- 0:02:28
229000 -- (-1127.506) [-1117.228] (-1116.162) (-1113.889) * (-1116.221) (-1117.940) (-1120.747) [-1113.707] -- 0:02:28
229500 -- (-1117.975) [-1109.796] (-1116.421) (-1118.650) * [-1110.805] (-1112.558) (-1119.602) (-1108.375) -- 0:02:27
230000 -- (-1114.060) [-1113.425] (-1119.594) (-1112.276) * (-1115.023) (-1110.332) (-1118.315) [-1111.311] -- 0:02:27
Average standard deviation of split frequencies: 0.002044
230500 -- (-1118.522) [-1112.026] (-1116.380) (-1111.522) * [-1117.333] (-1116.579) (-1113.703) (-1115.927) -- 0:02:26
231000 -- (-1112.060) (-1113.768) [-1111.173] (-1116.739) * (-1117.593) (-1117.093) (-1111.724) [-1120.254] -- 0:02:26
231500 -- (-1111.029) [-1115.049] (-1110.295) (-1111.911) * (-1116.342) (-1117.413) [-1110.856] (-1113.294) -- 0:02:26
232000 -- [-1109.012] (-1113.610) (-1114.176) (-1116.014) * (-1116.365) (-1115.745) [-1111.730] (-1114.223) -- 0:02:25
232500 -- (-1116.599) [-1111.579] (-1114.329) (-1121.552) * (-1114.692) (-1113.794) (-1111.705) [-1113.067] -- 0:02:28
233000 -- (-1113.550) [-1118.605] (-1113.529) (-1113.764) * (-1118.195) (-1112.213) [-1111.381] (-1113.843) -- 0:02:28
233500 -- (-1115.983) [-1109.486] (-1119.786) (-1115.675) * (-1116.312) (-1111.896) (-1115.002) [-1113.525] -- 0:02:27
234000 -- [-1113.402] (-1115.461) (-1116.086) (-1113.933) * (-1119.681) [-1114.896] (-1119.309) (-1119.044) -- 0:02:27
234500 -- [-1110.267] (-1117.564) (-1122.872) (-1114.686) * (-1108.635) [-1113.196] (-1114.173) (-1117.728) -- 0:02:26
235000 -- (-1118.867) (-1114.079) [-1118.079] (-1115.660) * (-1111.367) (-1108.487) (-1108.873) [-1114.517] -- 0:02:26
Average standard deviation of split frequencies: 0.002663
235500 -- [-1113.806] (-1109.855) (-1114.504) (-1109.938) * [-1116.625] (-1112.645) (-1118.323) (-1112.061) -- 0:02:26
236000 -- (-1122.663) (-1115.468) [-1116.340] (-1108.897) * (-1115.399) (-1120.508) [-1115.249] (-1110.726) -- 0:02:25
236500 -- (-1120.102) (-1117.409) (-1116.036) [-1115.948] * (-1122.512) [-1116.987] (-1117.915) (-1114.511) -- 0:02:25
237000 -- [-1122.442] (-1116.483) (-1112.383) (-1109.083) * (-1119.352) [-1112.686] (-1115.451) (-1116.939) -- 0:02:24
237500 -- (-1111.533) (-1116.587) [-1114.038] (-1114.784) * (-1119.011) [-1114.003] (-1117.852) (-1119.042) -- 0:02:24
238000 -- (-1117.417) [-1118.361] (-1116.916) (-1118.679) * (-1120.432) (-1120.511) (-1111.409) [-1109.381] -- 0:02:27
238500 -- [-1113.862] (-1124.340) (-1118.295) (-1129.946) * (-1121.586) (-1115.002) [-1113.498] (-1116.552) -- 0:02:26
239000 -- (-1118.271) [-1120.527] (-1111.099) (-1127.095) * [-1116.309] (-1119.307) (-1119.392) (-1115.166) -- 0:02:26
239500 -- (-1115.355) (-1120.184) [-1117.210] (-1118.989) * (-1114.697) [-1120.291] (-1121.354) (-1115.521) -- 0:02:26
240000 -- (-1115.977) [-1118.517] (-1112.139) (-1121.147) * (-1114.512) (-1112.621) (-1116.580) [-1114.266] -- 0:02:25
Average standard deviation of split frequencies: 0.003265
240500 -- (-1114.695) [-1119.831] (-1114.342) (-1117.696) * (-1113.058) (-1115.687) [-1110.349] (-1112.125) -- 0:02:25
241000 -- (-1110.872) (-1115.662) [-1118.056] (-1115.127) * (-1116.564) (-1113.087) (-1111.966) [-1114.429] -- 0:02:24
241500 -- (-1123.068) [-1113.160] (-1110.890) (-1114.189) * [-1117.499] (-1113.810) (-1109.511) (-1118.842) -- 0:02:24
242000 -- (-1116.620) (-1110.775) [-1116.172] (-1115.228) * (-1122.493) (-1109.995) (-1116.077) [-1114.726] -- 0:02:24
242500 -- (-1112.177) [-1113.873] (-1119.694) (-1116.506) * (-1117.794) [-1110.723] (-1110.572) (-1122.302) -- 0:02:23
243000 -- [-1113.802] (-1117.249) (-1111.761) (-1116.440) * (-1118.099) (-1119.450) [-1112.521] (-1114.420) -- 0:02:26
243500 -- (-1115.197) (-1113.539) [-1109.491] (-1118.142) * [-1110.753] (-1115.740) (-1112.968) (-1115.606) -- 0:02:26
244000 -- [-1109.590] (-1122.173) (-1115.115) (-1122.421) * (-1114.989) (-1127.912) (-1111.427) [-1113.708] -- 0:02:25
244500 -- (-1113.911) (-1119.128) [-1116.263] (-1115.274) * (-1114.431) (-1113.752) (-1118.627) [-1112.146] -- 0:02:25
245000 -- (-1122.949) (-1113.521) (-1118.478) [-1114.757] * [-1115.113] (-1115.760) (-1115.153) (-1113.103) -- 0:02:24
Average standard deviation of split frequencies: 0.003833
245500 -- (-1115.847) (-1110.100) [-1119.420] (-1119.111) * (-1125.366) (-1113.858) (-1117.740) [-1119.616] -- 0:02:24
246000 -- [-1115.086] (-1112.821) (-1112.277) (-1117.885) * (-1114.975) (-1114.159) (-1115.798) [-1108.963] -- 0:02:24
246500 -- (-1113.449) [-1112.138] (-1109.551) (-1121.801) * (-1123.817) (-1118.910) (-1114.544) [-1108.558] -- 0:02:23
247000 -- (-1118.892) (-1116.138) [-1113.433] (-1118.900) * (-1115.869) (-1115.967) [-1117.786] (-1114.173) -- 0:02:23
247500 -- [-1118.755] (-1116.121) (-1109.391) (-1120.950) * (-1119.388) (-1113.895) [-1113.753] (-1124.959) -- 0:02:22
248000 -- (-1116.765) (-1117.351) [-1117.339] (-1117.290) * (-1110.087) [-1113.030] (-1113.563) (-1112.864) -- 0:02:22
248500 -- (-1119.275) (-1122.105) [-1112.101] (-1113.139) * (-1110.630) [-1113.911] (-1121.822) (-1110.963) -- 0:02:25
249000 -- [-1115.149] (-1110.202) (-1110.742) (-1123.343) * (-1112.865) (-1126.273) [-1114.064] (-1113.300) -- 0:02:24
249500 -- [-1118.571] (-1110.780) (-1116.214) (-1117.237) * (-1117.771) [-1114.601] (-1114.862) (-1117.662) -- 0:02:24
250000 -- (-1118.050) [-1118.215] (-1110.114) (-1112.867) * (-1116.692) (-1115.192) (-1113.056) [-1114.277] -- 0:02:24
Average standard deviation of split frequencies: 0.002507
250500 -- (-1119.133) (-1115.867) [-1114.905] (-1109.658) * (-1113.208) (-1115.103) (-1117.477) [-1111.771] -- 0:02:23
251000 -- (-1113.365) [-1118.975] (-1114.957) (-1113.797) * [-1109.643] (-1110.158) (-1122.492) (-1116.112) -- 0:02:23
251500 -- (-1116.375) (-1114.519) [-1116.958] (-1111.577) * (-1108.585) (-1116.219) (-1111.051) [-1116.156] -- 0:02:22
252000 -- [-1115.035] (-1112.833) (-1123.054) (-1116.165) * (-1112.913) (-1114.527) (-1124.577) [-1111.932] -- 0:02:22
252500 -- (-1116.081) [-1110.090] (-1121.084) (-1110.551) * (-1117.396) [-1119.419] (-1114.868) (-1114.043) -- 0:02:22
253000 -- (-1118.116) [-1112.215] (-1124.187) (-1114.273) * [-1111.033] (-1125.973) (-1112.657) (-1116.544) -- 0:02:21
253500 -- (-1114.901) (-1113.955) [-1113.035] (-1123.828) * [-1117.035] (-1111.338) (-1108.927) (-1118.955) -- 0:02:21
254000 -- (-1118.052) [-1110.672] (-1111.039) (-1115.236) * (-1112.992) [-1109.853] (-1112.639) (-1128.658) -- 0:02:23
254500 -- [-1119.355] (-1112.987) (-1110.917) (-1114.732) * [-1110.743] (-1115.378) (-1121.479) (-1120.688) -- 0:02:23
255000 -- (-1113.316) (-1111.817) [-1113.040] (-1115.217) * [-1114.124] (-1115.874) (-1115.659) (-1111.818) -- 0:02:23
Average standard deviation of split frequencies: 0.003069
255500 -- (-1113.085) (-1109.389) [-1117.115] (-1109.720) * [-1115.074] (-1123.768) (-1111.485) (-1115.470) -- 0:02:22
256000 -- (-1115.993) (-1114.860) (-1116.183) [-1114.185] * [-1113.444] (-1114.507) (-1113.256) (-1125.881) -- 0:02:22
256500 -- (-1114.204) (-1121.302) (-1112.084) [-1116.369] * (-1110.981) (-1121.271) [-1112.114] (-1114.200) -- 0:02:22
257000 -- (-1112.515) (-1112.928) (-1112.520) [-1112.877] * [-1115.932] (-1117.042) (-1118.876) (-1116.587) -- 0:02:21
257500 -- [-1114.105] (-1118.173) (-1110.746) (-1112.042) * (-1117.799) (-1115.208) (-1116.592) [-1116.995] -- 0:02:21
258000 -- (-1115.093) (-1119.254) [-1115.011] (-1113.705) * (-1124.083) (-1111.634) (-1115.046) [-1115.101] -- 0:02:20
258500 -- (-1120.129) (-1115.223) (-1115.074) [-1110.735] * (-1113.572) (-1115.458) (-1114.171) [-1118.403] -- 0:02:20
259000 -- (-1120.757) (-1111.983) (-1114.002) [-1111.414] * (-1116.321) [-1112.586] (-1113.579) (-1114.884) -- 0:02:23
259500 -- (-1117.630) [-1115.380] (-1113.458) (-1114.898) * (-1126.099) (-1113.075) [-1107.582] (-1118.039) -- 0:02:22
260000 -- [-1117.253] (-1113.341) (-1114.077) (-1119.992) * (-1116.111) [-1116.899] (-1114.008) (-1121.622) -- 0:02:22
Average standard deviation of split frequencies: 0.003014
260500 -- (-1116.158) (-1114.872) [-1115.142] (-1114.057) * (-1119.938) (-1114.285) [-1113.880] (-1114.857) -- 0:02:21
261000 -- (-1117.306) [-1120.379] (-1117.849) (-1113.138) * (-1118.127) (-1111.509) [-1113.836] (-1119.837) -- 0:02:21
261500 -- (-1120.239) [-1114.817] (-1114.170) (-1116.582) * (-1107.029) [-1112.515] (-1111.508) (-1114.010) -- 0:02:21
262000 -- (-1120.805) [-1115.954] (-1118.672) (-1115.576) * [-1108.706] (-1121.993) (-1113.543) (-1117.380) -- 0:02:20
262500 -- (-1115.234) (-1115.457) (-1117.582) [-1110.181] * (-1120.083) (-1118.616) (-1117.314) [-1117.782] -- 0:02:20
263000 -- (-1115.038) [-1113.246] (-1113.500) (-1122.870) * (-1115.404) [-1115.454] (-1132.403) (-1120.281) -- 0:02:20
263500 -- (-1114.636) [-1115.140] (-1119.841) (-1116.684) * (-1109.867) [-1111.905] (-1118.374) (-1119.045) -- 0:02:19
264000 -- (-1117.738) (-1119.754) (-1118.134) [-1116.025] * (-1111.764) [-1112.524] (-1109.419) (-1118.976) -- 0:02:19
264500 -- (-1111.094) (-1116.990) (-1122.220) [-1113.453] * (-1119.593) [-1114.740] (-1119.447) (-1123.559) -- 0:02:21
265000 -- [-1114.919] (-1124.054) (-1115.258) (-1114.081) * (-1111.643) (-1112.894) (-1127.623) [-1122.442] -- 0:02:21
Average standard deviation of split frequencies: 0.002954
265500 -- (-1111.707) (-1120.571) [-1119.910] (-1109.483) * (-1112.701) (-1113.255) [-1109.949] (-1119.076) -- 0:02:21
266000 -- (-1113.942) (-1114.443) (-1117.646) [-1108.111] * [-1117.868] (-1119.122) (-1113.310) (-1119.459) -- 0:02:20
266500 -- (-1114.963) [-1111.018] (-1109.938) (-1109.502) * (-1116.319) (-1108.430) [-1114.397] (-1116.854) -- 0:02:20
267000 -- (-1118.750) (-1115.332) (-1111.678) [-1112.324] * [-1112.750] (-1112.254) (-1118.734) (-1113.958) -- 0:02:20
267500 -- (-1119.534) (-1120.506) (-1111.369) [-1110.514] * (-1117.725) [-1114.242] (-1123.502) (-1110.616) -- 0:02:19
268000 -- (-1115.085) [-1109.167] (-1118.731) (-1115.064) * (-1115.647) (-1117.419) [-1111.960] (-1111.397) -- 0:02:19
268500 -- [-1113.561] (-1119.901) (-1108.890) (-1109.608) * (-1115.784) (-1112.455) [-1113.062] (-1122.181) -- 0:02:18
269000 -- (-1113.688) (-1116.704) [-1117.757] (-1114.211) * (-1108.792) (-1123.220) [-1116.458] (-1116.179) -- 0:02:18
269500 -- [-1112.521] (-1120.446) (-1121.334) (-1112.165) * (-1122.501) (-1118.728) [-1115.975] (-1122.239) -- 0:02:20
270000 -- (-1122.580) (-1112.219) (-1115.110) [-1118.792] * [-1112.600] (-1117.598) (-1110.959) (-1125.736) -- 0:02:20
Average standard deviation of split frequencies: 0.004644
270500 -- [-1114.056] (-1119.988) (-1117.103) (-1114.201) * [-1111.061] (-1123.582) (-1115.023) (-1116.155) -- 0:02:20
271000 -- (-1120.455) [-1111.042] (-1115.629) (-1120.104) * (-1115.380) (-1115.165) [-1112.538] (-1114.582) -- 0:02:19
271500 -- (-1123.523) (-1111.943) (-1118.682) [-1112.956] * (-1120.001) (-1117.347) [-1111.995] (-1117.316) -- 0:02:19
272000 -- [-1120.802] (-1110.838) (-1112.763) (-1112.802) * (-1111.524) (-1122.129) [-1116.882] (-1118.536) -- 0:02:19
272500 -- (-1114.097) (-1118.765) (-1110.813) [-1113.429] * [-1114.048] (-1115.463) (-1114.898) (-1121.419) -- 0:02:18
273000 -- (-1117.190) (-1115.629) (-1113.738) [-1116.450] * (-1110.763) (-1111.912) (-1115.826) [-1112.891] -- 0:02:18
273500 -- (-1114.767) (-1113.524) [-1112.100] (-1115.837) * (-1123.410) [-1114.610] (-1112.033) (-1109.856) -- 0:02:18
274000 -- (-1115.756) (-1114.445) (-1115.241) [-1121.027] * (-1117.981) (-1113.253) [-1111.341] (-1112.393) -- 0:02:17
274500 -- (-1119.129) (-1111.445) [-1108.199] (-1118.602) * (-1116.027) (-1113.895) [-1113.439] (-1108.228) -- 0:02:17
275000 -- (-1115.388) (-1121.481) [-1115.470] (-1122.096) * (-1115.966) [-1109.272] (-1107.719) (-1113.136) -- 0:02:19
Average standard deviation of split frequencies: 0.003985
275500 -- [-1113.295] (-1118.346) (-1120.590) (-1110.719) * (-1113.030) (-1116.184) (-1114.627) [-1112.990] -- 0:02:19
276000 -- (-1112.986) (-1117.261) (-1119.110) [-1109.225] * (-1121.388) (-1122.641) (-1120.109) [-1112.557] -- 0:02:19
276500 -- [-1115.901] (-1123.007) (-1122.644) (-1113.689) * [-1116.695] (-1126.238) (-1116.870) (-1112.878) -- 0:02:18
277000 -- (-1116.817) (-1111.914) (-1125.491) [-1111.208] * (-1117.336) (-1111.504) (-1114.381) [-1114.226] -- 0:02:18
277500 -- (-1117.720) (-1124.907) (-1112.572) [-1114.403] * (-1114.108) (-1113.088) [-1108.667] (-1115.236) -- 0:02:17
278000 -- (-1111.193) (-1120.312) (-1118.728) [-1114.492] * (-1109.224) (-1110.148) [-1110.553] (-1117.535) -- 0:02:17
278500 -- (-1113.841) (-1114.569) (-1118.989) [-1114.650] * (-1116.507) (-1114.503) (-1116.713) [-1115.736] -- 0:02:17
279000 -- (-1122.049) (-1119.684) [-1116.891] (-1121.871) * (-1111.786) (-1119.168) [-1108.106] (-1119.802) -- 0:02:16
279500 -- (-1114.926) [-1118.505] (-1122.556) (-1125.102) * [-1111.579] (-1118.199) (-1120.361) (-1114.391) -- 0:02:16
280000 -- (-1119.511) (-1113.980) [-1114.578] (-1119.510) * (-1109.444) (-1117.062) (-1120.212) [-1112.774] -- 0:02:18
Average standard deviation of split frequencies: 0.003919
280500 -- (-1117.926) (-1121.132) (-1116.755) [-1114.066] * [-1113.470] (-1107.541) (-1114.903) (-1115.153) -- 0:02:18
281000 -- (-1123.236) (-1109.257) [-1114.537] (-1124.216) * (-1111.188) (-1120.048) (-1113.317) [-1114.237] -- 0:02:18
281500 -- (-1111.636) (-1116.161) [-1112.840] (-1120.805) * (-1110.202) (-1109.985) (-1114.232) [-1108.779] -- 0:02:17
282000 -- [-1107.899] (-1111.713) (-1115.102) (-1115.605) * (-1125.428) (-1113.778) [-1110.151] (-1116.066) -- 0:02:17
282500 -- (-1110.213) [-1112.452] (-1111.402) (-1111.835) * (-1109.767) (-1114.968) (-1115.421) [-1111.776] -- 0:02:17
283000 -- (-1112.539) (-1125.572) [-1121.866] (-1112.141) * [-1116.472] (-1111.079) (-1114.973) (-1118.006) -- 0:02:16
283500 -- (-1113.734) (-1113.795) [-1111.223] (-1111.260) * (-1116.045) [-1114.551] (-1125.195) (-1114.228) -- 0:02:16
284000 -- [-1116.615] (-1112.038) (-1119.502) (-1117.279) * [-1124.218] (-1112.156) (-1115.259) (-1117.751) -- 0:02:16
284500 -- (-1115.348) (-1113.472) (-1117.888) [-1110.201] * (-1121.763) (-1121.525) (-1115.525) [-1110.152] -- 0:02:15
285000 -- (-1119.763) (-1112.705) (-1115.458) [-1115.368] * (-1119.867) (-1122.237) [-1115.799] (-1115.172) -- 0:02:15
Average standard deviation of split frequencies: 0.004945
285500 -- (-1118.167) [-1113.594] (-1114.756) (-1122.788) * (-1113.016) [-1115.046] (-1118.565) (-1116.735) -- 0:02:17
286000 -- (-1115.445) [-1115.057] (-1110.710) (-1121.139) * (-1116.726) [-1113.545] (-1111.280) (-1121.408) -- 0:02:17
286500 -- (-1126.046) [-1115.344] (-1110.187) (-1129.185) * (-1120.637) (-1116.878) [-1113.020] (-1126.544) -- 0:02:16
287000 -- (-1126.333) [-1108.306] (-1118.706) (-1124.830) * (-1116.187) (-1114.097) [-1111.491] (-1110.998) -- 0:02:16
287500 -- (-1116.183) [-1110.095] (-1110.635) (-1122.492) * (-1117.951) [-1109.935] (-1113.886) (-1114.258) -- 0:02:16
288000 -- [-1115.845] (-1114.580) (-1113.241) (-1120.426) * (-1121.567) (-1115.168) (-1112.632) [-1121.573] -- 0:02:15
288500 -- (-1116.259) (-1110.934) [-1114.040] (-1110.709) * (-1119.143) (-1112.388) [-1112.877] (-1118.914) -- 0:02:15
289000 -- (-1123.855) (-1113.288) (-1108.220) [-1111.483] * (-1116.583) [-1110.650] (-1114.373) (-1113.252) -- 0:02:15
289500 -- (-1120.152) (-1113.971) [-1118.866] (-1122.457) * (-1118.947) [-1112.687] (-1115.398) (-1116.822) -- 0:02:14
290000 -- (-1112.986) [-1114.498] (-1120.728) (-1107.234) * (-1122.202) (-1111.776) [-1112.541] (-1115.559) -- 0:02:14
Average standard deviation of split frequencies: 0.004865
290500 -- (-1112.999) [-1114.456] (-1118.864) (-1112.897) * (-1127.983) [-1119.916] (-1115.644) (-1116.144) -- 0:02:16
291000 -- (-1110.635) [-1111.617] (-1113.500) (-1107.496) * (-1129.401) (-1112.289) [-1112.651] (-1111.748) -- 0:02:16
291500 -- (-1111.109) (-1115.514) [-1121.256] (-1117.712) * (-1107.713) (-1115.496) [-1111.542] (-1122.744) -- 0:02:16
292000 -- [-1115.009] (-1116.193) (-1129.683) (-1109.320) * (-1116.434) (-1114.694) (-1115.993) [-1110.206] -- 0:02:15
292500 -- [-1114.678] (-1113.034) (-1117.279) (-1111.195) * (-1111.311) (-1115.115) [-1110.571] (-1114.639) -- 0:02:15
293000 -- (-1110.804) [-1111.025] (-1121.249) (-1113.456) * (-1114.006) (-1115.264) (-1112.230) [-1110.602] -- 0:02:15
293500 -- (-1111.275) (-1115.344) (-1122.855) [-1111.997] * [-1113.520] (-1120.066) (-1116.751) (-1118.103) -- 0:02:14
294000 -- (-1111.779) [-1111.823] (-1122.965) (-1113.157) * [-1113.597] (-1122.919) (-1117.229) (-1113.856) -- 0:02:14
294500 -- [-1111.616] (-1114.725) (-1119.960) (-1111.888) * (-1114.102) (-1110.768) (-1116.259) [-1113.852] -- 0:02:14
295000 -- (-1113.209) (-1117.219) [-1116.680] (-1111.786) * (-1119.104) (-1111.986) (-1118.362) [-1114.195] -- 0:02:13
Average standard deviation of split frequencies: 0.005839
295500 -- (-1123.501) (-1118.695) (-1113.677) [-1114.432] * (-1114.516) (-1114.748) [-1121.697] (-1119.699) -- 0:02:13
296000 -- (-1117.080) (-1115.721) [-1118.203] (-1119.562) * (-1113.591) [-1113.110] (-1111.568) (-1116.811) -- 0:02:15
296500 -- (-1110.924) (-1113.951) [-1115.526] (-1114.934) * (-1118.695) (-1113.494) (-1112.111) [-1109.536] -- 0:02:15
297000 -- (-1114.231) [-1118.018] (-1117.990) (-1113.534) * (-1118.661) [-1113.897] (-1116.311) (-1111.831) -- 0:02:14
297500 -- [-1117.322] (-1111.165) (-1121.937) (-1117.429) * (-1118.447) (-1114.132) (-1114.066) [-1112.278] -- 0:02:14
298000 -- [-1114.610] (-1112.128) (-1116.665) (-1120.454) * (-1112.609) (-1113.236) [-1117.376] (-1113.247) -- 0:02:14
298500 -- (-1114.980) (-1114.539) (-1117.947) [-1115.259] * (-1121.274) (-1109.903) [-1115.432] (-1114.567) -- 0:02:13
299000 -- [-1114.716] (-1115.284) (-1115.413) (-1117.276) * (-1120.128) (-1115.440) [-1111.277] (-1117.399) -- 0:02:13
299500 -- [-1109.950] (-1114.401) (-1112.168) (-1113.987) * (-1122.975) (-1121.237) [-1105.409] (-1116.182) -- 0:02:13
300000 -- (-1118.204) (-1109.364) (-1116.296) [-1118.871] * (-1123.374) (-1114.689) (-1115.063) [-1123.240] -- 0:02:13
Average standard deviation of split frequencies: 0.005749
300500 -- [-1111.445] (-1114.037) (-1117.652) (-1119.870) * [-1123.192] (-1114.672) (-1111.429) (-1115.599) -- 0:02:12
301000 -- (-1119.624) (-1115.342) [-1116.532] (-1117.305) * (-1113.229) [-1112.172] (-1109.321) (-1122.563) -- 0:02:12
301500 -- [-1111.365] (-1113.756) (-1109.653) (-1114.130) * (-1118.205) [-1112.935] (-1109.915) (-1114.953) -- 0:02:14
302000 -- (-1112.112) (-1113.251) [-1113.730] (-1116.251) * (-1116.342) (-1122.108) [-1116.918] (-1114.858) -- 0:02:14
302500 -- (-1111.437) [-1110.341] (-1111.465) (-1115.626) * (-1112.283) (-1114.026) (-1119.526) [-1110.310] -- 0:02:13
303000 -- (-1112.350) [-1118.146] (-1117.005) (-1110.418) * [-1111.474] (-1113.343) (-1120.557) (-1117.136) -- 0:02:13
303500 -- (-1118.167) [-1112.772] (-1116.475) (-1110.428) * [-1112.338] (-1114.946) (-1119.247) (-1123.412) -- 0:02:13
304000 -- (-1118.082) (-1111.261) [-1119.690] (-1113.209) * (-1110.142) [-1110.537] (-1112.722) (-1120.641) -- 0:02:12
304500 -- [-1111.331] (-1111.587) (-1114.821) (-1118.545) * (-1112.233) [-1114.595] (-1113.180) (-1119.163) -- 0:02:12
305000 -- (-1118.570) (-1121.465) [-1122.020] (-1112.391) * (-1120.543) (-1115.294) (-1116.200) [-1114.923] -- 0:02:12
Average standard deviation of split frequencies: 0.004108
305500 -- (-1119.824) (-1118.306) (-1117.121) [-1106.692] * (-1113.764) (-1112.233) (-1121.934) [-1114.521] -- 0:02:11
306000 -- (-1124.401) (-1115.710) (-1119.843) [-1113.930] * (-1118.009) [-1113.080] (-1116.022) (-1124.175) -- 0:02:11
306500 -- [-1119.617] (-1114.240) (-1117.257) (-1123.570) * [-1115.922] (-1111.300) (-1117.535) (-1117.362) -- 0:02:13
307000 -- (-1124.535) [-1109.186] (-1117.746) (-1125.827) * (-1120.760) [-1110.018] (-1115.426) (-1109.384) -- 0:02:13
307500 -- (-1119.723) [-1114.281] (-1117.347) (-1115.724) * (-1123.643) [-1118.974] (-1118.638) (-1115.606) -- 0:02:12
308000 -- (-1122.729) (-1116.843) [-1117.436] (-1107.039) * [-1122.408] (-1119.057) (-1112.478) (-1111.597) -- 0:02:12
308500 -- (-1120.600) [-1117.830] (-1115.660) (-1118.287) * (-1118.616) (-1119.668) (-1118.413) [-1107.321] -- 0:02:12
309000 -- (-1114.753) [-1107.718] (-1115.361) (-1116.393) * [-1113.936] (-1114.786) (-1130.433) (-1116.866) -- 0:02:11
309500 -- (-1117.834) (-1120.322) (-1107.862) [-1114.802] * [-1115.426] (-1115.962) (-1119.414) (-1114.581) -- 0:02:11
310000 -- (-1115.885) (-1117.868) [-1114.286] (-1119.367) * (-1114.686) (-1119.470) (-1121.494) [-1115.791] -- 0:02:11
Average standard deviation of split frequencies: 0.004046
310500 -- [-1110.888] (-1112.118) (-1115.548) (-1118.822) * (-1116.113) [-1110.918] (-1114.468) (-1111.475) -- 0:02:11
311000 -- [-1116.037] (-1116.536) (-1120.847) (-1112.259) * (-1113.334) (-1112.218) [-1118.668] (-1111.718) -- 0:02:10
311500 -- (-1121.795) (-1115.179) (-1119.811) [-1119.287] * (-1115.027) (-1118.808) [-1117.002] (-1121.178) -- 0:02:10
312000 -- (-1115.664) (-1116.603) (-1111.784) [-1114.387] * (-1113.346) [-1113.625] (-1122.419) (-1115.921) -- 0:02:12
312500 -- (-1113.526) (-1110.295) [-1115.086] (-1116.810) * [-1121.382] (-1114.042) (-1110.689) (-1116.092) -- 0:02:12
313000 -- (-1113.458) [-1112.986] (-1113.417) (-1116.994) * (-1117.755) (-1117.961) (-1113.496) [-1114.449] -- 0:02:11
313500 -- (-1112.018) (-1110.408) [-1115.205] (-1114.203) * (-1110.033) (-1111.500) (-1116.349) [-1117.062] -- 0:02:11
314000 -- (-1110.743) (-1120.219) (-1116.629) [-1115.964] * (-1114.048) [-1110.308] (-1116.057) (-1117.361) -- 0:02:11
314500 -- (-1113.940) (-1113.813) (-1110.321) [-1112.191] * (-1112.540) (-1106.809) [-1115.859] (-1113.538) -- 0:02:10
315000 -- (-1113.726) (-1120.036) [-1112.345] (-1113.834) * (-1116.337) (-1119.038) (-1126.737) [-1116.127] -- 0:02:10
Average standard deviation of split frequencies: 0.002984
315500 -- [-1113.673] (-1119.358) (-1113.632) (-1111.906) * (-1114.738) [-1111.359] (-1115.290) (-1111.839) -- 0:02:10
316000 -- [-1115.381] (-1115.518) (-1111.301) (-1119.534) * (-1113.420) (-1116.173) (-1119.111) [-1116.038] -- 0:02:09
316500 -- (-1118.051) [-1115.144] (-1111.880) (-1113.087) * (-1117.214) (-1122.032) [-1109.933] (-1110.939) -- 0:02:09
317000 -- (-1115.805) (-1119.055) [-1111.643] (-1111.102) * (-1115.370) (-1118.712) [-1113.656] (-1114.757) -- 0:02:11
317500 -- (-1115.228) [-1120.385] (-1117.045) (-1123.189) * (-1113.103) (-1112.241) (-1110.405) [-1110.369] -- 0:02:11
318000 -- (-1119.958) [-1114.807] (-1113.873) (-1113.881) * (-1114.166) [-1111.957] (-1111.106) (-1113.942) -- 0:02:10
318500 -- (-1115.552) (-1126.881) (-1117.406) [-1112.468] * (-1108.858) [-1109.975] (-1121.951) (-1116.040) -- 0:02:10
319000 -- (-1118.241) (-1123.939) [-1112.419] (-1113.575) * (-1116.732) (-1117.705) (-1113.030) [-1109.419] -- 0:02:10
319500 -- (-1117.951) (-1120.471) [-1110.392] (-1129.004) * (-1113.590) (-1126.678) (-1116.602) [-1110.468] -- 0:02:09
320000 -- (-1115.509) (-1125.992) (-1109.988) [-1116.473] * [-1115.939] (-1115.763) (-1113.493) (-1113.196) -- 0:02:09
Average standard deviation of split frequencies: 0.002940
320500 -- (-1112.107) (-1126.766) (-1113.626) [-1108.493] * [-1117.365] (-1119.669) (-1117.255) (-1119.582) -- 0:02:09
321000 -- (-1121.054) (-1123.092) (-1115.439) [-1109.547] * (-1115.274) [-1120.162] (-1115.326) (-1121.631) -- 0:02:09
321500 -- (-1111.199) (-1120.727) (-1113.716) [-1111.951] * (-1114.999) [-1124.154] (-1112.634) (-1114.524) -- 0:02:08
322000 -- (-1109.699) [-1113.985] (-1113.216) (-1121.355) * [-1112.495] (-1116.761) (-1114.107) (-1113.234) -- 0:02:08
322500 -- (-1115.344) (-1119.406) [-1109.685] (-1113.293) * (-1109.755) [-1114.416] (-1112.721) (-1116.087) -- 0:02:10
323000 -- [-1111.780] (-1120.918) (-1116.808) (-1114.179) * [-1111.607] (-1119.165) (-1115.298) (-1121.600) -- 0:02:09
323500 -- (-1114.073) [-1113.328] (-1111.377) (-1113.832) * [-1110.731] (-1121.586) (-1119.323) (-1109.448) -- 0:02:09
324000 -- [-1117.133] (-1117.060) (-1113.636) (-1110.413) * (-1115.678) (-1112.532) (-1115.949) [-1111.227] -- 0:02:09
324500 -- (-1109.729) (-1113.752) (-1110.510) [-1110.483] * (-1118.691) (-1128.041) (-1109.935) [-1114.666] -- 0:02:09
325000 -- (-1112.086) (-1113.557) [-1117.557] (-1118.241) * (-1114.693) (-1121.202) (-1111.980) [-1111.937] -- 0:02:08
Average standard deviation of split frequencies: 0.001928
325500 -- (-1116.264) (-1108.269) [-1112.994] (-1111.771) * (-1107.960) (-1116.199) (-1108.384) [-1112.956] -- 0:02:08
326000 -- (-1117.241) (-1114.992) (-1109.904) [-1114.306] * (-1112.769) (-1110.558) (-1107.477) [-1113.069] -- 0:02:08
326500 -- (-1117.805) [-1109.780] (-1114.974) (-1114.149) * (-1113.122) [-1113.466] (-1113.704) (-1123.519) -- 0:02:07
327000 -- (-1116.454) [-1113.424] (-1112.456) (-1107.721) * [-1109.626] (-1119.969) (-1113.737) (-1121.184) -- 0:02:07
327500 -- (-1112.650) (-1115.937) [-1114.482] (-1109.617) * (-1109.690) (-1119.543) (-1115.807) [-1112.903] -- 0:02:09
328000 -- (-1114.210) [-1115.279] (-1114.685) (-1114.885) * (-1111.940) [-1116.305] (-1119.601) (-1113.249) -- 0:02:09
328500 -- [-1114.229] (-1121.301) (-1119.862) (-1111.124) * (-1117.633) (-1120.004) (-1115.878) [-1114.068] -- 0:02:08
329000 -- [-1114.366] (-1115.353) (-1116.508) (-1115.594) * (-1116.707) [-1121.218] (-1112.602) (-1121.372) -- 0:02:08
329500 -- (-1118.799) (-1117.261) (-1115.317) [-1114.292] * [-1113.804] (-1112.875) (-1113.272) (-1117.187) -- 0:02:08
330000 -- (-1114.641) (-1126.186) (-1114.895) [-1115.459] * [-1116.077] (-1114.194) (-1114.859) (-1118.575) -- 0:02:07
Average standard deviation of split frequencies: 0.002851
330500 -- (-1118.605) (-1116.710) [-1110.609] (-1116.339) * (-1109.073) [-1114.946] (-1114.022) (-1112.608) -- 0:02:07
331000 -- (-1112.216) (-1116.375) (-1115.800) [-1113.822] * [-1120.616] (-1119.513) (-1121.249) (-1112.835) -- 0:02:07
331500 -- (-1122.776) (-1120.014) (-1123.081) [-1112.333] * (-1114.747) (-1118.981) (-1116.769) [-1117.091] -- 0:02:07
332000 -- (-1115.882) (-1127.360) (-1114.254) [-1111.352] * (-1116.580) [-1118.256] (-1113.213) (-1109.767) -- 0:02:06
332500 -- (-1125.844) (-1115.860) [-1118.361] (-1121.823) * (-1119.193) [-1113.577] (-1115.331) (-1117.454) -- 0:02:06
333000 -- (-1114.398) [-1111.316] (-1112.239) (-1114.808) * (-1111.412) [-1121.461] (-1111.270) (-1114.430) -- 0:02:08
333500 -- [-1117.586] (-1107.376) (-1116.671) (-1121.365) * (-1112.087) (-1117.861) (-1111.108) [-1110.656] -- 0:02:07
334000 -- [-1124.249] (-1113.694) (-1120.334) (-1117.687) * (-1116.135) [-1114.205] (-1113.549) (-1110.845) -- 0:02:07
334500 -- (-1121.771) (-1122.362) [-1118.030] (-1111.477) * (-1113.304) [-1119.198] (-1109.875) (-1119.791) -- 0:02:07
335000 -- (-1121.787) (-1117.735) (-1124.539) [-1106.848] * (-1125.820) [-1112.487] (-1114.123) (-1113.581) -- 0:02:07
Average standard deviation of split frequencies: 0.003741
335500 -- (-1118.078) (-1110.815) [-1113.648] (-1114.009) * (-1114.496) (-1111.452) [-1112.463] (-1113.354) -- 0:02:06
336000 -- (-1121.987) [-1127.129] (-1115.516) (-1116.486) * (-1111.418) (-1106.640) (-1115.872) [-1109.414] -- 0:02:06
336500 -- (-1121.826) [-1115.006] (-1118.693) (-1112.614) * [-1111.299] (-1117.434) (-1119.042) (-1118.931) -- 0:02:06
337000 -- (-1122.686) (-1120.898) [-1116.221] (-1110.192) * (-1117.982) (-1122.837) [-1113.815] (-1111.210) -- 0:02:05
337500 -- (-1117.225) (-1112.649) (-1117.737) [-1118.372] * (-1119.291) [-1114.537] (-1115.294) (-1116.874) -- 0:02:05
338000 -- (-1116.082) [-1114.759] (-1116.009) (-1113.947) * (-1113.218) (-1113.497) [-1117.200] (-1113.338) -- 0:02:05
338500 -- (-1113.660) (-1109.053) (-1111.562) [-1116.003] * (-1114.181) (-1113.522) (-1115.520) [-1113.705] -- 0:02:07
339000 -- [-1114.071] (-1123.360) (-1118.356) (-1112.396) * [-1109.635] (-1117.436) (-1117.338) (-1116.072) -- 0:02:06
339500 -- (-1113.485) (-1123.114) [-1119.682] (-1122.719) * (-1112.935) (-1119.947) [-1114.808] (-1113.263) -- 0:02:06
340000 -- [-1114.255] (-1114.090) (-1129.712) (-1115.560) * (-1115.608) (-1120.300) [-1113.299] (-1117.759) -- 0:02:06
Average standard deviation of split frequencies: 0.005074
340500 -- (-1111.209) (-1116.309) (-1125.028) [-1113.919] * [-1110.675] (-1125.535) (-1115.057) (-1118.235) -- 0:02:05
341000 -- [-1118.497] (-1115.973) (-1121.877) (-1111.262) * (-1111.759) (-1113.491) [-1112.590] (-1127.715) -- 0:02:05
341500 -- (-1115.737) [-1111.495] (-1124.500) (-1116.909) * (-1119.429) [-1113.134] (-1109.431) (-1125.600) -- 0:02:05
342000 -- (-1116.919) (-1113.641) (-1124.298) [-1115.935] * (-1115.394) (-1113.178) [-1111.657] (-1126.622) -- 0:02:05
342500 -- (-1114.125) [-1111.021] (-1116.707) (-1117.566) * [-1111.367] (-1115.558) (-1112.273) (-1125.282) -- 0:02:04
343000 -- (-1114.193) [-1114.975] (-1112.783) (-1122.443) * (-1119.450) (-1119.977) (-1112.797) [-1121.763] -- 0:02:04
343500 -- (-1115.897) (-1117.689) (-1118.477) [-1112.206] * [-1114.107] (-1120.786) (-1117.528) (-1115.762) -- 0:02:06
344000 -- (-1113.773) (-1121.294) [-1107.818] (-1113.239) * (-1122.599) [-1112.049] (-1118.496) (-1119.013) -- 0:02:05
344500 -- [-1113.745] (-1116.682) (-1110.670) (-1117.799) * (-1116.337) [-1113.793] (-1112.224) (-1114.381) -- 0:02:05
345000 -- (-1125.574) (-1115.761) [-1116.139] (-1115.471) * [-1113.674] (-1109.277) (-1116.662) (-1112.408) -- 0:02:05
Average standard deviation of split frequencies: 0.004996
345500 -- [-1113.228] (-1117.559) (-1118.234) (-1125.637) * (-1120.468) (-1113.253) [-1121.173] (-1118.451) -- 0:02:05
346000 -- (-1117.039) [-1118.809] (-1116.424) (-1114.961) * (-1115.556) [-1113.882] (-1117.617) (-1130.407) -- 0:02:04
346500 -- [-1111.203] (-1117.657) (-1116.371) (-1111.178) * (-1116.519) [-1115.714] (-1122.292) (-1120.529) -- 0:02:04
347000 -- (-1110.522) [-1110.962] (-1116.603) (-1121.400) * [-1116.885] (-1115.349) (-1125.142) (-1122.177) -- 0:02:04
347500 -- (-1111.814) [-1111.237] (-1122.526) (-1118.226) * [-1114.461] (-1118.438) (-1115.706) (-1114.032) -- 0:02:03
348000 -- (-1119.851) (-1114.014) (-1109.693) [-1115.100] * (-1112.519) (-1111.548) [-1115.656] (-1116.686) -- 0:02:03
348500 -- [-1117.207] (-1117.601) (-1113.793) (-1119.979) * [-1116.487] (-1111.927) (-1115.823) (-1113.043) -- 0:02:05
349000 -- (-1122.344) (-1117.773) [-1118.591] (-1117.103) * (-1108.147) [-1108.576] (-1114.028) (-1114.902) -- 0:02:04
349500 -- (-1118.972) [-1112.528] (-1117.689) (-1112.046) * (-1110.733) [-1117.764] (-1129.133) (-1115.165) -- 0:02:04
350000 -- (-1118.806) (-1111.313) (-1121.771) [-1117.519] * [-1121.803] (-1111.984) (-1115.956) (-1115.905) -- 0:02:04
Average standard deviation of split frequencies: 0.003585
350500 -- (-1114.771) (-1119.961) (-1116.704) [-1115.259] * (-1119.007) [-1112.720] (-1124.918) (-1115.260) -- 0:02:04
351000 -- (-1121.726) (-1117.233) (-1113.366) [-1113.034] * (-1114.800) (-1113.513) [-1113.170] (-1123.277) -- 0:02:03
351500 -- (-1113.213) (-1124.558) (-1110.530) [-1116.148] * (-1113.573) (-1114.742) [-1113.572] (-1114.085) -- 0:02:03
352000 -- [-1115.779] (-1126.821) (-1111.080) (-1113.612) * [-1111.849] (-1113.988) (-1116.121) (-1121.109) -- 0:02:03
352500 -- [-1111.383] (-1115.781) (-1119.943) (-1124.325) * (-1118.075) [-1115.815] (-1113.313) (-1121.826) -- 0:02:03
353000 -- (-1111.685) (-1116.539) (-1110.127) [-1111.756] * (-1111.754) (-1114.976) (-1113.370) [-1115.083] -- 0:02:02
353500 -- (-1109.566) (-1115.883) [-1111.127] (-1122.246) * (-1119.263) (-1112.092) [-1113.535] (-1112.183) -- 0:02:04
354000 -- (-1114.324) [-1111.709] (-1112.501) (-1115.046) * [-1109.057] (-1123.034) (-1115.595) (-1114.519) -- 0:02:04
354500 -- (-1124.131) (-1113.012) [-1113.937] (-1111.041) * [-1113.080] (-1113.613) (-1117.642) (-1119.205) -- 0:02:03
355000 -- (-1120.121) (-1125.743) (-1125.428) [-1114.613] * (-1119.978) [-1113.199] (-1123.355) (-1113.498) -- 0:02:03
Average standard deviation of split frequencies: 0.004855
355500 -- (-1122.283) (-1116.622) [-1110.404] (-1110.170) * (-1116.986) (-1120.687) (-1115.026) [-1111.106] -- 0:02:03
356000 -- (-1117.746) [-1112.661] (-1112.895) (-1119.323) * (-1118.573) (-1113.914) [-1115.322] (-1123.451) -- 0:02:03
356500 -- (-1110.160) (-1120.756) (-1115.150) [-1114.283] * (-1112.678) [-1113.102] (-1119.013) (-1119.218) -- 0:02:02
357000 -- (-1110.215) (-1115.793) (-1116.165) [-1111.209] * (-1121.062) (-1114.724) (-1119.081) [-1114.879] -- 0:02:02
357500 -- [-1110.519] (-1112.667) (-1110.990) (-1110.081) * [-1123.904] (-1116.207) (-1116.522) (-1113.135) -- 0:02:02
358000 -- (-1115.504) (-1111.411) (-1110.974) [-1112.457] * (-1113.875) (-1118.785) (-1116.355) [-1107.713] -- 0:02:01
358500 -- (-1112.166) (-1118.555) [-1112.013] (-1114.034) * (-1117.403) (-1111.827) (-1118.250) [-1114.566] -- 0:02:01
359000 -- (-1119.046) [-1115.007] (-1116.794) (-1117.795) * [-1121.107] (-1122.842) (-1116.866) (-1116.151) -- 0:02:03
359500 -- (-1118.230) [-1115.275] (-1115.315) (-1121.202) * (-1116.684) [-1112.967] (-1114.888) (-1117.815) -- 0:02:02
360000 -- (-1114.078) [-1115.539] (-1115.005) (-1117.491) * (-1113.294) (-1116.181) [-1112.990] (-1121.614) -- 0:02:02
Average standard deviation of split frequencies: 0.004792
360500 -- (-1124.468) [-1110.562] (-1114.520) (-1120.913) * (-1120.537) (-1107.953) [-1112.765] (-1121.279) -- 0:02:02
361000 -- (-1126.236) [-1114.986] (-1124.959) (-1118.425) * (-1113.580) [-1120.812] (-1118.017) (-1125.930) -- 0:02:02
361500 -- (-1125.601) [-1113.491] (-1116.008) (-1111.507) * (-1122.687) [-1113.441] (-1116.897) (-1119.961) -- 0:02:01
362000 -- (-1121.643) (-1115.693) (-1118.956) [-1112.202] * [-1114.326] (-1108.937) (-1117.459) (-1122.227) -- 0:02:01
362500 -- (-1122.029) [-1117.805] (-1114.562) (-1113.494) * (-1116.116) [-1114.630] (-1108.419) (-1120.375) -- 0:02:01
363000 -- (-1117.605) [-1108.897] (-1112.617) (-1114.072) * (-1122.779) (-1117.683) (-1115.718) [-1114.557] -- 0:02:01
363500 -- (-1125.405) (-1116.974) [-1116.550] (-1118.776) * [-1116.768] (-1107.915) (-1116.607) (-1112.051) -- 0:02:00
364000 -- (-1117.536) (-1112.361) [-1111.970] (-1114.869) * (-1118.899) (-1115.384) (-1117.417) [-1109.228] -- 0:02:02
364500 -- (-1116.666) [-1111.437] (-1113.037) (-1114.125) * (-1118.008) [-1112.902] (-1116.162) (-1113.561) -- 0:02:02
365000 -- (-1120.861) (-1113.375) (-1120.959) [-1114.447] * (-1115.004) [-1112.259] (-1115.345) (-1115.534) -- 0:02:01
Average standard deviation of split frequencies: 0.003435
365500 -- [-1107.768] (-1111.523) (-1111.243) (-1114.161) * (-1119.559) (-1110.035) [-1113.394] (-1113.864) -- 0:02:01
366000 -- [-1111.648] (-1111.914) (-1110.850) (-1110.277) * (-1116.819) (-1112.650) (-1118.966) [-1112.403] -- 0:02:01
366500 -- (-1115.041) [-1113.923] (-1109.527) (-1114.809) * (-1115.104) (-1112.498) [-1113.452] (-1116.099) -- 0:02:00
367000 -- (-1123.084) (-1115.438) [-1111.137] (-1110.091) * (-1117.773) (-1109.078) (-1110.103) [-1115.845] -- 0:02:00
367500 -- (-1111.156) (-1111.785) [-1114.705] (-1109.977) * (-1108.806) [-1114.023] (-1114.979) (-1115.853) -- 0:02:00
368000 -- (-1114.278) (-1119.787) [-1114.448] (-1111.309) * (-1112.215) [-1119.514] (-1119.918) (-1115.380) -- 0:02:00
368500 -- (-1115.928) (-1115.778) (-1111.538) [-1117.078] * [-1114.529] (-1119.769) (-1109.488) (-1115.958) -- 0:01:59
369000 -- (-1116.098) (-1114.747) [-1109.776] (-1110.536) * (-1111.654) (-1112.712) (-1113.882) [-1111.087] -- 0:01:59
369500 -- (-1112.567) [-1112.900] (-1111.728) (-1115.528) * [-1115.219] (-1123.289) (-1110.357) (-1114.154) -- 0:02:01
370000 -- (-1113.241) [-1111.274] (-1117.729) (-1115.154) * (-1114.014) (-1114.515) [-1116.856] (-1110.315) -- 0:02:00
Average standard deviation of split frequencies: 0.003391
370500 -- (-1112.123) [-1114.621] (-1115.203) (-1122.259) * [-1111.463] (-1116.955) (-1113.746) (-1111.612) -- 0:02:00
371000 -- (-1112.596) (-1118.427) (-1114.765) [-1112.169] * (-1129.365) (-1114.395) [-1110.785] (-1114.033) -- 0:02:00
371500 -- (-1113.828) [-1108.743] (-1121.819) (-1110.755) * (-1110.026) (-1118.564) (-1111.916) [-1116.032] -- 0:02:00
372000 -- (-1115.619) (-1107.604) [-1115.758] (-1119.050) * (-1116.549) [-1115.233] (-1121.885) (-1115.919) -- 0:01:59
372500 -- [-1113.248] (-1113.950) (-1116.989) (-1120.450) * [-1115.509] (-1115.745) (-1123.726) (-1109.884) -- 0:01:59
373000 -- (-1117.709) (-1114.693) [-1119.192] (-1111.659) * [-1108.622] (-1117.831) (-1119.544) (-1110.120) -- 0:01:59
373500 -- (-1116.600) (-1114.348) (-1113.936) [-1111.589] * (-1113.409) [-1113.609] (-1112.075) (-1116.698) -- 0:01:59
374000 -- [-1113.482] (-1116.431) (-1112.630) (-1117.351) * (-1116.294) (-1112.174) [-1109.305] (-1120.751) -- 0:01:58
374500 -- (-1114.397) (-1112.613) (-1117.914) [-1115.632] * [-1112.322] (-1122.601) (-1112.970) (-1116.179) -- 0:01:58
375000 -- (-1117.855) (-1110.839) [-1113.014] (-1115.583) * (-1119.455) (-1120.105) [-1110.621] (-1115.290) -- 0:02:00
Average standard deviation of split frequencies: 0.003343
375500 -- (-1118.860) [-1112.913] (-1114.228) (-1113.599) * (-1119.101) (-1119.529) (-1113.350) [-1113.139] -- 0:01:59
376000 -- (-1111.608) (-1118.405) (-1117.679) [-1114.668] * (-1119.577) (-1113.484) (-1117.741) [-1111.654] -- 0:01:59
376500 -- (-1118.366) (-1117.322) [-1113.201] (-1117.739) * (-1109.263) (-1113.455) (-1114.837) [-1113.888] -- 0:01:59
377000 -- (-1116.107) (-1115.874) [-1113.115] (-1120.429) * (-1117.862) [-1119.716] (-1109.404) (-1118.650) -- 0:01:58
377500 -- (-1113.222) (-1118.705) [-1111.568] (-1123.764) * [-1113.261] (-1116.307) (-1108.381) (-1116.976) -- 0:01:58
378000 -- [-1118.761] (-1121.823) (-1109.538) (-1120.162) * (-1120.322) (-1124.361) [-1118.987] (-1113.356) -- 0:01:58
378500 -- (-1114.853) [-1114.111] (-1114.334) (-1127.953) * (-1116.248) [-1109.240] (-1109.812) (-1115.880) -- 0:01:58
379000 -- (-1126.832) [-1120.075] (-1107.198) (-1114.675) * [-1107.974] (-1111.709) (-1119.082) (-1114.948) -- 0:01:57
379500 -- [-1119.422] (-1114.864) (-1114.005) (-1115.130) * (-1111.960) [-1119.938] (-1112.797) (-1125.314) -- 0:01:57
380000 -- (-1122.064) (-1108.638) (-1111.706) [-1115.288] * (-1112.467) (-1116.547) [-1113.379] (-1116.759) -- 0:01:59
Average standard deviation of split frequencies: 0.004953
380500 -- (-1115.897) (-1110.785) [-1115.741] (-1118.685) * (-1116.593) (-1117.652) [-1113.344] (-1115.070) -- 0:01:58
381000 -- (-1121.185) [-1115.329] (-1123.112) (-1116.766) * [-1122.243] (-1117.569) (-1115.758) (-1113.771) -- 0:01:58
381500 -- (-1117.468) (-1113.963) [-1122.500] (-1116.417) * [-1121.291] (-1122.214) (-1112.002) (-1109.522) -- 0:01:58
382000 -- (-1117.512) [-1113.590] (-1114.414) (-1120.216) * (-1115.748) (-1121.965) (-1118.529) [-1111.009] -- 0:01:58
382500 -- (-1120.081) (-1124.364) (-1111.941) [-1115.686] * [-1119.361] (-1128.605) (-1114.725) (-1116.900) -- 0:01:57
383000 -- [-1118.032] (-1110.834) (-1110.833) (-1111.194) * [-1112.235] (-1109.433) (-1111.466) (-1110.444) -- 0:01:57
383500 -- (-1114.640) (-1112.835) [-1121.167] (-1114.378) * (-1110.126) [-1110.164] (-1120.821) (-1116.815) -- 0:01:57
384000 -- [-1115.046] (-1112.012) (-1118.493) (-1116.525) * (-1112.767) (-1122.562) (-1115.499) [-1115.188] -- 0:01:57
384500 -- (-1119.651) (-1112.596) (-1117.196) [-1113.352] * [-1113.803] (-1114.362) (-1119.429) (-1117.597) -- 0:01:56
385000 -- [-1118.782] (-1110.111) (-1114.444) (-1112.941) * (-1108.913) (-1117.833) (-1118.739) [-1116.788] -- 0:01:56
Average standard deviation of split frequencies: 0.007328
385500 -- (-1115.026) [-1111.586] (-1113.430) (-1124.522) * (-1117.539) (-1113.791) (-1110.277) [-1113.367] -- 0:01:57
386000 -- (-1119.378) (-1117.597) [-1121.656] (-1122.083) * [-1115.506] (-1116.925) (-1112.706) (-1112.133) -- 0:01:57
386500 -- [-1111.952] (-1111.908) (-1120.417) (-1119.508) * (-1115.760) [-1115.972] (-1109.961) (-1111.791) -- 0:01:57
387000 -- (-1117.841) (-1117.424) [-1110.755] (-1112.200) * (-1115.373) (-1125.326) (-1114.483) [-1113.152] -- 0:01:57
387500 -- (-1116.478) (-1120.810) [-1114.732] (-1117.603) * [-1111.775] (-1124.804) (-1116.919) (-1111.319) -- 0:01:56
388000 -- (-1118.608) [-1114.497] (-1117.938) (-1123.294) * (-1123.111) (-1115.834) [-1110.268] (-1108.825) -- 0:01:56
388500 -- (-1117.429) (-1120.701) [-1117.916] (-1120.236) * [-1110.934] (-1127.152) (-1115.115) (-1111.580) -- 0:01:56
389000 -- (-1116.777) (-1115.466) [-1113.526] (-1112.143) * (-1114.247) (-1121.562) [-1119.283] (-1118.434) -- 0:01:56
389500 -- [-1115.658] (-1118.082) (-1121.275) (-1120.582) * [-1115.962] (-1119.740) (-1120.693) (-1116.097) -- 0:01:55
390000 -- (-1109.820) [-1123.016] (-1116.335) (-1118.206) * [-1109.093] (-1114.987) (-1122.168) (-1113.584) -- 0:01:55
Average standard deviation of split frequencies: 0.008044
390500 -- [-1113.136] (-1123.250) (-1117.046) (-1112.127) * (-1116.764) [-1118.135] (-1114.170) (-1119.160) -- 0:01:57
391000 -- (-1116.983) [-1119.937] (-1117.742) (-1118.967) * (-1117.336) [-1112.498] (-1123.388) (-1121.640) -- 0:01:56
391500 -- (-1116.028) (-1117.140) [-1113.905] (-1111.863) * [-1112.496] (-1119.496) (-1110.830) (-1115.394) -- 0:01:56
392000 -- (-1112.277) (-1117.465) (-1111.370) [-1106.967] * (-1118.877) [-1113.915] (-1113.765) (-1119.012) -- 0:01:56
392500 -- (-1113.819) [-1108.162] (-1116.359) (-1112.670) * (-1117.489) (-1113.228) [-1115.646] (-1122.975) -- 0:01:56
393000 -- [-1114.804] (-1113.481) (-1121.059) (-1114.923) * [-1112.546] (-1119.450) (-1114.395) (-1117.545) -- 0:01:55
393500 -- (-1110.709) [-1110.915] (-1115.773) (-1118.138) * (-1112.590) (-1118.785) [-1115.149] (-1122.889) -- 0:01:55
394000 -- (-1115.093) (-1115.483) [-1113.597] (-1115.138) * [-1115.794] (-1119.890) (-1123.963) (-1120.111) -- 0:01:55
394500 -- (-1117.893) (-1118.515) [-1112.415] (-1115.470) * (-1115.456) [-1113.916] (-1116.150) (-1114.901) -- 0:01:55
395000 -- (-1114.302) (-1114.715) [-1111.465] (-1116.716) * (-1122.375) (-1115.089) [-1111.869] (-1118.493) -- 0:01:54
Average standard deviation of split frequencies: 0.007936
395500 -- (-1117.835) (-1109.045) (-1111.516) [-1112.352] * (-1125.159) (-1110.475) [-1109.868] (-1114.623) -- 0:01:54
396000 -- (-1115.537) (-1111.278) (-1119.175) [-1113.114] * (-1122.605) (-1115.692) [-1110.039] (-1114.531) -- 0:01:55
396500 -- (-1122.742) (-1114.540) [-1110.853] (-1112.054) * (-1117.537) (-1112.656) [-1113.236] (-1118.996) -- 0:01:55
397000 -- (-1116.868) (-1111.201) [-1115.713] (-1109.091) * (-1116.947) (-1114.619) [-1110.980] (-1115.006) -- 0:01:55
397500 -- (-1114.446) (-1117.434) [-1116.327] (-1120.081) * [-1117.832] (-1112.992) (-1116.561) (-1113.796) -- 0:01:55
398000 -- [-1110.887] (-1110.836) (-1112.853) (-1129.064) * (-1115.956) [-1113.864] (-1124.052) (-1111.568) -- 0:01:54
398500 -- [-1110.576] (-1112.202) (-1119.169) (-1109.470) * (-1111.719) [-1113.162] (-1116.485) (-1118.878) -- 0:01:54
399000 -- (-1116.055) (-1106.867) [-1116.523] (-1114.605) * [-1110.821] (-1116.575) (-1118.192) (-1111.098) -- 0:01:54
399500 -- (-1120.927) (-1108.623) [-1119.499] (-1110.309) * (-1113.695) (-1110.208) [-1112.820] (-1123.009) -- 0:01:54
400000 -- (-1118.311) (-1116.665) (-1113.071) [-1115.102] * [-1114.561] (-1109.357) (-1118.995) (-1119.553) -- 0:01:54
Average standard deviation of split frequencies: 0.007451
400500 -- [-1118.596] (-1126.703) (-1112.888) (-1112.052) * (-1111.489) (-1111.493) [-1112.671] (-1126.435) -- 0:01:53
401000 -- [-1111.216] (-1117.031) (-1113.097) (-1117.554) * (-1118.213) (-1115.117) (-1119.737) [-1112.895] -- 0:01:53
401500 -- [-1115.348] (-1112.000) (-1119.300) (-1113.872) * (-1114.001) [-1110.014] (-1117.677) (-1115.126) -- 0:01:54
402000 -- (-1116.371) [-1110.217] (-1113.586) (-1125.489) * (-1112.491) [-1110.841] (-1111.084) (-1119.485) -- 0:01:54
402500 -- (-1110.289) (-1111.401) (-1112.754) [-1119.570] * (-1118.850) (-1110.772) (-1119.263) [-1120.924] -- 0:01:54
403000 -- (-1114.866) (-1112.794) (-1116.502) [-1115.471] * (-1114.353) (-1109.833) [-1115.692] (-1112.430) -- 0:01:54
403500 -- [-1115.712] (-1119.024) (-1120.638) (-1113.618) * (-1110.080) (-1109.868) (-1113.623) [-1115.086] -- 0:01:53
404000 -- [-1110.710] (-1112.826) (-1125.891) (-1112.825) * (-1114.405) (-1115.751) [-1113.014] (-1119.855) -- 0:01:53
404500 -- (-1117.601) [-1114.322] (-1128.285) (-1113.953) * [-1115.604] (-1118.434) (-1117.818) (-1117.563) -- 0:01:53
405000 -- [-1110.666] (-1130.719) (-1114.385) (-1115.387) * (-1117.355) (-1112.757) [-1112.455] (-1119.686) -- 0:01:53
Average standard deviation of split frequencies: 0.006967
405500 -- (-1113.421) (-1119.441) (-1115.595) [-1114.774] * (-1115.037) (-1113.206) (-1119.040) [-1115.889] -- 0:01:52
406000 -- (-1118.727) [-1121.083] (-1117.158) (-1115.563) * (-1122.723) (-1116.255) (-1127.862) [-1116.773] -- 0:01:52
406500 -- (-1113.720) (-1113.834) (-1117.765) [-1110.193] * (-1129.110) (-1112.671) [-1111.903] (-1113.455) -- 0:01:53
407000 -- [-1110.222] (-1109.730) (-1121.283) (-1117.442) * (-1120.277) (-1114.290) (-1109.195) [-1112.079] -- 0:01:53
407500 -- (-1112.571) [-1109.887] (-1110.958) (-1109.595) * (-1116.605) (-1111.788) [-1110.585] (-1110.171) -- 0:01:53
408000 -- (-1125.705) (-1111.870) [-1114.956] (-1112.082) * (-1121.329) (-1113.518) (-1123.611) [-1115.928] -- 0:01:53
408500 -- (-1121.519) (-1114.192) [-1116.279] (-1121.349) * (-1123.260) (-1111.353) [-1115.024] (-1115.126) -- 0:01:52
409000 -- (-1122.084) (-1111.681) [-1111.641] (-1112.081) * (-1119.467) (-1109.833) (-1117.861) [-1116.614] -- 0:01:52
409500 -- [-1121.009] (-1112.675) (-1111.771) (-1114.666) * (-1118.552) (-1120.917) [-1115.485] (-1120.619) -- 0:01:52
410000 -- (-1116.566) (-1122.497) [-1112.433] (-1118.954) * (-1116.586) [-1111.299] (-1112.841) (-1115.236) -- 0:01:52
Average standard deviation of split frequencies: 0.006887
410500 -- (-1112.677) [-1112.950] (-1114.837) (-1113.299) * (-1115.295) [-1112.997] (-1122.783) (-1116.990) -- 0:01:52
411000 -- (-1112.507) (-1120.080) (-1120.343) [-1115.505] * [-1115.299] (-1118.224) (-1117.900) (-1115.144) -- 0:01:51
411500 -- (-1108.770) [-1111.995] (-1121.887) (-1113.139) * (-1114.703) (-1117.855) (-1110.491) [-1110.079] -- 0:01:51
412000 -- [-1108.994] (-1114.610) (-1109.121) (-1119.856) * [-1110.237] (-1116.509) (-1110.396) (-1108.500) -- 0:01:52
412500 -- (-1119.793) [-1114.067] (-1115.555) (-1114.774) * [-1108.974] (-1112.816) (-1120.003) (-1117.039) -- 0:01:52
413000 -- (-1116.601) (-1114.772) (-1110.998) [-1119.216] * (-1111.834) (-1118.430) [-1111.737] (-1112.574) -- 0:01:52
413500 -- (-1117.131) (-1117.511) (-1113.547) [-1108.977] * [-1108.665] (-1108.334) (-1112.626) (-1113.594) -- 0:01:52
414000 -- [-1113.014] (-1122.933) (-1114.032) (-1113.137) * (-1115.567) (-1109.921) [-1116.732] (-1113.096) -- 0:01:51
414500 -- (-1114.879) (-1114.205) (-1118.688) [-1120.341] * (-1116.150) [-1110.655] (-1115.484) (-1114.875) -- 0:01:51
415000 -- (-1120.125) [-1112.821] (-1121.343) (-1109.174) * [-1109.699] (-1115.966) (-1116.524) (-1107.405) -- 0:01:51
Average standard deviation of split frequencies: 0.006799
415500 -- (-1116.626) (-1114.211) (-1115.849) [-1108.512] * (-1112.982) (-1114.729) (-1113.022) [-1109.925] -- 0:01:51
416000 -- (-1113.967) [-1113.334] (-1114.062) (-1116.258) * [-1115.750] (-1113.778) (-1115.769) (-1108.269) -- 0:01:50
416500 -- (-1116.541) (-1113.231) (-1110.787) [-1112.227] * [-1110.546] (-1117.973) (-1114.065) (-1116.650) -- 0:01:50
417000 -- (-1117.763) (-1117.706) (-1110.746) [-1110.951] * (-1114.218) [-1114.368] (-1116.290) (-1115.917) -- 0:01:51
417500 -- (-1124.059) [-1124.399] (-1117.329) (-1113.483) * (-1119.215) (-1117.909) (-1115.464) [-1113.816] -- 0:01:51
418000 -- (-1111.439) [-1115.232] (-1118.162) (-1115.396) * (-1126.642) (-1117.244) (-1115.118) [-1113.536] -- 0:01:51
418500 -- [-1117.476] (-1110.100) (-1126.263) (-1114.942) * (-1120.904) (-1121.299) [-1112.602] (-1114.189) -- 0:01:51
419000 -- (-1110.827) [-1116.599] (-1115.822) (-1112.029) * (-1118.749) (-1122.065) (-1114.846) [-1109.458] -- 0:01:50
419500 -- (-1108.217) (-1110.486) [-1113.160] (-1115.837) * (-1114.639) (-1114.458) (-1112.260) [-1112.379] -- 0:01:50
420000 -- (-1113.403) (-1113.337) [-1115.150] (-1116.111) * (-1110.963) (-1112.893) (-1111.979) [-1123.061] -- 0:01:50
Average standard deviation of split frequencies: 0.007097
420500 -- (-1111.939) [-1108.365] (-1120.593) (-1121.769) * (-1116.328) [-1113.373] (-1110.755) (-1115.195) -- 0:01:50
421000 -- (-1118.710) [-1112.169] (-1114.843) (-1110.839) * (-1114.425) (-1116.454) [-1114.625] (-1114.421) -- 0:01:50
421500 -- (-1116.530) (-1108.196) (-1115.231) [-1114.546] * (-1115.323) (-1116.053) (-1111.143) [-1115.288] -- 0:01:51
422000 -- [-1112.273] (-1115.135) (-1117.401) (-1114.450) * (-1117.453) [-1111.268] (-1119.296) (-1118.468) -- 0:01:50
422500 -- (-1115.348) (-1112.001) [-1113.510] (-1121.212) * (-1118.440) [-1115.099] (-1116.577) (-1122.454) -- 0:01:50
423000 -- (-1112.317) [-1111.837] (-1116.889) (-1120.449) * (-1114.930) [-1117.908] (-1115.635) (-1114.610) -- 0:01:50
423500 -- (-1113.081) [-1120.464] (-1114.682) (-1121.185) * (-1118.642) [-1114.575] (-1116.362) (-1110.222) -- 0:01:50
424000 -- [-1108.677] (-1122.425) (-1115.341) (-1126.789) * (-1118.045) (-1117.610) (-1113.516) [-1114.299] -- 0:01:50
424500 -- [-1110.241] (-1118.276) (-1113.954) (-1120.045) * [-1113.346] (-1116.837) (-1108.732) (-1118.369) -- 0:01:49
425000 -- (-1111.089) (-1111.451) (-1119.006) [-1119.145] * (-1111.962) [-1112.756] (-1116.567) (-1116.509) -- 0:01:49
Average standard deviation of split frequencies: 0.006640
425500 -- [-1117.570] (-1117.098) (-1121.209) (-1118.348) * (-1109.954) (-1113.892) [-1109.845] (-1115.448) -- 0:01:49
426000 -- (-1112.585) [-1111.949] (-1112.285) (-1122.263) * (-1123.521) (-1128.678) (-1109.456) [-1109.627] -- 0:01:50
426500 -- (-1112.911) [-1120.701] (-1116.593) (-1116.707) * (-1111.011) (-1124.509) (-1120.511) [-1112.088] -- 0:01:50
427000 -- [-1109.220] (-1111.477) (-1119.396) (-1119.073) * (-1118.904) (-1116.885) (-1112.678) [-1115.391] -- 0:01:50
427500 -- (-1113.080) [-1119.062] (-1116.084) (-1121.780) * (-1113.959) (-1115.044) (-1115.975) [-1120.778] -- 0:01:49
428000 -- (-1121.202) (-1115.896) (-1115.189) [-1115.816] * (-1122.715) (-1111.173) (-1119.361) [-1114.392] -- 0:01:49
428500 -- [-1110.973] (-1119.926) (-1116.709) (-1121.151) * (-1113.920) [-1109.942] (-1117.412) (-1111.980) -- 0:01:49
429000 -- (-1114.828) (-1108.415) (-1120.720) [-1124.880] * [-1114.260] (-1111.542) (-1120.190) (-1115.945) -- 0:01:49
429500 -- [-1119.419] (-1115.338) (-1113.864) (-1119.281) * (-1117.240) (-1116.245) (-1115.395) [-1109.446] -- 0:01:48
430000 -- (-1110.967) (-1115.409) [-1129.217] (-1112.389) * (-1112.318) (-1125.074) (-1112.946) [-1116.658] -- 0:01:48
Average standard deviation of split frequencies: 0.006568
430500 -- [-1114.495] (-1117.678) (-1116.544) (-1113.266) * (-1115.126) [-1113.148] (-1114.141) (-1110.008) -- 0:01:48
431000 -- (-1123.107) (-1120.801) (-1115.450) [-1112.742] * (-1119.972) [-1113.720] (-1117.143) (-1115.122) -- 0:01:48
431500 -- (-1116.241) (-1114.892) [-1118.231] (-1121.417) * (-1112.332) [-1112.453] (-1111.449) (-1116.022) -- 0:01:49
432000 -- (-1113.862) (-1114.816) (-1119.872) [-1116.326] * (-1116.506) (-1114.596) [-1118.157] (-1115.442) -- 0:01:49
432500 -- (-1115.618) [-1109.371] (-1113.568) (-1112.965) * (-1114.234) (-1112.535) [-1115.184] (-1111.275) -- 0:01:48
433000 -- (-1115.642) (-1111.691) [-1115.789] (-1118.522) * (-1125.199) [-1112.323] (-1116.510) (-1115.841) -- 0:01:48
433500 -- (-1121.158) (-1113.062) (-1110.122) [-1116.492] * (-1118.748) (-1113.195) [-1115.561] (-1116.331) -- 0:01:48
434000 -- (-1109.302) (-1117.620) (-1114.877) [-1115.018] * (-1121.423) (-1110.816) [-1112.736] (-1128.066) -- 0:01:48
434500 -- (-1111.226) (-1114.315) [-1110.554] (-1119.938) * (-1123.078) [-1110.232] (-1114.800) (-1118.395) -- 0:01:48
435000 -- [-1109.643] (-1106.478) (-1116.628) (-1112.118) * (-1116.484) (-1113.633) (-1113.170) [-1114.610] -- 0:01:47
Average standard deviation of split frequencies: 0.006848
435500 -- (-1109.503) (-1112.556) [-1114.625] (-1122.499) * (-1119.524) (-1110.608) (-1114.539) [-1116.897] -- 0:01:47
436000 -- [-1111.586] (-1117.609) (-1113.707) (-1124.169) * (-1117.435) [-1115.632] (-1114.708) (-1113.438) -- 0:01:47
436500 -- [-1112.202] (-1119.873) (-1109.480) (-1120.737) * (-1122.944) (-1111.496) [-1116.219] (-1119.349) -- 0:01:48
437000 -- (-1120.993) (-1113.694) [-1111.713] (-1124.793) * [-1114.246] (-1113.816) (-1115.750) (-1112.199) -- 0:01:48
437500 -- [-1114.500] (-1112.502) (-1107.628) (-1126.459) * (-1113.731) (-1112.232) (-1114.735) [-1119.041] -- 0:01:48
438000 -- (-1114.315) [-1112.745] (-1116.813) (-1117.932) * (-1122.614) (-1121.005) [-1112.256] (-1119.053) -- 0:01:47
438500 -- (-1122.943) (-1116.665) [-1122.678] (-1116.004) * (-1123.068) [-1114.101] (-1121.570) (-1116.776) -- 0:01:47
439000 -- (-1118.272) (-1113.545) [-1111.015] (-1115.867) * (-1118.475) [-1112.056] (-1107.904) (-1123.630) -- 0:01:47
439500 -- (-1120.437) (-1116.537) [-1113.887] (-1117.731) * (-1120.865) (-1113.445) [-1115.101] (-1119.050) -- 0:01:47
440000 -- (-1114.244) (-1124.527) [-1118.632] (-1118.445) * (-1115.729) (-1112.305) [-1110.687] (-1125.665) -- 0:01:46
Average standard deviation of split frequencies: 0.006419
440500 -- (-1121.462) (-1112.796) [-1119.766] (-1124.256) * [-1115.350] (-1112.720) (-1115.447) (-1119.168) -- 0:01:46
441000 -- (-1122.775) (-1112.929) (-1114.181) [-1116.796] * [-1112.596] (-1110.674) (-1122.484) (-1113.675) -- 0:01:46
441500 -- (-1114.496) [-1115.109] (-1118.820) (-1121.868) * (-1123.853) [-1115.040] (-1126.050) (-1115.456) -- 0:01:46
442000 -- (-1110.765) (-1123.651) [-1115.317] (-1112.521) * (-1111.884) (-1111.963) (-1118.441) [-1112.595] -- 0:01:47
442500 -- (-1116.914) (-1112.502) (-1112.533) [-1112.343] * [-1110.574] (-1110.881) (-1123.182) (-1114.916) -- 0:01:47
443000 -- (-1116.436) (-1113.311) (-1111.868) [-1114.464] * (-1117.211) [-1110.415] (-1108.532) (-1117.084) -- 0:01:46
443500 -- (-1109.727) (-1119.762) [-1109.117] (-1118.374) * (-1116.385) (-1110.830) (-1113.088) [-1116.321] -- 0:01:46
444000 -- (-1115.324) (-1112.721) (-1108.866) [-1113.236] * (-1119.562) (-1112.320) (-1114.940) [-1117.501] -- 0:01:46
444500 -- (-1119.419) (-1114.618) (-1116.395) [-1117.760] * (-1111.898) [-1115.214] (-1112.407) (-1120.474) -- 0:01:46
445000 -- (-1117.905) (-1112.894) [-1109.446] (-1125.481) * (-1108.287) [-1112.602] (-1114.081) (-1115.001) -- 0:01:46
Average standard deviation of split frequencies: 0.006342
445500 -- (-1117.389) (-1109.314) (-1125.451) [-1112.494] * (-1114.997) (-1117.296) [-1113.282] (-1114.211) -- 0:01:45
446000 -- (-1110.932) (-1115.082) (-1118.381) [-1117.618] * [-1111.181] (-1111.882) (-1116.671) (-1116.148) -- 0:01:45
446500 -- (-1111.863) [-1108.665] (-1115.591) (-1111.841) * (-1118.297) (-1115.262) [-1114.326] (-1121.874) -- 0:01:45
447000 -- [-1109.848] (-1118.048) (-1121.141) (-1108.750) * (-1120.153) [-1110.098] (-1118.713) (-1117.865) -- 0:01:46
447500 -- [-1116.607] (-1115.039) (-1111.773) (-1118.287) * (-1113.819) (-1115.539) [-1120.264] (-1111.775) -- 0:01:46
448000 -- (-1112.754) (-1113.803) [-1120.069] (-1116.977) * (-1113.966) [-1114.601] (-1113.464) (-1116.219) -- 0:01:45
448500 -- (-1114.308) [-1106.981] (-1115.527) (-1114.995) * (-1118.221) [-1116.449] (-1119.296) (-1116.378) -- 0:01:45
449000 -- (-1113.079) (-1118.087) (-1115.162) [-1111.797] * (-1125.109) (-1124.972) (-1112.372) [-1113.167] -- 0:01:45
449500 -- (-1119.968) [-1116.762] (-1118.210) (-1114.237) * (-1123.788) (-1118.877) (-1116.227) [-1112.676] -- 0:01:45
450000 -- (-1116.456) [-1118.262] (-1116.443) (-1110.955) * (-1128.003) (-1117.042) (-1114.932) [-1111.643] -- 0:01:45
Average standard deviation of split frequencies: 0.005927
450500 -- (-1119.213) (-1117.281) (-1113.982) [-1112.868] * (-1122.499) [-1114.486] (-1113.482) (-1116.016) -- 0:01:44
451000 -- (-1111.655) (-1118.135) (-1113.806) [-1111.733] * (-1121.174) (-1112.227) (-1120.030) [-1115.027] -- 0:01:44
451500 -- [-1119.581] (-1108.397) (-1111.374) (-1111.959) * [-1119.707] (-1115.324) (-1119.168) (-1113.936) -- 0:01:44
452000 -- (-1118.630) (-1107.866) (-1118.483) [-1113.460] * [-1115.976] (-1116.624) (-1117.687) (-1122.006) -- 0:01:44
452500 -- (-1116.330) [-1111.959] (-1115.550) (-1125.583) * [-1113.872] (-1113.191) (-1114.665) (-1123.157) -- 0:01:45
453000 -- (-1115.778) [-1117.602] (-1116.831) (-1119.287) * (-1111.785) (-1112.227) [-1116.628] (-1114.050) -- 0:01:45
453500 -- (-1119.671) (-1115.323) (-1118.971) [-1113.917] * (-1117.181) (-1113.221) [-1115.924] (-1113.822) -- 0:01:44
454000 -- (-1114.107) (-1119.435) (-1113.093) [-1117.949] * (-1110.437) (-1117.222) (-1113.563) [-1114.523] -- 0:01:44
454500 -- [-1116.020] (-1114.594) (-1111.372) (-1125.233) * (-1118.224) [-1112.831] (-1112.836) (-1119.843) -- 0:01:44
455000 -- (-1119.156) (-1112.904) [-1114.060] (-1117.533) * (-1121.207) [-1114.692] (-1123.750) (-1120.309) -- 0:01:44
Average standard deviation of split frequencies: 0.005858
455500 -- [-1118.265] (-1117.082) (-1117.010) (-1111.180) * [-1109.047] (-1112.559) (-1122.422) (-1116.179) -- 0:01:43
456000 -- (-1120.097) [-1119.528] (-1118.362) (-1114.939) * [-1118.180] (-1115.783) (-1118.381) (-1113.531) -- 0:01:43
456500 -- (-1114.681) (-1126.755) (-1120.425) [-1122.302] * (-1111.654) (-1116.554) [-1119.134] (-1115.607) -- 0:01:43
457000 -- [-1111.709] (-1116.131) (-1120.344) (-1112.465) * (-1113.091) (-1114.535) [-1112.203] (-1119.015) -- 0:01:43
457500 -- (-1114.047) (-1117.706) [-1110.208] (-1109.511) * [-1118.649] (-1123.876) (-1116.308) (-1113.855) -- 0:01:44
458000 -- [-1110.677] (-1113.983) (-1115.645) (-1112.349) * (-1112.389) (-1111.097) [-1111.302] (-1115.716) -- 0:01:44
458500 -- (-1116.268) (-1118.888) (-1120.185) [-1115.240] * [-1117.794] (-1128.671) (-1115.505) (-1113.543) -- 0:01:43
459000 -- (-1111.033) [-1110.865] (-1118.958) (-1125.910) * [-1110.698] (-1113.847) (-1109.746) (-1112.007) -- 0:01:43
459500 -- (-1111.810) (-1110.845) [-1110.490] (-1110.882) * (-1112.472) (-1111.164) [-1114.366] (-1117.717) -- 0:01:43
460000 -- [-1115.579] (-1114.919) (-1115.302) (-1110.390) * [-1111.802] (-1110.572) (-1124.519) (-1111.705) -- 0:01:43
Average standard deviation of split frequencies: 0.006481
460500 -- (-1113.043) (-1114.920) [-1116.596] (-1112.748) * (-1113.550) [-1114.361] (-1118.896) (-1116.397) -- 0:01:43
461000 -- (-1116.565) [-1114.841] (-1111.846) (-1119.368) * [-1113.485] (-1113.334) (-1119.652) (-1118.760) -- 0:01:42
461500 -- (-1113.843) [-1112.605] (-1115.029) (-1118.128) * [-1116.858] (-1111.108) (-1115.813) (-1113.577) -- 0:01:42
462000 -- (-1120.658) (-1113.635) [-1114.664] (-1113.924) * (-1112.523) [-1113.231] (-1127.123) (-1118.428) -- 0:01:42
462500 -- (-1123.961) [-1109.219] (-1115.161) (-1118.970) * [-1114.541] (-1114.291) (-1124.212) (-1113.515) -- 0:01:42
463000 -- (-1125.504) [-1110.591] (-1121.529) (-1122.332) * [-1116.832] (-1112.481) (-1121.565) (-1114.908) -- 0:01:43
463500 -- (-1121.702) [-1110.222] (-1112.007) (-1113.970) * (-1114.643) (-1116.788) (-1109.607) [-1118.467] -- 0:01:43
464000 -- (-1119.865) [-1112.068] (-1113.897) (-1113.579) * (-1123.424) (-1110.837) [-1109.173] (-1123.289) -- 0:01:42
464500 -- [-1108.190] (-1111.311) (-1114.791) (-1112.973) * (-1121.161) [-1113.677] (-1119.467) (-1113.781) -- 0:01:42
465000 -- (-1117.835) [-1110.955] (-1116.472) (-1116.708) * (-1112.803) (-1116.862) (-1129.779) [-1114.258] -- 0:01:42
Average standard deviation of split frequencies: 0.006407
465500 -- (-1118.985) (-1114.443) [-1113.869] (-1118.470) * (-1116.103) (-1116.435) (-1114.969) [-1111.239] -- 0:01:42
466000 -- (-1121.279) (-1112.975) [-1116.068] (-1127.057) * (-1117.479) [-1118.275] (-1120.681) (-1111.486) -- 0:01:41
466500 -- (-1119.426) [-1108.339] (-1117.390) (-1113.443) * (-1114.769) (-1113.345) (-1115.431) [-1118.108] -- 0:01:41
467000 -- (-1119.758) [-1117.154] (-1120.872) (-1120.473) * (-1121.385) (-1117.896) [-1110.203] (-1115.260) -- 0:01:41
467500 -- (-1115.529) [-1110.829] (-1117.656) (-1120.925) * [-1115.216] (-1112.609) (-1111.096) (-1112.479) -- 0:01:41
468000 -- (-1112.774) (-1110.620) [-1117.276] (-1116.285) * (-1116.118) (-1115.212) (-1116.228) [-1121.942] -- 0:01:42
468500 -- [-1109.293] (-1111.563) (-1114.172) (-1117.274) * (-1112.635) [-1115.087] (-1121.814) (-1109.204) -- 0:01:42
469000 -- (-1108.734) (-1120.818) (-1112.517) [-1117.853] * (-1124.555) [-1112.488] (-1121.050) (-1113.982) -- 0:01:41
469500 -- [-1119.262] (-1115.825) (-1111.262) (-1115.426) * [-1115.991] (-1113.968) (-1113.871) (-1112.625) -- 0:01:41
470000 -- (-1115.173) [-1111.482] (-1118.496) (-1112.906) * [-1109.609] (-1111.087) (-1116.490) (-1119.176) -- 0:01:41
Average standard deviation of split frequencies: 0.006343
470500 -- [-1112.700] (-1114.387) (-1120.880) (-1110.850) * (-1117.505) (-1118.481) (-1110.929) [-1112.612] -- 0:01:41
471000 -- (-1111.874) (-1116.498) (-1117.217) [-1110.986] * [-1111.343] (-1116.801) (-1119.373) (-1113.762) -- 0:01:41
471500 -- [-1119.547] (-1112.287) (-1113.648) (-1111.704) * (-1111.921) [-1116.244] (-1118.064) (-1122.710) -- 0:01:40
472000 -- (-1119.624) (-1119.575) (-1112.027) [-1110.346] * (-1115.564) [-1110.774] (-1114.504) (-1113.164) -- 0:01:40
472500 -- (-1116.463) (-1120.888) (-1120.066) [-1116.943] * (-1119.550) [-1111.029] (-1123.159) (-1110.202) -- 0:01:40
473000 -- (-1115.935) (-1113.224) [-1127.871] (-1110.198) * (-1119.326) (-1113.199) (-1115.189) [-1109.469] -- 0:01:40
473500 -- (-1119.746) (-1117.571) (-1114.641) [-1113.733] * (-1115.403) (-1109.772) [-1117.012] (-1119.072) -- 0:01:41
474000 -- [-1116.417] (-1121.025) (-1120.441) (-1118.530) * [-1120.253] (-1117.228) (-1117.262) (-1114.078) -- 0:01:40
474500 -- [-1124.298] (-1115.551) (-1113.652) (-1114.995) * (-1113.918) [-1115.397] (-1116.685) (-1116.429) -- 0:01:40
475000 -- (-1125.823) (-1118.269) (-1121.785) [-1117.784] * (-1111.758) (-1111.212) [-1112.908] (-1115.921) -- 0:01:40
Average standard deviation of split frequencies: 0.006602
475500 -- (-1118.134) [-1120.348] (-1114.030) (-1112.502) * [-1111.558] (-1119.056) (-1110.192) (-1114.762) -- 0:01:40
476000 -- (-1120.058) (-1120.177) [-1110.547] (-1113.231) * [-1111.631] (-1113.383) (-1123.038) (-1115.996) -- 0:01:40
476500 -- [-1122.566] (-1116.552) (-1115.203) (-1112.659) * (-1110.825) (-1114.585) [-1112.650] (-1115.631) -- 0:01:39
477000 -- (-1114.147) [-1113.205] (-1113.041) (-1112.625) * (-1115.750) (-1112.555) [-1111.660] (-1118.485) -- 0:01:39
477500 -- (-1113.857) (-1119.963) [-1108.979] (-1119.998) * [-1110.835] (-1115.426) (-1114.311) (-1115.130) -- 0:01:39
478000 -- (-1121.028) [-1114.206] (-1114.629) (-1113.416) * [-1109.781] (-1114.433) (-1113.385) (-1114.983) -- 0:01:39
478500 -- (-1113.975) (-1116.942) [-1112.756] (-1109.674) * (-1120.066) (-1114.965) [-1110.725] (-1117.593) -- 0:01:40
479000 -- (-1114.716) (-1116.472) (-1113.796) [-1108.566] * (-1119.415) (-1107.092) (-1112.810) [-1111.248] -- 0:01:40
479500 -- (-1124.490) [-1110.837] (-1118.513) (-1122.914) * (-1118.289) [-1110.153] (-1110.403) (-1115.030) -- 0:01:39
480000 -- (-1126.391) (-1114.569) [-1114.373] (-1108.908) * (-1118.565) (-1108.745) (-1111.940) [-1117.638] -- 0:01:39
Average standard deviation of split frequencies: 0.006538
480500 -- (-1115.996) (-1118.905) (-1122.572) [-1112.482] * (-1119.660) [-1117.519] (-1116.887) (-1116.447) -- 0:01:39
481000 -- [-1115.950] (-1111.429) (-1123.148) (-1121.019) * (-1118.898) (-1114.354) (-1112.846) [-1120.469] -- 0:01:39
481500 -- (-1116.188) (-1112.768) [-1116.067] (-1117.978) * (-1115.681) (-1116.813) (-1114.617) [-1112.997] -- 0:01:39
482000 -- (-1114.353) (-1116.615) [-1112.262] (-1109.588) * [-1111.858] (-1114.321) (-1114.274) (-1115.723) -- 0:01:38
482500 -- (-1115.722) (-1115.582) (-1116.993) [-1113.489] * (-1115.113) (-1116.920) (-1108.907) [-1114.969] -- 0:01:38
483000 -- (-1112.266) [-1116.889] (-1116.565) (-1115.167) * (-1119.623) [-1121.400] (-1118.619) (-1115.432) -- 0:01:38
483500 -- (-1109.224) (-1114.429) (-1116.793) [-1110.224] * (-1116.540) (-1121.494) [-1107.337] (-1114.377) -- 0:01:38
484000 -- (-1116.803) (-1116.656) [-1114.836] (-1110.978) * (-1107.160) (-1118.147) (-1122.148) [-1112.624] -- 0:01:39
484500 -- (-1113.567) (-1120.600) [-1119.001] (-1113.406) * [-1113.291] (-1113.755) (-1113.300) (-1122.360) -- 0:01:38
485000 -- (-1110.173) (-1128.432) (-1116.356) [-1123.585] * (-1111.309) [-1115.135] (-1114.932) (-1123.415) -- 0:01:38
Average standard deviation of split frequencies: 0.005820
485500 -- (-1111.099) (-1126.428) (-1113.139) [-1113.861] * (-1111.581) [-1114.203] (-1109.440) (-1126.229) -- 0:01:38
486000 -- (-1110.974) (-1120.529) (-1114.495) [-1110.003] * (-1119.051) [-1119.584] (-1121.157) (-1113.916) -- 0:01:38
486500 -- (-1113.581) (-1115.866) (-1112.168) [-1115.959] * (-1112.929) (-1116.410) [-1106.842] (-1113.712) -- 0:01:38
487000 -- (-1116.480) [-1113.456] (-1111.511) (-1120.430) * (-1115.965) (-1119.702) [-1114.312] (-1114.316) -- 0:01:37
487500 -- (-1121.092) (-1121.901) (-1121.054) [-1110.055] * (-1116.522) (-1116.143) (-1107.895) [-1119.215] -- 0:01:37
488000 -- (-1115.132) [-1112.361] (-1119.964) (-1113.108) * [-1121.168] (-1113.102) (-1113.816) (-1110.584) -- 0:01:37
488500 -- (-1115.283) (-1111.864) (-1117.068) [-1108.865] * [-1112.047] (-1110.081) (-1113.643) (-1113.253) -- 0:01:37
489000 -- (-1115.558) (-1112.064) [-1116.733] (-1113.362) * (-1115.638) (-1116.580) (-1117.190) [-1110.450] -- 0:01:38
489500 -- (-1122.367) (-1113.218) [-1111.004] (-1114.954) * (-1116.299) [-1109.276] (-1119.496) (-1115.062) -- 0:01:38
490000 -- (-1116.222) (-1113.209) [-1114.013] (-1117.795) * (-1113.006) (-1113.439) (-1118.542) [-1112.393] -- 0:01:37
Average standard deviation of split frequencies: 0.005764
490500 -- (-1117.557) (-1115.672) [-1111.482] (-1117.377) * (-1112.029) [-1115.263] (-1118.118) (-1113.584) -- 0:01:37
491000 -- (-1113.100) (-1110.817) (-1118.595) [-1116.622] * (-1112.301) (-1127.163) [-1110.220] (-1113.241) -- 0:01:37
491500 -- [-1114.906] (-1111.545) (-1118.695) (-1120.084) * [-1114.222] (-1111.256) (-1119.666) (-1117.603) -- 0:01:37
492000 -- [-1115.222] (-1116.151) (-1124.140) (-1111.051) * (-1115.816) [-1110.344] (-1120.543) (-1110.646) -- 0:01:37
492500 -- [-1111.980] (-1116.548) (-1118.157) (-1116.151) * (-1113.694) (-1115.553) (-1118.865) [-1111.349] -- 0:01:36
493000 -- (-1113.785) [-1119.070] (-1117.416) (-1114.066) * (-1109.314) (-1115.869) [-1117.355] (-1110.627) -- 0:01:36
493500 -- (-1115.536) (-1118.197) (-1115.715) [-1111.656] * (-1121.811) (-1116.141) [-1118.818] (-1119.590) -- 0:01:36
494000 -- (-1110.767) (-1113.117) (-1117.735) [-1112.880] * (-1111.774) (-1113.319) (-1114.907) [-1110.947] -- 0:01:37
494500 -- (-1109.328) (-1125.642) (-1121.329) [-1112.069] * (-1123.008) (-1112.823) [-1115.827] (-1114.175) -- 0:01:37
495000 -- [-1108.944] (-1110.876) (-1121.026) (-1113.245) * [-1107.812] (-1111.294) (-1111.105) (-1116.275) -- 0:01:36
Average standard deviation of split frequencies: 0.005702
495500 -- (-1116.318) (-1112.257) (-1110.695) [-1113.078] * (-1120.315) (-1114.906) (-1119.442) [-1119.386] -- 0:01:36
496000 -- (-1120.574) [-1111.189] (-1115.980) (-1115.853) * (-1113.476) (-1113.070) (-1122.790) [-1115.164] -- 0:01:36
496500 -- [-1111.505] (-1114.641) (-1108.497) (-1106.285) * (-1115.216) (-1114.168) [-1116.346] (-1111.989) -- 0:01:36
497000 -- (-1113.137) [-1111.002] (-1114.245) (-1112.518) * (-1112.253) (-1115.331) [-1114.859] (-1116.563) -- 0:01:36
497500 -- (-1113.710) (-1121.478) (-1109.697) [-1113.122] * [-1116.320] (-1111.906) (-1117.745) (-1112.826) -- 0:01:35
498000 -- (-1109.811) [-1114.287] (-1110.151) (-1112.668) * (-1112.293) (-1112.085) (-1114.403) [-1114.752] -- 0:01:35
498500 -- (-1117.243) (-1117.102) (-1113.004) [-1112.067] * [-1115.001] (-1114.690) (-1118.688) (-1114.365) -- 0:01:35
499000 -- (-1118.894) (-1117.821) [-1111.387] (-1114.761) * (-1115.867) (-1114.701) (-1118.340) [-1113.018] -- 0:01:35
499500 -- (-1122.416) [-1112.331] (-1112.756) (-1113.964) * [-1111.969] (-1110.762) (-1114.786) (-1114.107) -- 0:01:36
500000 -- (-1113.143) (-1111.274) (-1116.149) [-1110.830] * (-1108.894) [-1113.907] (-1120.478) (-1115.381) -- 0:01:36
Average standard deviation of split frequencies: 0.005335
500500 -- [-1111.994] (-1111.259) (-1112.552) (-1112.848) * (-1115.205) (-1110.838) [-1113.525] (-1110.285) -- 0:01:35
501000 -- [-1117.695] (-1113.416) (-1118.260) (-1114.987) * (-1117.682) (-1113.859) [-1109.105] (-1121.898) -- 0:01:35
501500 -- (-1115.644) [-1111.863] (-1114.884) (-1119.370) * [-1118.225] (-1116.557) (-1118.894) (-1117.722) -- 0:01:35
502000 -- (-1122.652) [-1113.204] (-1116.730) (-1120.862) * (-1113.960) [-1115.417] (-1115.382) (-1118.958) -- 0:01:35
502500 -- (-1117.401) (-1114.787) (-1117.576) [-1119.187] * (-1114.203) (-1120.262) [-1110.974] (-1110.419) -- 0:01:35
503000 -- (-1118.512) [-1117.205] (-1123.506) (-1120.129) * (-1111.634) (-1115.022) (-1109.991) [-1114.649] -- 0:01:34
503500 -- (-1114.634) [-1112.877] (-1111.916) (-1120.444) * [-1111.118] (-1117.701) (-1111.048) (-1114.619) -- 0:01:34
504000 -- (-1113.263) (-1112.642) (-1111.016) [-1116.487] * (-1115.937) (-1125.603) [-1118.249] (-1115.500) -- 0:01:34
504500 -- (-1114.457) [-1116.659] (-1113.286) (-1118.169) * [-1116.742] (-1124.393) (-1118.714) (-1115.500) -- 0:01:35
505000 -- (-1126.222) (-1108.263) (-1115.600) [-1111.983] * (-1114.818) (-1118.364) [-1111.999] (-1125.992) -- 0:01:35
Average standard deviation of split frequencies: 0.004969
505500 -- [-1117.160] (-1112.828) (-1115.294) (-1115.416) * (-1119.763) [-1111.118] (-1117.073) (-1115.900) -- 0:01:34
506000 -- [-1113.262] (-1120.470) (-1119.544) (-1114.057) * (-1113.409) (-1123.086) (-1113.228) [-1111.390] -- 0:01:34
506500 -- (-1118.844) [-1110.998] (-1113.906) (-1115.093) * (-1117.776) [-1106.490] (-1121.391) (-1113.575) -- 0:01:34
507000 -- (-1117.317) (-1114.190) (-1114.479) [-1114.756] * (-1117.536) (-1111.581) [-1117.930] (-1124.345) -- 0:01:34
507500 -- (-1120.408) (-1113.195) (-1116.471) [-1113.371] * (-1117.115) (-1110.936) (-1126.816) [-1118.026] -- 0:01:34
508000 -- [-1112.070] (-1112.019) (-1116.519) (-1116.666) * [-1113.466] (-1122.024) (-1120.797) (-1111.544) -- 0:01:33
508500 -- (-1115.081) [-1115.527] (-1109.345) (-1117.398) * (-1115.441) [-1112.243] (-1109.623) (-1128.020) -- 0:01:33
509000 -- (-1113.643) (-1115.708) [-1111.140] (-1121.171) * (-1113.166) (-1109.802) (-1115.169) [-1114.827] -- 0:01:33
509500 -- [-1113.558] (-1114.870) (-1117.318) (-1114.842) * (-1109.377) (-1113.388) (-1117.389) [-1110.721] -- 0:01:34
510000 -- (-1113.076) (-1114.908) [-1112.858] (-1116.718) * (-1116.905) (-1120.753) [-1116.663] (-1115.869) -- 0:01:34
Average standard deviation of split frequencies: 0.004000
510500 -- (-1112.231) (-1118.006) [-1115.932] (-1122.157) * (-1118.961) (-1114.433) [-1116.215] (-1118.308) -- 0:01:33
511000 -- [-1108.905] (-1107.833) (-1117.199) (-1123.268) * (-1119.284) [-1119.185] (-1113.629) (-1118.149) -- 0:01:33
511500 -- (-1115.502) (-1110.140) (-1113.361) [-1119.211] * (-1118.555) (-1119.017) [-1115.260] (-1115.846) -- 0:01:33
512000 -- [-1108.803] (-1114.195) (-1114.753) (-1118.750) * (-1124.681) (-1121.636) (-1116.088) [-1115.623] -- 0:01:33
512500 -- (-1116.131) (-1125.616) [-1114.172] (-1114.701) * (-1123.102) (-1120.451) (-1109.422) [-1111.348] -- 0:01:33
513000 -- (-1111.626) [-1116.869] (-1114.891) (-1119.416) * (-1111.131) [-1120.332] (-1117.645) (-1112.373) -- 0:01:33
513500 -- (-1115.149) (-1112.914) (-1118.740) [-1118.797] * [-1110.270] (-1115.823) (-1118.049) (-1122.827) -- 0:01:32
514000 -- (-1109.392) (-1115.703) (-1113.509) [-1116.155] * [-1117.103] (-1120.233) (-1116.314) (-1114.799) -- 0:01:32
514500 -- [-1110.746] (-1114.111) (-1110.545) (-1112.407) * (-1113.700) (-1118.782) [-1117.238] (-1114.880) -- 0:01:32
515000 -- [-1113.583] (-1122.961) (-1114.817) (-1117.024) * [-1110.886] (-1111.205) (-1119.615) (-1107.205) -- 0:01:33
Average standard deviation of split frequencies: 0.003350
515500 -- (-1118.794) (-1114.213) [-1113.790] (-1122.290) * (-1110.436) (-1108.192) [-1115.611] (-1110.107) -- 0:01:33
516000 -- (-1123.838) [-1113.456] (-1113.229) (-1118.140) * (-1119.127) [-1110.910] (-1121.093) (-1110.747) -- 0:01:32
516500 -- (-1116.413) (-1111.108) [-1119.477] (-1120.012) * (-1113.261) (-1112.784) (-1118.839) [-1123.128] -- 0:01:32
517000 -- (-1108.970) (-1114.607) [-1109.747] (-1119.553) * [-1114.735] (-1112.003) (-1124.790) (-1122.417) -- 0:01:32
517500 -- (-1112.754) (-1113.591) [-1115.021] (-1117.064) * (-1118.795) (-1116.604) (-1113.843) [-1114.603] -- 0:01:32
518000 -- (-1117.816) [-1114.154] (-1119.897) (-1117.646) * [-1112.111] (-1111.366) (-1121.775) (-1125.238) -- 0:01:32
518500 -- (-1113.544) (-1115.532) (-1111.868) [-1112.204] * [-1118.008] (-1112.355) (-1120.683) (-1124.551) -- 0:01:31
519000 -- [-1115.111] (-1124.883) (-1118.144) (-1110.087) * (-1114.654) [-1111.441] (-1116.639) (-1122.594) -- 0:01:31
519500 -- (-1110.991) [-1113.080] (-1116.864) (-1115.590) * (-1114.893) [-1112.092] (-1116.581) (-1117.525) -- 0:01:31
520000 -- (-1121.939) [-1114.173] (-1112.460) (-1112.942) * (-1117.313) [-1110.865] (-1115.789) (-1119.456) -- 0:01:32
Average standard deviation of split frequencies: 0.002716
520500 -- (-1109.943) (-1115.125) [-1115.507] (-1117.280) * [-1116.484] (-1117.208) (-1113.679) (-1114.115) -- 0:01:32
521000 -- (-1115.212) (-1116.968) (-1116.044) [-1114.254] * [-1111.993] (-1117.114) (-1111.697) (-1119.860) -- 0:01:31
521500 -- (-1111.978) (-1114.011) (-1115.773) [-1117.883] * (-1112.964) [-1113.686] (-1111.193) (-1117.363) -- 0:01:31
522000 -- [-1111.147] (-1115.327) (-1119.163) (-1116.700) * [-1115.013] (-1118.774) (-1112.007) (-1117.899) -- 0:01:31
522500 -- (-1110.695) [-1121.143] (-1115.443) (-1117.674) * (-1117.716) (-1113.374) (-1113.544) [-1111.280] -- 0:01:31
523000 -- [-1110.265] (-1124.330) (-1117.355) (-1109.825) * (-1116.443) [-1112.059] (-1115.675) (-1113.410) -- 0:01:31
523500 -- (-1114.537) [-1113.326] (-1112.802) (-1112.501) * (-1119.874) (-1109.463) (-1113.981) [-1113.138] -- 0:01:31
524000 -- (-1123.542) (-1117.628) [-1111.914] (-1111.076) * (-1119.941) (-1120.625) [-1109.536] (-1114.645) -- 0:01:30
524500 -- (-1116.635) (-1126.483) (-1117.693) [-1114.787] * (-1114.457) [-1110.875] (-1112.299) (-1118.439) -- 0:01:30
525000 -- (-1120.766) (-1115.493) [-1120.619] (-1113.704) * (-1120.720) (-1112.112) [-1116.307] (-1118.553) -- 0:01:31
Average standard deviation of split frequencies: 0.002091
525500 -- (-1117.106) (-1118.734) [-1120.883] (-1113.305) * (-1110.269) (-1117.759) (-1109.245) [-1112.256] -- 0:01:31
526000 -- (-1121.892) (-1115.556) (-1115.245) [-1112.629] * (-1115.800) (-1120.834) (-1111.228) [-1113.551] -- 0:01:31
526500 -- [-1114.312] (-1119.498) (-1112.390) (-1123.043) * (-1117.752) (-1124.729) (-1108.570) [-1113.080] -- 0:01:30
527000 -- (-1113.735) (-1114.881) [-1115.919] (-1112.885) * [-1125.617] (-1123.375) (-1108.232) (-1117.382) -- 0:01:30
527500 -- (-1124.825) [-1109.204] (-1114.663) (-1117.599) * [-1113.871] (-1120.374) (-1114.004) (-1110.027) -- 0:01:30
528000 -- (-1112.336) (-1121.851) (-1111.750) [-1115.546] * (-1117.852) (-1109.869) [-1115.728] (-1121.222) -- 0:01:30
528500 -- (-1114.834) (-1123.554) (-1114.047) [-1114.244] * (-1116.380) (-1116.294) (-1116.272) [-1110.314] -- 0:01:30
529000 -- (-1116.007) (-1122.768) (-1117.123) [-1114.626] * (-1110.038) (-1115.306) (-1116.946) [-1115.962] -- 0:01:29
529500 -- [-1121.276] (-1119.762) (-1115.189) (-1117.208) * (-1109.202) (-1110.558) [-1110.616] (-1111.284) -- 0:01:29
530000 -- (-1115.250) [-1114.991] (-1114.511) (-1117.041) * (-1120.358) (-1111.860) [-1113.266] (-1125.620) -- 0:01:29
Average standard deviation of split frequencies: 0.002665
530500 -- (-1114.264) (-1119.718) (-1108.845) [-1111.358] * [-1109.622] (-1110.121) (-1118.654) (-1116.696) -- 0:01:30
531000 -- (-1116.208) (-1114.817) (-1114.970) [-1117.955] * (-1112.579) (-1113.632) (-1120.261) [-1114.256] -- 0:01:30
531500 -- (-1119.134) (-1116.808) [-1117.337] (-1113.966) * (-1123.938) (-1117.663) (-1125.936) [-1114.048] -- 0:01:29
532000 -- (-1120.150) (-1116.810) (-1114.285) [-1123.926] * (-1114.678) [-1116.532] (-1115.928) (-1119.133) -- 0:01:29
532500 -- (-1119.130) (-1114.144) (-1111.961) [-1110.026] * (-1108.177) (-1117.127) [-1110.380] (-1118.772) -- 0:01:29
533000 -- (-1121.335) [-1114.000] (-1118.847) (-1114.140) * (-1113.593) (-1126.141) [-1115.304] (-1119.472) -- 0:01:29
533500 -- (-1119.671) [-1114.541] (-1115.085) (-1113.882) * (-1111.158) (-1117.509) (-1124.712) [-1109.864] -- 0:01:29
534000 -- [-1108.401] (-1114.317) (-1115.064) (-1114.883) * (-1112.952) (-1120.799) (-1111.455) [-1118.703] -- 0:01:29
534500 -- (-1115.952) (-1112.225) (-1118.428) [-1109.007] * (-1118.104) (-1119.126) (-1115.002) [-1110.127] -- 0:01:28
535000 -- (-1109.067) [-1115.473] (-1116.491) (-1112.244) * (-1127.224) (-1114.929) [-1114.201] (-1118.014) -- 0:01:28
Average standard deviation of split frequencies: 0.002932
535500 -- [-1116.216] (-1122.566) (-1120.154) (-1116.831) * (-1123.770) (-1117.860) [-1119.437] (-1124.171) -- 0:01:29
536000 -- [-1108.752] (-1124.094) (-1112.314) (-1116.708) * [-1115.913] (-1118.254) (-1116.561) (-1116.938) -- 0:01:29
536500 -- [-1111.072] (-1116.464) (-1117.328) (-1109.186) * [-1113.011] (-1116.862) (-1118.459) (-1122.553) -- 0:01:28
537000 -- (-1113.892) (-1113.947) [-1119.663] (-1114.940) * (-1117.345) (-1118.000) (-1115.876) [-1112.053] -- 0:01:28
537500 -- (-1118.263) [-1119.186] (-1112.262) (-1113.980) * (-1118.988) (-1120.091) [-1115.172] (-1116.586) -- 0:01:28
538000 -- (-1121.984) (-1116.396) (-1117.835) [-1111.630] * (-1121.584) [-1109.046] (-1119.508) (-1112.716) -- 0:01:28
538500 -- (-1116.029) (-1115.368) [-1115.886] (-1118.254) * (-1124.908) (-1119.968) [-1112.063] (-1119.205) -- 0:01:28
539000 -- [-1119.891] (-1110.248) (-1111.954) (-1112.913) * (-1113.593) (-1112.898) [-1112.802] (-1112.635) -- 0:01:28
539500 -- (-1114.389) [-1115.350] (-1118.547) (-1116.578) * (-1122.967) (-1111.239) [-1113.855] (-1113.475) -- 0:01:27
540000 -- (-1112.803) (-1108.563) (-1115.114) [-1114.280] * (-1122.247) (-1119.720) [-1117.256] (-1118.575) -- 0:01:27
Average standard deviation of split frequencies: 0.002616
540500 -- [-1112.254] (-1114.419) (-1117.427) (-1118.049) * [-1113.716] (-1113.709) (-1112.504) (-1125.838) -- 0:01:28
541000 -- (-1108.090) [-1108.804] (-1122.837) (-1115.659) * (-1109.369) (-1117.878) [-1111.721] (-1109.668) -- 0:01:28
541500 -- (-1115.096) [-1112.241] (-1113.810) (-1113.057) * (-1111.792) [-1119.391] (-1124.253) (-1116.300) -- 0:01:28
542000 -- (-1111.438) (-1113.532) (-1116.744) [-1111.156] * (-1111.204) (-1118.292) [-1117.167] (-1116.782) -- 0:01:27
542500 -- [-1109.768] (-1118.689) (-1108.642) (-1114.732) * [-1114.480] (-1114.464) (-1118.276) (-1120.567) -- 0:01:27
543000 -- [-1106.780] (-1125.596) (-1118.339) (-1119.756) * (-1119.375) (-1120.171) [-1114.682] (-1121.062) -- 0:01:27
543500 -- [-1115.304] (-1117.529) (-1114.528) (-1124.677) * (-1118.446) [-1113.113] (-1112.051) (-1116.083) -- 0:01:27
544000 -- [-1112.405] (-1121.938) (-1113.116) (-1112.636) * [-1118.377] (-1116.942) (-1123.601) (-1120.550) -- 0:01:27
544500 -- [-1114.705] (-1116.314) (-1111.529) (-1114.384) * (-1111.297) (-1122.464) [-1116.989] (-1111.411) -- 0:01:27
545000 -- (-1122.592) (-1119.587) [-1114.849] (-1122.778) * (-1112.818) (-1116.148) [-1121.035] (-1115.133) -- 0:01:26
Average standard deviation of split frequencies: 0.002302
545500 -- [-1114.780] (-1113.049) (-1112.650) (-1117.108) * [-1112.269] (-1129.161) (-1117.195) (-1115.255) -- 0:01:26
546000 -- [-1111.827] (-1113.835) (-1113.860) (-1114.170) * [-1117.220] (-1113.942) (-1108.006) (-1113.991) -- 0:01:27
546500 -- (-1109.820) [-1111.912] (-1120.740) (-1115.106) * (-1121.003) [-1116.319] (-1113.273) (-1115.092) -- 0:01:27
547000 -- (-1118.959) [-1120.673] (-1116.646) (-1113.479) * (-1117.153) [-1114.756] (-1110.412) (-1114.759) -- 0:01:26
547500 -- (-1113.417) (-1118.261) (-1111.049) [-1121.891] * (-1116.046) (-1118.690) [-1109.700] (-1115.317) -- 0:01:26
548000 -- [-1111.659] (-1123.991) (-1118.080) (-1122.855) * (-1113.804) [-1113.090] (-1113.394) (-1117.187) -- 0:01:26
548500 -- (-1116.447) (-1120.578) [-1113.344] (-1115.390) * (-1122.803) [-1110.942] (-1111.759) (-1114.744) -- 0:01:26
549000 -- [-1110.144] (-1116.943) (-1113.803) (-1112.226) * [-1124.849] (-1112.580) (-1117.092) (-1115.762) -- 0:01:26
549500 -- (-1117.911) [-1127.879] (-1116.259) (-1112.311) * (-1112.363) [-1111.119] (-1130.989) (-1111.138) -- 0:01:26
550000 -- (-1111.989) [-1116.509] (-1113.626) (-1110.531) * [-1114.129] (-1110.097) (-1119.749) (-1110.022) -- 0:01:25
Average standard deviation of split frequencies: 0.004566
550500 -- (-1111.969) (-1116.871) [-1113.727] (-1111.685) * (-1111.479) (-1112.247) (-1117.720) [-1114.698] -- 0:01:25
551000 -- (-1116.818) [-1117.206] (-1111.275) (-1119.101) * (-1116.449) [-1112.648] (-1124.204) (-1124.530) -- 0:01:26
551500 -- [-1114.952] (-1117.490) (-1123.241) (-1120.416) * (-1122.731) [-1119.175] (-1118.308) (-1117.718) -- 0:01:26
552000 -- (-1117.161) (-1111.103) [-1118.626] (-1110.661) * (-1128.175) (-1117.499) (-1116.363) [-1122.933] -- 0:01:26
552500 -- (-1118.400) [-1114.331] (-1121.444) (-1117.403) * (-1119.807) (-1116.727) [-1113.989] (-1116.852) -- 0:01:25
553000 -- (-1116.838) (-1114.756) [-1113.741] (-1115.173) * (-1109.616) (-1128.041) [-1110.028] (-1115.873) -- 0:01:25
553500 -- (-1118.870) (-1117.564) [-1114.035] (-1124.685) * (-1114.589) [-1118.664] (-1113.614) (-1118.337) -- 0:01:25
554000 -- [-1116.962] (-1109.426) (-1117.904) (-1126.432) * (-1110.154) (-1124.710) (-1114.115) [-1111.003] -- 0:01:25
554500 -- (-1115.418) (-1114.426) [-1113.679] (-1121.862) * (-1116.549) [-1119.490] (-1118.400) (-1119.986) -- 0:01:25
555000 -- (-1124.631) (-1115.700) (-1113.850) [-1121.301] * (-1116.826) (-1117.008) (-1108.400) [-1115.968] -- 0:01:24
Average standard deviation of split frequencies: 0.003109
555500 -- [-1110.677] (-1113.012) (-1117.707) (-1113.741) * (-1122.223) [-1115.776] (-1121.594) (-1113.586) -- 0:01:24
556000 -- (-1118.491) (-1119.930) (-1115.954) [-1119.162] * [-1121.617] (-1120.516) (-1111.978) (-1121.124) -- 0:01:25
556500 -- [-1117.947] (-1123.578) (-1112.173) (-1128.292) * (-1111.266) [-1117.636] (-1110.234) (-1122.614) -- 0:01:25
557000 -- [-1110.369] (-1118.435) (-1115.193) (-1112.916) * [-1113.473] (-1110.362) (-1119.336) (-1118.292) -- 0:01:25
557500 -- (-1118.254) (-1119.945) (-1113.609) [-1115.261] * (-1112.757) (-1117.159) (-1118.954) [-1117.028] -- 0:01:24
558000 -- [-1115.316] (-1114.967) (-1113.110) (-1115.475) * (-1113.572) [-1115.002] (-1111.072) (-1122.215) -- 0:01:24
558500 -- (-1119.203) [-1116.816] (-1117.332) (-1112.640) * (-1117.157) (-1118.316) [-1116.363] (-1114.521) -- 0:01:24
559000 -- (-1116.882) (-1116.591) (-1110.525) [-1121.403] * (-1114.855) (-1114.233) [-1109.668] (-1126.517) -- 0:01:24
559500 -- (-1115.493) (-1114.556) [-1114.396] (-1111.466) * [-1114.447] (-1114.427) (-1114.537) (-1113.051) -- 0:01:24
560000 -- (-1117.508) (-1120.607) (-1114.584) [-1110.453] * (-1117.856) (-1114.265) [-1109.431] (-1109.193) -- 0:01:24
Average standard deviation of split frequencies: 0.003083
560500 -- (-1116.039) (-1112.359) (-1116.289) [-1113.100] * [-1118.013] (-1114.534) (-1111.896) (-1110.752) -- 0:01:23
561000 -- [-1119.508] (-1116.729) (-1112.666) (-1113.731) * (-1114.526) (-1115.769) [-1113.029] (-1124.278) -- 0:01:23
561500 -- (-1117.818) [-1118.109] (-1114.135) (-1115.495) * (-1117.556) [-1114.632] (-1114.257) (-1113.383) -- 0:01:24
562000 -- (-1111.422) (-1114.702) [-1113.320] (-1111.993) * (-1112.515) (-1120.033) (-1110.055) [-1120.969] -- 0:01:24
562500 -- (-1114.360) [-1111.852] (-1116.508) (-1109.497) * (-1122.135) (-1119.640) (-1110.646) [-1119.765] -- 0:01:24
563000 -- (-1117.006) (-1114.678) (-1113.639) [-1114.030] * [-1109.231] (-1113.264) (-1117.290) (-1118.517) -- 0:01:23
563500 -- [-1114.018] (-1117.958) (-1113.252) (-1119.720) * [-1111.504] (-1116.663) (-1114.095) (-1114.729) -- 0:01:23
564000 -- [-1111.363] (-1114.476) (-1118.417) (-1113.883) * [-1113.594] (-1115.769) (-1112.292) (-1120.392) -- 0:01:23
564500 -- [-1113.403] (-1117.177) (-1118.045) (-1115.975) * (-1115.422) (-1116.567) [-1109.411] (-1112.179) -- 0:01:23
565000 -- (-1119.336) (-1116.933) (-1113.366) [-1111.038] * (-1114.449) [-1115.975] (-1117.017) (-1108.898) -- 0:01:23
Average standard deviation of split frequencies: 0.003609
565500 -- (-1119.009) (-1116.314) (-1114.248) [-1109.484] * (-1113.133) [-1116.046] (-1111.854) (-1106.240) -- 0:01:22
566000 -- (-1118.626) [-1115.990] (-1110.636) (-1116.561) * [-1108.436] (-1119.384) (-1117.100) (-1112.647) -- 0:01:22
566500 -- (-1109.745) [-1111.704] (-1118.120) (-1121.826) * [-1113.771] (-1123.870) (-1122.481) (-1111.631) -- 0:01:23
567000 -- (-1117.893) (-1120.798) (-1112.822) [-1111.020] * (-1114.776) (-1121.614) (-1120.676) [-1115.503] -- 0:01:23
567500 -- (-1113.366) (-1121.615) [-1114.375] (-1117.715) * (-1113.070) (-1114.792) [-1115.237] (-1116.683) -- 0:01:23
568000 -- (-1114.928) (-1118.074) (-1113.622) [-1113.108] * (-1115.831) (-1111.459) [-1112.974] (-1118.107) -- 0:01:22
568500 -- (-1113.213) [-1115.766] (-1122.707) (-1117.049) * (-1120.187) [-1110.381] (-1116.932) (-1118.630) -- 0:01:22
569000 -- [-1118.795] (-1109.470) (-1108.617) (-1121.687) * (-1110.411) [-1108.513] (-1115.214) (-1114.292) -- 0:01:22
569500 -- [-1116.147] (-1112.535) (-1114.905) (-1115.892) * (-1117.559) [-1115.223] (-1113.515) (-1112.352) -- 0:01:22
570000 -- [-1114.375] (-1115.327) (-1120.966) (-1118.028) * [-1115.755] (-1117.508) (-1116.909) (-1111.459) -- 0:01:22
Average standard deviation of split frequencies: 0.003580
570500 -- (-1114.038) (-1121.353) (-1117.390) [-1114.712] * (-1111.929) (-1116.798) (-1118.692) [-1117.539] -- 0:01:22
571000 -- [-1115.924] (-1114.935) (-1112.397) (-1117.262) * [-1115.686] (-1119.872) (-1115.188) (-1115.984) -- 0:01:21
571500 -- (-1121.866) [-1110.061] (-1111.792) (-1114.296) * (-1109.950) (-1120.141) [-1113.575] (-1108.712) -- 0:01:21
572000 -- (-1111.814) (-1116.941) [-1110.880] (-1124.255) * [-1114.288] (-1123.162) (-1105.511) (-1112.190) -- 0:01:22
572500 -- (-1119.883) [-1119.058] (-1115.032) (-1115.505) * (-1115.563) (-1122.548) (-1110.989) [-1107.764] -- 0:01:22
573000 -- (-1114.144) [-1114.052] (-1116.435) (-1117.364) * (-1120.984) [-1122.299] (-1113.161) (-1106.017) -- 0:01:21
573500 -- [-1116.841] (-1121.013) (-1112.574) (-1122.246) * [-1110.741] (-1116.507) (-1110.326) (-1113.607) -- 0:01:21
574000 -- (-1115.802) (-1112.044) [-1114.867] (-1122.593) * (-1113.351) [-1115.961] (-1118.768) (-1112.515) -- 0:01:21
574500 -- (-1113.024) (-1120.709) (-1112.287) [-1117.226] * (-1113.757) (-1116.521) (-1112.545) [-1111.747] -- 0:01:21
575000 -- (-1118.306) (-1117.326) [-1117.988] (-1119.956) * (-1122.273) [-1120.488] (-1115.422) (-1109.938) -- 0:01:21
Average standard deviation of split frequencies: 0.003546
575500 -- (-1115.878) (-1110.335) [-1111.862] (-1113.692) * (-1122.729) (-1112.604) [-1119.790] (-1114.466) -- 0:01:21
576000 -- (-1121.760) (-1117.946) [-1115.233] (-1115.516) * (-1119.355) [-1108.406] (-1122.179) (-1114.430) -- 0:01:20
576500 -- (-1111.544) [-1116.046] (-1111.377) (-1115.181) * (-1117.696) (-1112.996) [-1116.317] (-1115.036) -- 0:01:20
577000 -- (-1114.807) [-1117.569] (-1110.411) (-1116.118) * (-1116.133) [-1111.719] (-1114.369) (-1119.111) -- 0:01:21
577500 -- (-1117.559) (-1115.224) [-1113.573] (-1116.036) * (-1117.647) (-1116.401) [-1114.767] (-1120.290) -- 0:01:21
578000 -- (-1114.604) [-1111.475] (-1113.289) (-1115.936) * (-1110.459) (-1116.593) (-1112.502) [-1118.854] -- 0:01:21
578500 -- [-1114.671] (-1121.674) (-1110.153) (-1115.044) * (-1117.230) [-1118.000] (-1116.243) (-1116.471) -- 0:01:20
579000 -- (-1116.013) (-1119.151) (-1110.173) [-1116.200] * [-1113.547] (-1109.762) (-1115.295) (-1118.556) -- 0:01:20
579500 -- [-1112.161] (-1112.891) (-1113.058) (-1115.412) * [-1112.330] (-1113.682) (-1115.068) (-1117.330) -- 0:01:20
580000 -- (-1109.052) [-1120.417] (-1105.758) (-1115.876) * (-1109.542) (-1114.772) (-1117.647) [-1121.759] -- 0:01:20
Average standard deviation of split frequencies: 0.004330
580500 -- (-1113.723) (-1115.219) [-1111.117] (-1117.004) * (-1113.259) (-1121.651) (-1117.107) [-1115.723] -- 0:01:20
581000 -- (-1120.325) (-1120.021) (-1113.460) [-1108.693] * (-1115.687) (-1121.637) [-1112.605] (-1117.834) -- 0:01:20
581500 -- [-1112.826] (-1117.753) (-1112.218) (-1112.248) * (-1117.069) (-1117.784) (-1115.748) [-1112.719] -- 0:01:19
582000 -- (-1121.635) (-1124.384) (-1112.516) [-1112.529] * (-1117.757) [-1117.397] (-1114.198) (-1118.072) -- 0:01:20
582500 -- (-1118.881) [-1118.328] (-1110.933) (-1112.725) * (-1115.893) [-1112.710] (-1120.911) (-1112.766) -- 0:01:20
583000 -- [-1115.497] (-1120.308) (-1116.890) (-1114.716) * (-1117.675) (-1119.205) [-1114.849] (-1128.247) -- 0:01:20
583500 -- (-1115.222) [-1114.113] (-1118.058) (-1112.810) * (-1117.483) [-1116.054] (-1110.438) (-1116.692) -- 0:01:19
584000 -- (-1112.851) (-1110.644) [-1111.651] (-1117.567) * (-1120.465) [-1121.074] (-1109.982) (-1121.358) -- 0:01:19
584500 -- (-1126.656) (-1114.947) (-1111.991) [-1110.915] * (-1126.063) [-1111.937] (-1109.306) (-1114.901) -- 0:01:19
585000 -- (-1118.058) [-1119.959] (-1111.266) (-1115.943) * [-1114.148] (-1121.800) (-1115.650) (-1122.579) -- 0:01:19
Average standard deviation of split frequencies: 0.003486
585500 -- (-1118.925) (-1113.370) [-1115.741] (-1114.170) * (-1113.524) (-1119.874) [-1112.324] (-1130.109) -- 0:01:19
586000 -- (-1123.785) (-1115.202) [-1121.503] (-1119.638) * (-1113.753) (-1121.107) [-1112.956] (-1114.129) -- 0:01:19
586500 -- [-1116.313] (-1115.628) (-1119.934) (-1121.245) * (-1111.683) (-1124.578) (-1116.130) [-1116.381] -- 0:01:18
587000 -- (-1110.953) [-1116.978] (-1113.588) (-1118.786) * [-1116.720] (-1118.013) (-1113.321) (-1112.253) -- 0:01:18
587500 -- (-1116.184) [-1110.330] (-1119.032) (-1116.699) * (-1116.311) (-1117.616) (-1119.462) [-1113.689] -- 0:01:19
588000 -- [-1110.398] (-1118.878) (-1120.071) (-1118.382) * (-1123.346) (-1110.407) [-1112.593] (-1117.933) -- 0:01:19
588500 -- (-1112.665) [-1112.925] (-1111.670) (-1116.019) * [-1110.873] (-1120.166) (-1116.836) (-1117.052) -- 0:01:19
589000 -- (-1118.469) (-1110.429) (-1115.591) [-1113.392] * (-1111.114) (-1109.786) [-1120.906] (-1115.072) -- 0:01:18
589500 -- (-1117.789) (-1109.427) [-1118.681] (-1116.246) * [-1112.760] (-1111.910) (-1114.095) (-1123.643) -- 0:01:18
590000 -- (-1121.412) [-1116.053] (-1113.356) (-1110.143) * (-1118.358) (-1110.206) (-1111.796) [-1109.449] -- 0:01:18
Average standard deviation of split frequencies: 0.003458
590500 -- [-1111.645] (-1115.675) (-1110.470) (-1114.262) * (-1113.756) (-1112.758) (-1116.839) [-1116.639] -- 0:01:18
591000 -- [-1110.148] (-1112.984) (-1114.606) (-1110.943) * (-1112.816) [-1108.698] (-1118.528) (-1113.851) -- 0:01:18
591500 -- (-1114.857) (-1109.377) (-1113.858) [-1114.432] * (-1115.982) [-1114.004] (-1112.700) (-1117.628) -- 0:01:18
592000 -- (-1111.186) (-1109.729) [-1114.129] (-1113.703) * (-1123.536) (-1116.901) (-1109.097) [-1118.772] -- 0:01:17
592500 -- (-1113.180) (-1108.164) [-1116.977] (-1121.959) * (-1118.898) (-1116.359) (-1110.618) [-1114.034] -- 0:01:18
593000 -- (-1116.463) (-1111.198) [-1111.132] (-1120.830) * (-1124.502) (-1113.503) (-1113.792) [-1114.333] -- 0:01:18
593500 -- (-1118.439) [-1112.017] (-1118.699) (-1124.238) * (-1120.718) (-1121.866) [-1109.878] (-1112.599) -- 0:01:18
594000 -- (-1116.491) (-1109.018) [-1112.361] (-1118.094) * (-1114.891) (-1115.524) (-1127.187) [-1110.831] -- 0:01:17
594500 -- (-1111.534) [-1112.745] (-1112.098) (-1111.353) * (-1112.878) [-1113.014] (-1114.134) (-1114.708) -- 0:01:17
595000 -- [-1115.650] (-1114.490) (-1118.805) (-1118.384) * (-1119.762) (-1112.666) (-1124.303) [-1117.931] -- 0:01:17
Average standard deviation of split frequencies: 0.003955
595500 -- [-1112.421] (-1115.321) (-1127.112) (-1114.652) * (-1127.850) (-1120.966) [-1111.829] (-1116.132) -- 0:01:17
596000 -- [-1112.943] (-1116.322) (-1114.254) (-1110.977) * (-1115.105) (-1114.688) [-1113.369] (-1112.646) -- 0:01:17
596500 -- (-1126.392) [-1116.254] (-1112.725) (-1115.360) * (-1123.200) [-1113.999] (-1110.645) (-1116.911) -- 0:01:17
597000 -- (-1118.889) (-1115.178) (-1122.054) [-1116.071] * [-1110.954] (-1119.147) (-1114.308) (-1123.803) -- 0:01:16
597500 -- (-1111.869) [-1114.222] (-1123.927) (-1120.372) * (-1117.993) (-1113.467) (-1117.221) [-1116.032] -- 0:01:16
598000 -- (-1118.333) [-1113.608] (-1115.380) (-1117.468) * [-1117.323] (-1111.328) (-1111.626) (-1114.716) -- 0:01:17
598500 -- (-1112.986) (-1114.433) [-1115.295] (-1115.542) * (-1111.111) (-1111.588) (-1113.009) [-1118.491] -- 0:01:17
599000 -- (-1115.491) (-1116.865) (-1118.919) [-1111.054] * (-1113.314) (-1122.349) [-1110.851] (-1116.660) -- 0:01:16
599500 -- (-1122.051) (-1119.463) [-1119.848] (-1117.393) * (-1118.175) [-1112.538] (-1124.772) (-1117.286) -- 0:01:16
600000 -- (-1110.710) [-1113.201] (-1113.107) (-1119.664) * (-1117.965) [-1112.344] (-1119.898) (-1115.810) -- 0:01:16
Average standard deviation of split frequencies: 0.003662
600500 -- (-1109.566) [-1111.312] (-1112.746) (-1123.902) * (-1118.666) (-1115.236) [-1121.105] (-1115.146) -- 0:01:16
601000 -- (-1114.292) (-1110.646) (-1109.144) [-1116.142] * [-1120.577] (-1113.498) (-1112.561) (-1113.570) -- 0:01:16
601500 -- (-1113.063) [-1112.832] (-1109.327) (-1113.612) * (-1117.015) (-1119.919) (-1116.124) [-1112.205] -- 0:01:16
602000 -- [-1112.385] (-1117.692) (-1118.671) (-1122.724) * (-1115.155) (-1116.338) (-1118.594) [-1114.430] -- 0:01:16
602500 -- (-1112.827) (-1115.090) [-1112.371] (-1118.345) * (-1113.368) [-1108.937] (-1119.668) (-1116.633) -- 0:01:15
603000 -- [-1119.215] (-1111.897) (-1115.473) (-1115.363) * (-1114.135) (-1109.265) (-1129.375) [-1120.272] -- 0:01:16
603500 -- [-1110.341] (-1110.651) (-1114.943) (-1127.631) * (-1113.549) [-1109.639] (-1121.991) (-1121.946) -- 0:01:16
604000 -- (-1124.093) (-1122.944) (-1115.329) [-1114.895] * (-1120.590) (-1117.496) (-1118.821) [-1117.241] -- 0:01:16
604500 -- (-1116.454) [-1112.276] (-1114.403) (-1125.626) * (-1110.586) (-1114.420) [-1112.582] (-1120.551) -- 0:01:15
605000 -- [-1111.037] (-1116.270) (-1108.824) (-1117.727) * (-1117.758) (-1117.503) (-1113.720) [-1121.113] -- 0:01:15
Average standard deviation of split frequencies: 0.004149
605500 -- [-1111.006] (-1119.807) (-1112.445) (-1113.424) * (-1113.802) (-1114.796) [-1112.285] (-1111.986) -- 0:01:15
606000 -- (-1115.438) (-1121.818) (-1123.300) [-1115.435] * (-1121.206) [-1114.154] (-1109.801) (-1111.167) -- 0:01:15
606500 -- (-1117.576) [-1113.949] (-1117.100) (-1117.730) * [-1111.262] (-1119.636) (-1116.381) (-1121.849) -- 0:01:15
607000 -- (-1114.563) (-1114.224) (-1110.276) [-1114.564] * [-1111.997] (-1111.046) (-1116.388) (-1119.582) -- 0:01:15
607500 -- (-1107.758) (-1112.841) (-1113.748) [-1110.657] * (-1116.054) [-1121.822] (-1115.042) (-1122.321) -- 0:01:14
608000 -- (-1109.551) [-1115.286] (-1118.683) (-1118.047) * (-1113.287) [-1112.602] (-1113.680) (-1123.786) -- 0:01:15
608500 -- (-1116.525) (-1115.832) [-1110.783] (-1113.019) * (-1116.848) (-1122.879) [-1105.847] (-1125.515) -- 0:01:15
609000 -- (-1121.646) (-1120.666) [-1109.315] (-1115.557) * [-1112.822] (-1126.875) (-1116.849) (-1120.474) -- 0:01:15
609500 -- (-1113.366) [-1113.591] (-1110.870) (-1114.898) * (-1115.863) (-1113.426) (-1122.657) [-1117.966] -- 0:01:14
610000 -- (-1119.684) (-1117.634) [-1117.215] (-1114.355) * (-1113.883) (-1117.627) [-1110.126] (-1118.462) -- 0:01:14
Average standard deviation of split frequencies: 0.003860
610500 -- (-1120.177) (-1115.920) [-1114.206] (-1110.772) * [-1114.715] (-1121.728) (-1112.283) (-1116.447) -- 0:01:14
611000 -- (-1124.082) [-1116.280] (-1116.973) (-1116.048) * (-1114.336) (-1117.437) (-1112.671) [-1121.563] -- 0:01:14
611500 -- (-1119.150) [-1111.550] (-1115.642) (-1113.045) * (-1117.763) [-1111.053] (-1115.629) (-1123.537) -- 0:01:14
612000 -- (-1121.522) (-1113.794) (-1116.977) [-1120.954] * (-1123.924) [-1115.719] (-1121.125) (-1120.845) -- 0:01:14
612500 -- (-1113.816) [-1113.657] (-1119.463) (-1112.720) * [-1116.461] (-1115.206) (-1114.239) (-1112.515) -- 0:01:14
613000 -- (-1121.793) (-1122.883) (-1113.386) [-1110.670] * (-1125.595) (-1115.964) [-1110.296] (-1112.715) -- 0:01:13
613500 -- (-1116.091) [-1111.879] (-1120.287) (-1113.477) * (-1111.926) [-1111.163] (-1115.698) (-1115.506) -- 0:01:14
614000 -- (-1120.063) (-1111.549) (-1122.301) [-1111.844] * (-1119.353) (-1111.299) [-1117.004] (-1116.506) -- 0:01:14
614500 -- (-1119.096) [-1113.640] (-1117.586) (-1118.242) * (-1122.929) (-1116.252) [-1113.600] (-1117.263) -- 0:01:14
615000 -- (-1111.737) [-1112.310] (-1111.389) (-1117.030) * (-1117.092) (-1114.618) (-1110.772) [-1115.857] -- 0:01:13
Average standard deviation of split frequencies: 0.004081
615500 -- [-1112.890] (-1109.086) (-1111.922) (-1118.839) * [-1113.501] (-1121.483) (-1116.915) (-1115.801) -- 0:01:13
616000 -- (-1113.206) (-1110.529) [-1113.327] (-1126.149) * (-1110.434) (-1116.093) [-1118.221] (-1113.537) -- 0:01:13
616500 -- (-1122.489) (-1110.800) (-1115.902) [-1113.206] * (-1120.120) (-1119.285) [-1121.725] (-1110.720) -- 0:01:13
617000 -- [-1115.592] (-1115.917) (-1114.316) (-1120.139) * [-1115.358] (-1115.281) (-1117.599) (-1118.632) -- 0:01:13
617500 -- (-1121.584) (-1116.698) [-1110.447] (-1112.099) * (-1114.820) (-1115.878) (-1118.204) [-1116.144] -- 0:01:13
618000 -- (-1121.440) (-1118.839) [-1112.494] (-1114.628) * (-1108.406) (-1122.536) [-1121.656] (-1112.971) -- 0:01:12
618500 -- (-1127.191) [-1114.541] (-1110.684) (-1111.254) * [-1113.072] (-1114.703) (-1111.525) (-1111.627) -- 0:01:13
619000 -- (-1121.915) (-1114.955) [-1108.959] (-1109.505) * (-1115.361) (-1112.056) (-1110.877) [-1116.242] -- 0:01:13
619500 -- (-1122.848) [-1113.644] (-1110.391) (-1111.374) * (-1116.687) [-1113.072] (-1114.469) (-1114.729) -- 0:01:13
620000 -- [-1117.779] (-1111.944) (-1112.788) (-1113.508) * (-1114.033) (-1110.565) [-1122.665] (-1112.321) -- 0:01:12
Average standard deviation of split frequencies: 0.004051
620500 -- (-1114.205) (-1111.308) (-1115.640) [-1122.305] * (-1113.951) (-1122.288) (-1116.203) [-1116.078] -- 0:01:12
621000 -- (-1111.882) (-1121.424) [-1112.045] (-1110.353) * [-1112.129] (-1116.906) (-1122.246) (-1116.872) -- 0:01:12
621500 -- (-1122.160) [-1115.072] (-1113.767) (-1116.634) * (-1109.467) (-1110.558) (-1112.799) [-1119.201] -- 0:01:12
622000 -- (-1117.659) (-1115.940) [-1109.604] (-1123.964) * (-1115.024) (-1117.048) [-1114.902] (-1112.898) -- 0:01:12
622500 -- (-1110.858) [-1117.947] (-1115.942) (-1124.882) * (-1119.921) [-1117.802] (-1115.847) (-1109.741) -- 0:01:12
623000 -- (-1112.864) (-1117.898) (-1113.760) [-1110.304] * (-1111.684) (-1120.307) [-1114.851] (-1113.714) -- 0:01:12
623500 -- [-1115.683] (-1112.065) (-1128.183) (-1117.929) * (-1119.082) (-1110.904) (-1111.202) [-1113.045] -- 0:01:12
624000 -- [-1114.122] (-1121.701) (-1117.016) (-1121.356) * [-1117.221] (-1114.902) (-1112.038) (-1111.438) -- 0:01:12
624500 -- [-1115.051] (-1113.993) (-1112.850) (-1115.902) * (-1120.277) [-1113.276] (-1111.762) (-1110.174) -- 0:01:12
625000 -- [-1113.282] (-1117.167) (-1116.774) (-1121.706) * [-1113.838] (-1114.693) (-1125.800) (-1117.228) -- 0:01:12
Average standard deviation of split frequencies: 0.004016
625500 -- (-1110.321) [-1112.231] (-1111.804) (-1117.119) * [-1115.206] (-1111.825) (-1118.358) (-1116.647) -- 0:01:11
626000 -- (-1115.912) (-1129.288) (-1122.260) [-1115.572] * (-1114.000) [-1113.512] (-1114.546) (-1119.849) -- 0:01:11
626500 -- (-1119.592) (-1116.043) [-1119.658] (-1111.319) * (-1119.504) (-1111.665) [-1111.864] (-1110.670) -- 0:01:11
627000 -- (-1114.141) (-1120.286) [-1118.134] (-1112.284) * [-1113.939] (-1112.218) (-1113.857) (-1119.116) -- 0:01:11
627500 -- (-1117.830) (-1116.886) [-1115.392] (-1119.417) * (-1113.520) [-1116.725] (-1112.040) (-1114.286) -- 0:01:11
628000 -- (-1115.465) (-1124.043) (-1111.213) [-1119.722] * (-1120.162) [-1116.118] (-1119.913) (-1111.239) -- 0:01:11
628500 -- (-1114.309) (-1116.311) [-1113.687] (-1117.138) * (-1120.770) [-1111.451] (-1120.931) (-1117.316) -- 0:01:10
629000 -- (-1115.153) (-1112.178) (-1119.089) [-1113.978] * (-1113.709) [-1109.028] (-1121.801) (-1115.242) -- 0:01:11
629500 -- (-1123.738) (-1113.863) (-1119.207) [-1110.221] * (-1113.961) [-1110.211] (-1117.514) (-1108.867) -- 0:01:11
630000 -- [-1115.153] (-1125.714) (-1113.016) (-1118.068) * (-1116.373) (-1108.425) [-1116.917] (-1119.437) -- 0:01:11
Average standard deviation of split frequencies: 0.003987
630500 -- (-1124.565) (-1125.703) [-1119.735] (-1116.207) * (-1117.059) (-1110.321) [-1117.221] (-1126.374) -- 0:01:10
631000 -- (-1122.476) (-1118.703) (-1117.372) [-1112.322] * (-1114.444) (-1113.322) [-1117.329] (-1118.679) -- 0:01:10
631500 -- (-1123.670) (-1113.874) [-1116.032] (-1115.906) * (-1125.474) (-1113.828) [-1111.262] (-1116.167) -- 0:01:10
632000 -- (-1121.190) (-1115.078) [-1114.156] (-1111.588) * (-1114.533) (-1112.187) [-1115.486] (-1124.196) -- 0:01:10
632500 -- (-1122.241) (-1123.979) (-1109.233) [-1109.131] * (-1114.978) [-1117.578] (-1123.964) (-1117.928) -- 0:01:10
633000 -- (-1112.981) [-1114.578] (-1119.247) (-1110.555) * [-1112.397] (-1118.857) (-1114.865) (-1123.183) -- 0:01:10
633500 -- [-1108.402] (-1113.041) (-1113.746) (-1122.034) * (-1124.282) (-1114.371) [-1111.830] (-1125.076) -- 0:01:10
634000 -- (-1113.101) [-1109.287] (-1115.997) (-1109.738) * [-1111.595] (-1118.522) (-1110.830) (-1129.460) -- 0:01:10
634500 -- (-1118.973) (-1115.095) [-1110.373] (-1111.172) * (-1115.272) (-1115.970) [-1109.986] (-1113.620) -- 0:01:10
635000 -- (-1122.980) [-1113.606] (-1111.457) (-1114.638) * (-1115.673) (-1114.887) (-1117.549) [-1113.730] -- 0:01:10
Average standard deviation of split frequencies: 0.004200
635500 -- (-1118.458) (-1119.209) [-1110.537] (-1120.611) * (-1114.611) [-1114.441] (-1117.040) (-1113.364) -- 0:01:09
636000 -- (-1117.789) [-1108.579] (-1113.882) (-1119.066) * [-1113.395] (-1111.626) (-1114.494) (-1111.683) -- 0:01:09
636500 -- (-1118.352) [-1111.509] (-1118.037) (-1114.423) * [-1112.437] (-1117.283) (-1114.885) (-1114.551) -- 0:01:09
637000 -- [-1111.830] (-1110.026) (-1118.159) (-1113.841) * (-1118.230) (-1111.388) (-1111.064) [-1109.066] -- 0:01:09
637500 -- (-1118.083) [-1110.640] (-1114.907) (-1113.078) * [-1119.032] (-1116.666) (-1110.911) (-1119.572) -- 0:01:09
638000 -- (-1112.445) (-1120.390) [-1111.849] (-1111.481) * (-1111.440) (-1110.879) (-1111.707) [-1107.698] -- 0:01:09
638500 -- (-1112.042) (-1117.563) [-1119.183] (-1116.118) * (-1114.410) (-1115.047) [-1111.310] (-1116.110) -- 0:01:09
639000 -- [-1110.741] (-1126.585) (-1114.567) (-1117.719) * (-1114.408) (-1120.123) [-1116.251] (-1114.862) -- 0:01:09
639500 -- (-1109.072) (-1119.522) [-1112.735] (-1118.616) * [-1115.103] (-1114.484) (-1108.472) (-1116.318) -- 0:01:09
640000 -- (-1117.677) (-1115.674) (-1119.216) [-1112.047] * (-1125.529) (-1115.261) [-1108.452] (-1114.451) -- 0:01:09
Average standard deviation of split frequencies: 0.004170
640500 -- (-1112.560) [-1118.574] (-1113.615) (-1112.134) * (-1110.347) (-1116.637) [-1114.559] (-1108.554) -- 0:01:09
641000 -- (-1110.673) (-1112.802) [-1115.059] (-1115.452) * (-1112.941) (-1113.108) [-1116.279] (-1114.287) -- 0:01:08
641500 -- [-1119.720] (-1108.564) (-1124.633) (-1111.049) * (-1120.906) [-1119.355] (-1112.267) (-1112.342) -- 0:01:08
642000 -- (-1115.666) (-1119.488) [-1111.471] (-1113.025) * (-1121.345) (-1116.213) [-1112.194] (-1123.615) -- 0:01:08
642500 -- (-1116.118) [-1118.792] (-1115.219) (-1120.664) * (-1123.321) (-1109.757) (-1113.950) [-1111.469] -- 0:01:08
643000 -- (-1119.491) (-1118.588) (-1111.821) [-1121.057] * [-1115.582] (-1110.474) (-1114.330) (-1114.577) -- 0:01:08
643500 -- (-1114.754) [-1118.271] (-1111.371) (-1115.359) * (-1117.140) (-1123.965) [-1114.835] (-1119.539) -- 0:01:08
644000 -- (-1123.338) (-1122.774) (-1113.993) [-1116.777] * [-1114.362] (-1120.861) (-1111.847) (-1115.627) -- 0:01:07
644500 -- (-1111.324) [-1113.347] (-1113.777) (-1115.966) * [-1110.032] (-1114.189) (-1111.597) (-1113.914) -- 0:01:08
645000 -- [-1112.057] (-1118.503) (-1111.727) (-1117.643) * [-1115.920] (-1119.097) (-1117.297) (-1113.180) -- 0:01:08
Average standard deviation of split frequencies: 0.003892
645500 -- (-1112.849) [-1114.736] (-1123.512) (-1116.330) * [-1111.125] (-1118.078) (-1120.359) (-1115.449) -- 0:01:08
646000 -- (-1108.511) (-1117.009) (-1117.501) [-1116.806] * (-1115.668) [-1115.690] (-1120.921) (-1116.725) -- 0:01:07
646500 -- (-1115.761) [-1115.189] (-1117.152) (-1121.009) * (-1112.341) (-1114.089) (-1119.932) [-1109.687] -- 0:01:07
647000 -- (-1113.888) [-1115.833] (-1114.602) (-1113.923) * [-1111.316] (-1109.759) (-1115.923) (-1111.599) -- 0:01:07
647500 -- (-1115.153) (-1114.704) [-1110.313] (-1112.087) * (-1114.970) [-1109.051] (-1121.403) (-1113.954) -- 0:01:07
648000 -- [-1111.260] (-1125.012) (-1125.169) (-1115.615) * (-1121.259) (-1114.253) (-1117.807) [-1113.566] -- 0:01:07
648500 -- (-1113.324) [-1124.990] (-1115.468) (-1120.002) * (-1114.226) (-1108.856) (-1115.445) [-1111.333] -- 0:01:07
649000 -- [-1116.393] (-1116.374) (-1117.525) (-1115.257) * (-1115.535) (-1110.642) (-1114.162) [-1111.614] -- 0:01:07
649500 -- (-1118.145) (-1110.867) [-1120.620] (-1105.909) * (-1118.448) [-1114.297] (-1117.661) (-1124.355) -- 0:01:06
650000 -- (-1115.733) [-1112.379] (-1112.398) (-1115.162) * (-1115.241) [-1111.421] (-1112.015) (-1115.226) -- 0:01:07
Average standard deviation of split frequencies: 0.003622
650500 -- (-1118.843) (-1115.143) [-1109.426] (-1112.097) * (-1114.865) [-1115.217] (-1109.818) (-1112.653) -- 0:01:07
651000 -- (-1117.386) [-1113.870] (-1115.479) (-1118.495) * (-1120.668) (-1122.187) [-1116.864] (-1115.022) -- 0:01:07
651500 -- (-1115.555) (-1113.219) (-1115.444) [-1117.301] * (-1117.446) (-1120.974) [-1112.385] (-1110.950) -- 0:01:06
652000 -- [-1113.420] (-1113.723) (-1112.374) (-1113.036) * (-1118.698) [-1115.822] (-1116.218) (-1119.953) -- 0:01:06
652500 -- (-1126.219) [-1109.106] (-1113.845) (-1117.582) * [-1118.177] (-1115.640) (-1116.013) (-1118.752) -- 0:01:06
653000 -- (-1120.191) [-1113.630] (-1115.645) (-1112.528) * (-1115.411) (-1110.903) [-1112.126] (-1117.205) -- 0:01:06
653500 -- (-1112.764) (-1114.787) (-1110.080) [-1109.044] * (-1125.907) [-1113.126] (-1113.958) (-1113.599) -- 0:01:06
654000 -- (-1115.068) [-1111.261] (-1120.709) (-1118.374) * (-1117.403) (-1110.729) (-1120.867) [-1114.805] -- 0:01:06
654500 -- (-1113.711) (-1113.796) [-1109.151] (-1115.866) * (-1119.277) (-1114.646) (-1118.415) [-1110.622] -- 0:01:05
655000 -- (-1110.750) [-1108.625] (-1118.391) (-1111.553) * (-1114.948) (-1115.674) [-1111.162] (-1111.701) -- 0:01:06
Average standard deviation of split frequencies: 0.003353
655500 -- (-1113.303) [-1111.585] (-1117.550) (-1113.987) * (-1117.538) (-1120.419) [-1114.523] (-1120.359) -- 0:01:06
656000 -- (-1118.545) (-1110.837) [-1111.062] (-1113.587) * (-1117.056) [-1119.256] (-1113.793) (-1110.877) -- 0:01:06
656500 -- (-1117.971) [-1117.509] (-1119.885) (-1123.222) * (-1115.510) (-1117.061) [-1115.944] (-1111.612) -- 0:01:05
657000 -- (-1110.053) (-1117.658) [-1114.255] (-1113.591) * [-1116.024] (-1114.660) (-1114.958) (-1111.852) -- 0:01:05
657500 -- (-1117.637) (-1119.964) (-1111.139) [-1115.647] * (-1111.412) (-1116.537) (-1119.057) [-1117.944] -- 0:01:05
658000 -- (-1116.272) [-1112.015] (-1110.919) (-1117.581) * (-1111.498) (-1112.842) [-1112.974] (-1123.007) -- 0:01:05
658500 -- (-1114.756) [-1111.659] (-1120.840) (-1116.326) * (-1116.920) (-1118.848) [-1109.095] (-1111.784) -- 0:01:05
659000 -- (-1129.447) (-1113.426) [-1111.935] (-1119.196) * (-1117.106) (-1113.709) (-1111.607) [-1110.394] -- 0:01:05
659500 -- (-1120.038) [-1114.754] (-1111.707) (-1117.114) * (-1117.004) (-1118.551) [-1112.044] (-1112.686) -- 0:01:05
660000 -- (-1115.392) [-1111.229] (-1110.964) (-1118.017) * (-1115.890) (-1111.756) [-1110.255] (-1115.508) -- 0:01:04
Average standard deviation of split frequencies: 0.003805
660500 -- (-1123.226) (-1121.059) [-1108.750] (-1122.856) * [-1112.048] (-1124.070) (-1114.613) (-1113.610) -- 0:01:05
661000 -- (-1114.885) (-1113.905) [-1111.686] (-1112.544) * (-1114.989) (-1110.832) [-1116.720] (-1115.596) -- 0:01:05
661500 -- (-1117.269) [-1110.636] (-1111.823) (-1122.334) * [-1109.901] (-1114.647) (-1112.551) (-1114.174) -- 0:01:04
662000 -- (-1113.992) (-1111.805) (-1112.618) [-1114.523] * [-1113.756] (-1110.842) (-1111.064) (-1122.336) -- 0:01:04
662500 -- (-1116.719) (-1115.407) (-1114.870) [-1115.242] * (-1108.032) [-1111.503] (-1118.590) (-1110.301) -- 0:01:04
663000 -- (-1118.192) [-1110.402] (-1118.998) (-1116.143) * (-1120.800) (-1115.132) [-1112.615] (-1112.461) -- 0:01:04
663500 -- [-1118.019] (-1118.531) (-1122.039) (-1118.431) * [-1122.318] (-1111.784) (-1122.381) (-1116.630) -- 0:01:04
664000 -- (-1115.939) (-1110.324) [-1114.193] (-1114.761) * (-1128.971) [-1109.880] (-1112.772) (-1124.125) -- 0:01:04
664500 -- (-1112.167) [-1114.347] (-1109.680) (-1118.095) * (-1118.093) (-1117.461) [-1112.763] (-1117.269) -- 0:01:04
665000 -- [-1118.204] (-1120.715) (-1113.756) (-1125.030) * (-1109.906) (-1112.907) [-1118.226] (-1113.872) -- 0:01:03
Average standard deviation of split frequencies: 0.004247
665500 -- [-1114.631] (-1112.605) (-1112.211) (-1113.631) * (-1116.555) (-1115.983) [-1114.627] (-1114.960) -- 0:01:04
666000 -- (-1114.718) (-1113.086) [-1114.781] (-1114.772) * [-1115.360] (-1114.170) (-1121.771) (-1114.019) -- 0:01:04
666500 -- (-1112.525) [-1110.130] (-1122.103) (-1118.890) * (-1112.414) (-1117.362) (-1118.012) [-1112.178] -- 0:01:04
667000 -- (-1117.392) [-1115.752] (-1116.542) (-1117.946) * [-1119.966] (-1113.213) (-1124.584) (-1116.462) -- 0:01:03
667500 -- (-1114.971) [-1117.594] (-1120.243) (-1109.728) * (-1123.832) (-1119.809) (-1120.365) [-1111.647] -- 0:01:03
668000 -- (-1111.977) (-1119.493) (-1116.301) [-1108.549] * (-1114.424) [-1114.817] (-1130.721) (-1112.071) -- 0:01:03
668500 -- (-1111.000) (-1119.092) (-1116.418) [-1111.535] * (-1117.018) (-1113.321) [-1113.913] (-1114.356) -- 0:01:03
669000 -- (-1118.046) (-1111.029) (-1123.091) [-1114.835] * (-1118.515) (-1120.457) (-1108.845) [-1110.200] -- 0:01:03
669500 -- (-1116.306) [-1115.806] (-1113.201) (-1117.223) * [-1110.731] (-1115.896) (-1110.541) (-1111.477) -- 0:01:03
670000 -- (-1109.969) (-1115.068) [-1114.892] (-1116.211) * (-1114.801) [-1113.009] (-1111.608) (-1112.914) -- 0:01:03
Average standard deviation of split frequencies: 0.003983
670500 -- [-1113.033] (-1118.407) (-1112.788) (-1113.405) * (-1127.945) (-1113.733) [-1110.541] (-1117.898) -- 0:01:02
671000 -- (-1115.179) [-1118.179] (-1118.936) (-1114.728) * (-1110.738) (-1110.706) [-1115.618] (-1111.255) -- 0:01:03
671500 -- (-1121.747) (-1125.769) [-1110.654] (-1114.316) * (-1112.326) (-1114.541) [-1111.304] (-1117.952) -- 0:01:03
672000 -- (-1120.509) (-1125.311) [-1112.089] (-1120.761) * (-1118.980) [-1123.394] (-1112.862) (-1110.067) -- 0:01:02
672500 -- (-1118.437) (-1113.696) (-1111.156) [-1111.911] * (-1110.284) (-1107.996) (-1119.478) [-1114.039] -- 0:01:02
673000 -- (-1114.466) (-1115.764) (-1110.101) [-1114.495] * (-1113.384) (-1116.514) (-1123.085) [-1111.011] -- 0:01:02
673500 -- (-1112.228) (-1115.061) [-1111.715] (-1116.059) * (-1118.469) [-1112.801] (-1115.664) (-1113.458) -- 0:01:02
674000 -- (-1111.642) [-1120.976] (-1114.935) (-1114.331) * [-1113.246] (-1111.036) (-1117.740) (-1113.999) -- 0:01:02
674500 -- (-1110.903) (-1118.224) (-1112.636) [-1113.499] * (-1121.058) (-1110.185) (-1114.364) [-1112.975] -- 0:01:02
675000 -- (-1115.217) (-1112.983) (-1111.777) [-1123.801] * (-1124.516) (-1120.366) [-1115.009] (-1114.494) -- 0:01:02
Average standard deviation of split frequencies: 0.003952
675500 -- (-1125.934) (-1111.702) (-1119.125) [-1115.351] * (-1119.648) (-1111.902) [-1123.170] (-1122.815) -- 0:01:01
676000 -- (-1111.008) (-1111.523) (-1109.914) [-1119.719] * (-1110.786) [-1110.150] (-1117.751) (-1114.811) -- 0:01:01
676500 -- [-1109.137] (-1118.882) (-1114.508) (-1115.641) * (-1121.272) [-1115.140] (-1116.382) (-1113.127) -- 0:01:02
677000 -- (-1111.711) [-1115.456] (-1119.876) (-1112.522) * [-1110.476] (-1110.477) (-1119.926) (-1110.843) -- 0:01:02
677500 -- (-1115.382) [-1116.804] (-1108.866) (-1119.086) * [-1111.439] (-1111.156) (-1121.761) (-1117.422) -- 0:01:01
678000 -- (-1117.299) (-1112.371) [-1109.263] (-1118.658) * [-1111.843] (-1118.859) (-1126.279) (-1113.271) -- 0:01:01
678500 -- [-1118.696] (-1115.567) (-1111.212) (-1114.375) * (-1112.232) [-1109.014] (-1115.911) (-1129.733) -- 0:01:01
679000 -- (-1116.863) (-1114.855) (-1108.362) [-1117.117] * [-1117.988] (-1109.937) (-1114.376) (-1110.077) -- 0:01:01
679500 -- (-1113.616) [-1111.747] (-1117.230) (-1116.684) * [-1111.687] (-1110.089) (-1122.272) (-1114.719) -- 0:01:01
680000 -- (-1113.168) (-1110.905) (-1116.250) [-1114.836] * [-1114.078] (-1110.355) (-1121.322) (-1116.193) -- 0:01:01
Average standard deviation of split frequencies: 0.003925
680500 -- (-1117.358) [-1115.728] (-1115.257) (-1121.444) * (-1114.140) (-1112.831) (-1121.856) [-1111.927] -- 0:01:01
681000 -- (-1113.038) (-1110.731) (-1114.768) [-1114.251] * [-1112.140] (-1109.555) (-1121.224) (-1114.428) -- 0:01:00
681500 -- (-1120.065) (-1113.742) [-1116.055] (-1113.979) * [-1114.419] (-1114.525) (-1112.271) (-1115.097) -- 0:01:01
682000 -- (-1115.501) (-1114.002) (-1113.161) [-1114.529] * (-1115.634) [-1121.773] (-1112.988) (-1113.939) -- 0:01:01
682500 -- (-1118.583) (-1115.605) (-1114.463) [-1113.777] * [-1110.065] (-1119.270) (-1114.709) (-1115.592) -- 0:01:00
683000 -- (-1116.358) (-1115.330) (-1122.195) [-1112.260] * (-1112.778) [-1108.627] (-1115.114) (-1113.615) -- 0:01:00
683500 -- (-1118.499) [-1110.157] (-1121.788) (-1111.272) * (-1121.462) (-1117.442) (-1118.530) [-1112.810] -- 0:01:00
684000 -- [-1113.884] (-1119.528) (-1119.670) (-1112.122) * (-1111.582) (-1116.719) (-1122.072) [-1113.655] -- 0:01:00
684500 -- (-1111.983) (-1115.994) [-1109.650] (-1112.382) * (-1110.757) (-1111.770) [-1114.190] (-1109.604) -- 0:01:00
685000 -- (-1113.063) [-1112.340] (-1118.341) (-1114.250) * (-1120.444) [-1113.817] (-1125.640) (-1111.743) -- 0:01:00
Average standard deviation of split frequencies: 0.003894
685500 -- (-1111.916) (-1116.427) [-1112.685] (-1123.847) * (-1116.044) (-1122.956) [-1113.644] (-1114.395) -- 0:01:00
686000 -- (-1115.415) [-1118.550] (-1116.880) (-1111.582) * (-1113.423) (-1111.095) (-1113.232) [-1118.890] -- 0:00:59
686500 -- (-1121.335) (-1115.219) (-1120.667) [-1112.008] * (-1111.454) (-1112.132) (-1117.290) [-1114.571] -- 0:00:59
687000 -- (-1115.896) (-1118.866) [-1113.672] (-1114.169) * (-1110.138) (-1118.784) (-1116.502) [-1107.645] -- 0:01:00
687500 -- [-1117.912] (-1116.912) (-1116.243) (-1115.286) * (-1117.184) (-1118.080) (-1116.458) [-1113.638] -- 0:01:00
688000 -- (-1115.577) [-1115.660] (-1116.600) (-1117.095) * (-1114.444) (-1119.442) (-1118.519) [-1113.383] -- 0:00:59
688500 -- (-1116.834) [-1112.117] (-1119.082) (-1117.027) * (-1115.190) [-1114.482] (-1113.890) (-1111.923) -- 0:00:59
689000 -- (-1120.980) (-1113.109) (-1117.172) [-1111.740] * [-1117.668] (-1117.822) (-1117.054) (-1121.722) -- 0:00:59
689500 -- (-1117.955) [-1113.114] (-1112.707) (-1112.399) * (-1118.030) (-1113.888) [-1110.656] (-1113.027) -- 0:00:59
690000 -- (-1119.086) (-1109.184) (-1116.722) [-1115.419] * [-1118.235] (-1115.031) (-1114.825) (-1119.464) -- 0:00:59
Average standard deviation of split frequencies: 0.002958
690500 -- (-1116.143) [-1113.188] (-1113.264) (-1109.983) * (-1121.066) (-1114.291) (-1122.185) [-1110.156] -- 0:00:59
691000 -- (-1119.016) [-1118.704] (-1110.846) (-1113.571) * (-1110.196) (-1110.960) (-1114.577) [-1115.230] -- 0:00:59
691500 -- [-1121.165] (-1113.194) (-1114.233) (-1115.558) * (-1120.219) (-1114.219) [-1112.308] (-1114.110) -- 0:00:58
692000 -- (-1118.938) [-1113.179] (-1115.885) (-1115.389) * (-1109.469) (-1117.069) [-1111.733] (-1118.253) -- 0:00:59
692500 -- (-1120.394) (-1117.097) [-1112.923] (-1119.002) * (-1115.482) (-1113.424) [-1118.315] (-1117.145) -- 0:00:59
693000 -- (-1118.895) (-1114.254) [-1111.880] (-1117.187) * (-1115.388) (-1113.772) (-1120.072) [-1114.778] -- 0:00:58
693500 -- (-1110.542) [-1110.315] (-1112.311) (-1116.686) * (-1113.636) [-1112.667] (-1120.814) (-1120.001) -- 0:00:58
694000 -- [-1112.892] (-1116.327) (-1113.128) (-1112.630) * [-1115.101] (-1114.811) (-1122.363) (-1115.956) -- 0:00:58
694500 -- (-1119.501) [-1112.988] (-1118.691) (-1116.257) * (-1120.677) (-1114.199) [-1114.203] (-1107.973) -- 0:00:58
695000 -- (-1114.991) [-1116.322] (-1115.767) (-1115.109) * (-1118.601) [-1118.381] (-1112.553) (-1113.746) -- 0:00:58
Average standard deviation of split frequencies: 0.002935
695500 -- (-1115.149) (-1113.124) (-1117.818) [-1115.667] * (-1119.140) (-1115.192) (-1119.267) [-1108.263] -- 0:00:58
696000 -- (-1110.890) [-1113.664] (-1110.845) (-1115.722) * (-1118.935) (-1120.395) [-1115.034] (-1109.853) -- 0:00:58
696500 -- (-1116.038) (-1115.051) [-1113.594] (-1111.933) * (-1111.440) [-1116.688] (-1112.429) (-1114.566) -- 0:00:57
697000 -- (-1120.158) (-1120.093) (-1112.738) [-1114.786] * (-1116.146) (-1115.287) [-1115.363] (-1120.300) -- 0:00:57
697500 -- (-1115.425) (-1110.802) (-1113.188) [-1111.707] * (-1120.685) (-1113.200) [-1111.030] (-1129.726) -- 0:00:58
698000 -- (-1113.735) (-1126.751) [-1113.250] (-1113.516) * [-1113.870] (-1114.402) (-1117.184) (-1120.499) -- 0:00:57
698500 -- (-1114.920) [-1109.268] (-1120.812) (-1114.571) * (-1113.010) (-1110.829) (-1123.673) [-1114.309] -- 0:00:57
699000 -- (-1119.963) (-1110.725) [-1116.355] (-1113.515) * [-1119.499] (-1109.026) (-1114.534) (-1110.903) -- 0:00:57
699500 -- (-1112.258) [-1112.042] (-1111.922) (-1112.675) * (-1119.872) [-1114.642] (-1118.605) (-1124.580) -- 0:00:57
700000 -- (-1111.483) [-1114.068] (-1113.068) (-1115.613) * (-1118.415) (-1115.958) (-1114.148) [-1109.536] -- 0:00:57
Average standard deviation of split frequencies: 0.002691
700500 -- (-1116.730) (-1112.848) (-1122.483) [-1114.725] * (-1115.532) [-1111.171] (-1110.277) (-1107.762) -- 0:00:57
701000 -- (-1118.344) (-1117.885) [-1109.679] (-1114.325) * (-1110.415) (-1114.062) (-1118.450) [-1114.499] -- 0:00:57
701500 -- (-1115.365) [-1114.111] (-1111.014) (-1112.509) * (-1118.594) (-1113.612) [-1114.368] (-1117.519) -- 0:00:57
702000 -- (-1114.466) [-1112.571] (-1114.706) (-1113.684) * (-1113.148) (-1116.222) (-1117.517) [-1114.229] -- 0:00:56
702500 -- [-1112.125] (-1111.128) (-1114.588) (-1112.034) * [-1110.653] (-1123.528) (-1120.045) (-1114.582) -- 0:00:57
703000 -- [-1118.608] (-1114.981) (-1118.350) (-1117.454) * (-1113.432) (-1116.265) [-1119.708] (-1113.579) -- 0:00:57
703500 -- (-1116.451) (-1111.992) (-1111.187) [-1111.941] * (-1119.454) (-1121.740) [-1117.701] (-1116.965) -- 0:00:56
704000 -- (-1115.584) [-1109.826] (-1110.838) (-1110.759) * (-1116.822) (-1115.967) (-1111.978) [-1114.400] -- 0:00:56
704500 -- (-1120.083) [-1116.682] (-1114.797) (-1116.909) * (-1112.534) (-1116.296) [-1115.079] (-1115.995) -- 0:00:56
705000 -- (-1115.068) (-1120.788) [-1114.838] (-1120.306) * (-1124.521) (-1116.592) (-1122.889) [-1113.264] -- 0:00:56
Average standard deviation of split frequencies: 0.002893
705500 -- [-1116.798] (-1114.856) (-1113.353) (-1111.050) * (-1120.448) (-1109.889) [-1118.800] (-1111.892) -- 0:00:56
706000 -- (-1118.692) [-1115.416] (-1109.643) (-1118.331) * (-1120.044) (-1109.058) [-1111.818] (-1116.408) -- 0:00:56
706500 -- [-1116.910] (-1113.578) (-1117.218) (-1111.107) * [-1119.967] (-1109.820) (-1115.644) (-1116.223) -- 0:00:56
707000 -- [-1111.147] (-1113.875) (-1111.132) (-1124.801) * (-1124.669) (-1117.544) [-1110.552] (-1110.551) -- 0:00:55
707500 -- (-1115.666) (-1118.393) (-1123.737) [-1114.899] * [-1111.038] (-1111.739) (-1112.064) (-1113.549) -- 0:00:55
708000 -- (-1120.347) [-1118.276] (-1114.789) (-1106.719) * (-1118.391) [-1110.842] (-1117.842) (-1112.551) -- 0:00:56
708500 -- [-1112.434] (-1117.558) (-1114.477) (-1115.732) * (-1119.693) [-1111.334] (-1118.560) (-1121.977) -- 0:00:55
709000 -- (-1112.090) [-1112.657] (-1117.726) (-1110.127) * (-1120.390) (-1113.133) (-1111.441) [-1114.141] -- 0:00:55
709500 -- [-1117.068] (-1107.807) (-1122.090) (-1115.959) * (-1111.959) (-1113.422) [-1110.038] (-1111.011) -- 0:00:55
710000 -- (-1119.608) (-1110.911) (-1112.981) [-1113.196] * (-1112.084) [-1116.951] (-1120.733) (-1112.988) -- 0:00:55
Average standard deviation of split frequencies: 0.002874
710500 -- (-1120.914) (-1116.963) (-1115.579) [-1111.575] * [-1111.549] (-1125.776) (-1121.463) (-1114.937) -- 0:00:55
711000 -- (-1123.042) (-1116.977) (-1117.476) [-1116.563] * [-1108.704] (-1122.562) (-1113.357) (-1122.053) -- 0:00:55
711500 -- (-1122.554) (-1118.665) (-1109.791) [-1119.825] * [-1108.709] (-1116.279) (-1113.698) (-1118.304) -- 0:00:55
712000 -- [-1115.132] (-1116.493) (-1124.394) (-1118.800) * [-1114.670] (-1127.071) (-1122.654) (-1115.698) -- 0:00:55
712500 -- (-1121.491) (-1110.785) (-1128.610) [-1117.253] * (-1117.831) [-1125.442] (-1114.640) (-1115.732) -- 0:00:54
713000 -- (-1111.626) (-1127.968) [-1119.688] (-1109.235) * (-1109.116) (-1117.589) (-1115.736) [-1115.901] -- 0:00:54
713500 -- (-1112.793) (-1127.640) (-1116.988) [-1115.807] * (-1116.767) (-1112.303) [-1111.797] (-1113.080) -- 0:00:55
714000 -- (-1119.426) (-1119.011) [-1119.480] (-1113.568) * (-1112.676) [-1114.374] (-1110.324) (-1114.245) -- 0:00:54
714500 -- (-1116.163) (-1115.041) (-1117.304) [-1113.389] * (-1113.189) (-1119.474) [-1110.592] (-1113.586) -- 0:00:54
715000 -- (-1113.789) (-1113.449) (-1116.528) [-1114.000] * (-1116.072) (-1112.519) (-1115.235) [-1114.926] -- 0:00:54
Average standard deviation of split frequencies: 0.002853
715500 -- (-1109.845) [-1111.234] (-1115.674) (-1111.626) * (-1114.218) (-1109.814) [-1115.746] (-1117.389) -- 0:00:54
716000 -- (-1116.982) [-1109.463] (-1117.802) (-1114.001) * (-1111.101) [-1110.292] (-1125.774) (-1112.626) -- 0:00:54
716500 -- (-1115.292) [-1116.847] (-1113.395) (-1115.360) * [-1113.481] (-1115.172) (-1120.345) (-1115.208) -- 0:00:54
717000 -- (-1114.470) [-1112.540] (-1111.278) (-1116.884) * (-1118.020) [-1112.134] (-1115.116) (-1112.371) -- 0:00:54
717500 -- [-1115.407] (-1108.928) (-1110.875) (-1112.905) * (-1126.581) [-1111.827] (-1109.698) (-1121.772) -- 0:00:53
718000 -- (-1117.481) (-1115.862) (-1116.536) [-1106.973] * (-1112.228) (-1111.031) [-1110.613] (-1118.470) -- 0:00:53
718500 -- (-1115.892) (-1115.152) [-1111.479] (-1118.733) * (-1114.724) (-1114.624) (-1117.449) [-1110.046] -- 0:00:54
719000 -- (-1115.605) (-1116.781) [-1115.382] (-1119.503) * (-1116.646) (-1111.398) (-1114.044) [-1112.801] -- 0:00:53
719500 -- (-1115.937) (-1113.780) [-1111.394] (-1113.784) * (-1115.175) (-1112.456) [-1114.664] (-1116.833) -- 0:00:53
720000 -- (-1111.858) [-1113.059] (-1115.225) (-1123.986) * (-1111.998) (-1108.902) (-1116.233) [-1115.335] -- 0:00:53
Average standard deviation of split frequencies: 0.003053
720500 -- (-1115.101) (-1114.665) [-1119.979] (-1118.682) * (-1112.172) [-1116.230] (-1119.960) (-1115.061) -- 0:00:53
721000 -- [-1117.513] (-1116.622) (-1117.272) (-1115.080) * [-1116.172] (-1113.126) (-1119.572) (-1118.687) -- 0:00:53
721500 -- (-1117.867) (-1115.866) (-1115.472) [-1116.076] * (-1114.493) (-1114.339) [-1113.824] (-1118.206) -- 0:00:53
722000 -- (-1111.098) [-1111.891] (-1108.975) (-1122.040) * (-1117.568) (-1121.961) [-1115.482] (-1112.238) -- 0:00:53
722500 -- (-1110.940) (-1112.038) (-1118.676) [-1114.764] * (-1116.817) (-1119.395) [-1118.460] (-1114.195) -- 0:00:53
723000 -- (-1111.597) (-1118.829) (-1124.766) [-1113.463] * (-1121.099) [-1114.444] (-1113.115) (-1123.934) -- 0:00:52
723500 -- (-1109.660) [-1115.268] (-1113.259) (-1114.417) * [-1111.549] (-1120.579) (-1115.743) (-1127.084) -- 0:00:52
724000 -- (-1110.857) (-1127.459) [-1115.011] (-1118.089) * [-1111.946] (-1114.896) (-1118.014) (-1116.258) -- 0:00:52
724500 -- (-1117.888) (-1119.909) (-1111.852) [-1110.413] * [-1113.628] (-1120.069) (-1115.244) (-1113.642) -- 0:00:52
725000 -- (-1119.280) (-1115.848) [-1110.434] (-1116.405) * (-1111.310) (-1125.607) [-1109.235] (-1121.305) -- 0:00:52
Average standard deviation of split frequencies: 0.003030
725500 -- (-1124.794) [-1106.287] (-1116.749) (-1112.355) * (-1110.433) (-1116.045) (-1111.542) [-1114.128] -- 0:00:52
726000 -- (-1114.086) [-1113.410] (-1121.063) (-1119.471) * (-1111.039) (-1131.817) (-1111.708) [-1109.246] -- 0:00:52
726500 -- (-1110.431) (-1121.583) (-1109.742) [-1113.785] * (-1113.446) (-1116.729) (-1118.791) [-1109.687] -- 0:00:52
727000 -- (-1110.320) [-1115.581] (-1116.611) (-1117.667) * (-1115.005) [-1121.879] (-1118.254) (-1113.382) -- 0:00:52
727500 -- (-1114.868) [-1112.762] (-1116.077) (-1114.708) * (-1108.999) (-1124.764) [-1113.411] (-1121.715) -- 0:00:52
728000 -- [-1117.165] (-1117.270) (-1124.210) (-1112.186) * (-1111.364) [-1116.875] (-1114.253) (-1123.392) -- 0:00:51
728500 -- (-1115.294) (-1116.531) (-1112.808) [-1111.797] * (-1108.036) (-1119.456) [-1115.275] (-1119.810) -- 0:00:51
729000 -- (-1113.564) (-1128.641) (-1116.660) [-1108.268] * (-1111.851) (-1122.112) [-1111.223] (-1113.779) -- 0:00:52
729500 -- (-1114.070) [-1114.894] (-1122.132) (-1113.215) * (-1113.665) (-1120.060) [-1111.957] (-1116.084) -- 0:00:51
730000 -- (-1116.106) [-1118.103] (-1114.560) (-1114.524) * (-1116.694) (-1116.979) [-1111.430] (-1115.051) -- 0:00:51
Average standard deviation of split frequencies: 0.002796
730500 -- [-1117.868] (-1123.584) (-1117.459) (-1110.953) * [-1111.882] (-1111.888) (-1119.664) (-1112.888) -- 0:00:51
731000 -- (-1119.855) (-1116.882) [-1121.505] (-1115.322) * (-1113.261) (-1110.803) (-1114.494) [-1116.401] -- 0:00:51
731500 -- (-1118.760) (-1121.294) (-1115.279) [-1114.131] * (-1114.411) (-1117.221) [-1114.127] (-1128.193) -- 0:00:51
732000 -- (-1117.350) (-1110.602) (-1119.208) [-1114.107] * (-1116.279) [-1117.011] (-1109.695) (-1127.947) -- 0:00:51
732500 -- [-1121.111] (-1119.806) (-1110.127) (-1112.522) * [-1111.483] (-1111.174) (-1109.505) (-1114.994) -- 0:00:51
733000 -- [-1115.661] (-1117.214) (-1114.234) (-1113.597) * (-1113.014) (-1118.279) [-1114.962] (-1119.481) -- 0:00:50
733500 -- (-1115.710) [-1110.818] (-1115.558) (-1116.417) * (-1116.885) (-1113.031) [-1112.457] (-1122.761) -- 0:00:50
734000 -- [-1117.349] (-1113.375) (-1118.601) (-1114.995) * (-1115.403) (-1118.835) (-1115.040) [-1108.668] -- 0:00:50
734500 -- [-1116.464] (-1111.051) (-1116.204) (-1112.985) * [-1112.025] (-1120.134) (-1110.113) (-1119.490) -- 0:00:50
735000 -- (-1116.322) [-1113.940] (-1120.189) (-1110.754) * (-1113.709) (-1123.656) [-1111.277] (-1111.176) -- 0:00:50
Average standard deviation of split frequencies: 0.002775
735500 -- (-1110.808) [-1113.612] (-1114.800) (-1114.949) * [-1113.831] (-1124.427) (-1119.039) (-1115.185) -- 0:00:50
736000 -- (-1113.119) [-1114.320] (-1115.941) (-1113.970) * (-1115.633) (-1110.591) (-1109.781) [-1121.178] -- 0:00:50
736500 -- (-1119.658) (-1113.573) [-1112.323] (-1118.772) * (-1116.189) [-1113.171] (-1115.619) (-1121.757) -- 0:00:50
737000 -- (-1118.064) (-1119.806) [-1112.587] (-1113.241) * [-1113.437] (-1113.339) (-1119.357) (-1113.159) -- 0:00:50
737500 -- (-1113.398) (-1113.988) [-1119.051] (-1114.186) * (-1110.738) (-1108.485) [-1116.527] (-1118.831) -- 0:00:50
738000 -- (-1115.206) (-1111.458) (-1113.338) [-1109.629] * (-1114.904) [-1112.684] (-1116.750) (-1118.311) -- 0:00:50
738500 -- [-1114.942] (-1110.642) (-1120.759) (-1115.831) * (-1118.912) (-1111.779) (-1113.578) [-1113.523] -- 0:00:49
739000 -- (-1112.929) (-1118.480) [-1109.346] (-1115.101) * (-1120.635) (-1120.408) (-1111.642) [-1109.880] -- 0:00:49
739500 -- [-1111.920] (-1119.345) (-1110.537) (-1122.270) * (-1122.625) (-1108.168) [-1109.023] (-1110.638) -- 0:00:50
740000 -- (-1115.947) [-1115.979] (-1121.726) (-1117.737) * (-1116.440) (-1118.511) [-1109.120] (-1120.605) -- 0:00:49
Average standard deviation of split frequencies: 0.002758
740500 -- (-1118.557) [-1116.257] (-1115.278) (-1116.084) * (-1118.188) [-1118.278] (-1109.924) (-1118.136) -- 0:00:49
741000 -- (-1122.052) (-1114.623) (-1121.616) [-1113.440] * (-1118.689) (-1114.698) [-1108.362] (-1118.145) -- 0:00:49
741500 -- (-1115.363) (-1113.373) (-1124.855) [-1113.518] * (-1120.994) (-1117.685) (-1113.818) [-1116.842] -- 0:00:49
742000 -- (-1115.073) [-1109.821] (-1116.198) (-1109.893) * [-1118.328] (-1113.496) (-1112.071) (-1111.176) -- 0:00:49
742500 -- (-1114.514) [-1110.181] (-1115.092) (-1109.186) * (-1117.647) (-1121.021) (-1117.724) [-1111.441] -- 0:00:49
743000 -- (-1115.549) [-1116.062] (-1115.664) (-1111.814) * [-1113.280] (-1115.876) (-1114.038) (-1110.057) -- 0:00:49
743500 -- [-1117.664] (-1113.815) (-1110.621) (-1115.346) * (-1120.616) (-1112.394) (-1116.693) [-1108.892] -- 0:00:48
744000 -- [-1111.999] (-1112.902) (-1110.710) (-1113.087) * (-1129.603) [-1113.720] (-1118.236) (-1118.180) -- 0:00:48
744500 -- (-1116.004) [-1113.404] (-1117.307) (-1117.642) * (-1120.394) (-1122.036) (-1110.917) [-1112.205] -- 0:00:48
745000 -- (-1110.034) (-1116.114) (-1115.310) [-1115.759] * (-1121.109) [-1111.625] (-1115.912) (-1110.295) -- 0:00:48
Average standard deviation of split frequencies: 0.002949
745500 -- (-1113.446) [-1122.177] (-1117.725) (-1116.075) * (-1121.905) [-1118.672] (-1113.727) (-1114.861) -- 0:00:48
746000 -- (-1121.890) [-1114.360] (-1118.073) (-1125.463) * [-1110.012] (-1116.985) (-1112.875) (-1117.660) -- 0:00:48
746500 -- (-1122.864) (-1116.596) (-1110.889) [-1121.391] * (-1111.495) (-1117.695) [-1109.465] (-1123.561) -- 0:00:48
747000 -- (-1117.073) [-1114.212] (-1112.148) (-1114.891) * [-1108.950] (-1112.871) (-1115.581) (-1117.353) -- 0:00:48
747500 -- (-1120.637) (-1122.199) (-1116.296) [-1115.486] * (-1115.071) [-1115.004] (-1111.907) (-1112.168) -- 0:00:48
748000 -- (-1115.761) (-1114.193) (-1111.897) [-1113.088] * [-1109.528] (-1112.942) (-1111.649) (-1118.116) -- 0:00:48
748500 -- (-1117.681) (-1121.887) [-1111.680] (-1115.866) * [-1112.478] (-1118.135) (-1120.430) (-1116.725) -- 0:00:48
749000 -- (-1117.526) (-1112.685) (-1122.337) [-1112.968] * [-1110.880] (-1116.226) (-1111.915) (-1116.487) -- 0:00:47
749500 -- (-1112.307) (-1119.220) (-1119.295) [-1118.493] * (-1118.621) (-1119.372) (-1113.098) [-1112.863] -- 0:00:47
750000 -- [-1115.505] (-1115.826) (-1115.732) (-1120.962) * (-1113.071) (-1112.077) [-1108.881] (-1116.612) -- 0:00:47
Average standard deviation of split frequencies: 0.003559
750500 -- (-1114.010) (-1122.845) (-1115.725) [-1110.693] * [-1118.305] (-1112.983) (-1116.096) (-1125.054) -- 0:00:47
751000 -- (-1116.095) (-1113.390) [-1112.911] (-1120.065) * [-1114.676] (-1117.170) (-1111.754) (-1110.032) -- 0:00:47
751500 -- (-1111.487) (-1113.319) (-1120.745) [-1112.959] * (-1118.656) (-1117.516) [-1114.567] (-1115.054) -- 0:00:47
752000 -- (-1119.233) (-1110.150) (-1120.416) [-1111.255] * [-1115.629] (-1112.454) (-1116.952) (-1115.370) -- 0:00:47
752500 -- [-1110.151] (-1112.051) (-1115.184) (-1113.194) * (-1118.992) (-1113.842) [-1116.319] (-1118.855) -- 0:00:47
753000 -- (-1113.629) (-1109.825) [-1110.763] (-1112.048) * (-1114.610) (-1117.751) [-1118.352] (-1115.210) -- 0:00:47
753500 -- (-1105.892) [-1117.955] (-1116.982) (-1111.662) * (-1111.371) (-1113.823) (-1108.823) [-1118.076] -- 0:00:47
754000 -- (-1111.364) [-1113.375] (-1112.183) (-1112.902) * (-1116.009) [-1117.569] (-1123.505) (-1113.852) -- 0:00:46
754500 -- (-1120.342) (-1114.940) (-1113.241) [-1112.594] * (-1116.676) (-1125.857) [-1120.718] (-1110.136) -- 0:00:46
755000 -- [-1119.613] (-1122.835) (-1114.028) (-1110.652) * (-1113.985) (-1117.307) (-1116.746) [-1111.553] -- 0:00:46
Average standard deviation of split frequencies: 0.003533
755500 -- (-1117.052) (-1117.851) [-1119.394] (-1111.436) * (-1118.555) (-1114.825) (-1110.302) [-1117.839] -- 0:00:46
756000 -- [-1110.790] (-1121.892) (-1113.381) (-1117.315) * (-1115.962) (-1112.872) [-1113.098] (-1120.084) -- 0:00:46
756500 -- [-1115.657] (-1113.855) (-1116.689) (-1121.400) * (-1109.844) (-1116.276) [-1111.397] (-1112.759) -- 0:00:46
757000 -- (-1119.572) [-1110.061] (-1121.479) (-1107.887) * (-1115.069) (-1117.690) [-1112.467] (-1119.487) -- 0:00:46
757500 -- (-1118.142) [-1113.030] (-1122.919) (-1114.125) * [-1115.808] (-1121.621) (-1116.768) (-1117.320) -- 0:00:46
758000 -- (-1114.747) (-1112.972) (-1110.983) [-1120.463] * (-1109.514) (-1112.935) (-1112.698) [-1110.910] -- 0:00:46
758500 -- (-1120.699) (-1115.162) (-1115.595) [-1114.210] * (-1116.727) (-1111.475) (-1110.950) [-1113.321] -- 0:00:46
759000 -- (-1114.099) (-1108.184) [-1116.908] (-1120.317) * (-1116.112) (-1112.812) (-1114.250) [-1112.609] -- 0:00:46
759500 -- (-1121.749) [-1120.562] (-1111.856) (-1115.892) * (-1116.705) (-1123.706) (-1114.661) [-1112.332] -- 0:00:45
760000 -- (-1118.652) (-1110.651) [-1112.135] (-1116.695) * (-1118.678) (-1118.290) (-1116.487) [-1112.428] -- 0:00:45
Average standard deviation of split frequencies: 0.003099
760500 -- (-1121.657) (-1108.478) [-1121.378] (-1123.016) * (-1114.554) (-1115.434) (-1117.180) [-1112.916] -- 0:00:45
761000 -- (-1109.100) (-1113.632) [-1113.368] (-1113.384) * [-1107.688] (-1122.805) (-1125.948) (-1115.391) -- 0:00:45
761500 -- (-1112.527) (-1120.114) [-1116.448] (-1118.173) * [-1108.616] (-1112.149) (-1118.613) (-1123.612) -- 0:00:45
762000 -- [-1114.973] (-1112.586) (-1111.174) (-1117.311) * (-1111.729) [-1116.102] (-1120.939) (-1119.514) -- 0:00:45
762500 -- (-1112.812) [-1112.927] (-1118.550) (-1122.190) * (-1118.692) (-1117.003) (-1111.625) [-1114.264] -- 0:00:45
763000 -- (-1112.659) (-1112.880) [-1118.430] (-1124.312) * (-1110.465) (-1116.912) [-1108.142] (-1111.662) -- 0:00:45
763500 -- (-1110.493) (-1115.584) [-1123.727] (-1113.699) * (-1117.729) [-1112.570] (-1124.280) (-1112.758) -- 0:00:45
764000 -- [-1112.506] (-1114.411) (-1121.359) (-1120.956) * (-1126.053) (-1115.993) (-1114.083) [-1111.669] -- 0:00:45
764500 -- (-1116.034) (-1124.168) [-1112.130] (-1126.744) * [-1116.673] (-1112.850) (-1119.214) (-1117.332) -- 0:00:44
765000 -- (-1117.725) (-1118.621) (-1110.675) [-1114.466] * (-1117.790) [-1115.630] (-1116.049) (-1119.710) -- 0:00:44
Average standard deviation of split frequencies: 0.003077
765500 -- (-1110.670) (-1110.356) (-1113.798) [-1114.341] * [-1115.477] (-1114.829) (-1116.226) (-1114.648) -- 0:00:44
766000 -- (-1116.643) (-1118.456) [-1109.268] (-1115.297) * (-1118.482) (-1110.386) (-1116.474) [-1116.963] -- 0:00:44
766500 -- (-1113.526) (-1125.180) (-1117.272) [-1107.156] * (-1115.043) (-1109.264) (-1130.527) [-1111.348] -- 0:00:44
767000 -- [-1119.070] (-1115.019) (-1122.843) (-1109.958) * (-1118.403) [-1112.802] (-1116.946) (-1115.942) -- 0:00:44
767500 -- (-1115.735) (-1115.355) (-1118.376) [-1111.125] * (-1116.343) (-1120.893) [-1110.761] (-1116.512) -- 0:00:44
768000 -- [-1112.458] (-1120.018) (-1115.161) (-1113.816) * [-1113.164] (-1122.325) (-1118.982) (-1116.605) -- 0:00:44
768500 -- (-1123.309) (-1125.477) (-1115.825) [-1107.748] * (-1109.316) [-1118.866] (-1119.299) (-1117.138) -- 0:00:44
769000 -- (-1114.243) [-1115.072] (-1117.815) (-1110.462) * [-1116.027] (-1120.490) (-1132.149) (-1116.577) -- 0:00:44
769500 -- [-1107.666] (-1114.981) (-1112.334) (-1114.965) * (-1113.218) (-1115.165) [-1112.501] (-1117.665) -- 0:00:44
770000 -- (-1116.681) (-1119.278) [-1118.302] (-1119.770) * [-1108.722] (-1116.789) (-1118.490) (-1116.395) -- 0:00:43
Average standard deviation of split frequencies: 0.003262
770500 -- [-1111.105] (-1113.813) (-1110.212) (-1118.435) * (-1112.156) [-1117.703] (-1118.919) (-1114.013) -- 0:00:43
771000 -- (-1112.937) [-1111.764] (-1118.052) (-1118.076) * (-1110.834) (-1118.197) (-1126.168) [-1115.840] -- 0:00:43
771500 -- [-1113.704] (-1114.876) (-1110.920) (-1122.122) * (-1111.822) (-1109.595) (-1109.701) [-1116.291] -- 0:00:43
772000 -- [-1110.050] (-1113.176) (-1119.120) (-1119.004) * (-1114.181) (-1111.864) [-1119.814] (-1119.393) -- 0:00:43
772500 -- (-1108.546) [-1112.921] (-1113.382) (-1115.673) * (-1126.969) (-1115.668) [-1115.177] (-1112.090) -- 0:00:43
773000 -- [-1109.981] (-1118.911) (-1116.714) (-1117.996) * [-1112.276] (-1123.024) (-1113.307) (-1114.860) -- 0:00:43
773500 -- (-1113.035) (-1112.870) (-1119.371) [-1120.623] * (-1111.996) (-1113.855) (-1119.963) [-1116.825] -- 0:00:43
774000 -- (-1124.700) (-1118.872) [-1114.245] (-1113.518) * [-1116.894] (-1119.860) (-1117.814) (-1118.971) -- 0:00:43
774500 -- [-1113.575] (-1115.724) (-1109.904) (-1113.690) * (-1125.086) (-1114.820) [-1113.527] (-1109.199) -- 0:00:43
775000 -- (-1116.619) [-1112.322] (-1118.881) (-1115.091) * (-1114.705) (-1119.702) (-1109.039) [-1109.078] -- 0:00:42
Average standard deviation of split frequencies: 0.003442
775500 -- (-1113.417) (-1113.561) (-1114.515) [-1113.462] * (-1110.275) (-1123.828) [-1111.134] (-1116.036) -- 0:00:42
776000 -- (-1109.235) (-1113.423) (-1114.428) [-1107.672] * [-1110.147] (-1113.509) (-1110.376) (-1122.203) -- 0:00:42
776500 -- (-1113.407) (-1115.857) (-1117.162) [-1111.307] * (-1112.108) (-1115.380) (-1110.738) [-1113.242] -- 0:00:42
777000 -- (-1117.726) (-1122.636) [-1113.207] (-1115.716) * [-1114.485] (-1118.048) (-1110.782) (-1107.564) -- 0:00:42
777500 -- (-1109.995) (-1121.629) (-1116.043) [-1110.151] * (-1113.936) (-1114.519) (-1116.624) [-1115.109] -- 0:00:42
778000 -- (-1117.852) (-1121.482) (-1117.248) [-1112.452] * (-1113.834) (-1113.672) [-1117.960] (-1121.986) -- 0:00:42
778500 -- [-1112.706] (-1116.988) (-1113.646) (-1116.499) * (-1122.863) (-1110.658) [-1108.642] (-1122.316) -- 0:00:42
779000 -- (-1114.752) (-1114.701) [-1112.822] (-1113.261) * (-1116.834) (-1119.594) (-1115.917) [-1111.161] -- 0:00:42
779500 -- (-1118.681) (-1113.736) [-1107.613] (-1120.486) * (-1115.989) (-1115.672) [-1117.293] (-1114.205) -- 0:00:42
780000 -- (-1122.797) (-1116.010) (-1110.432) [-1119.240] * (-1117.296) [-1111.215] (-1113.078) (-1119.195) -- 0:00:42
Average standard deviation of split frequencies: 0.003623
780500 -- (-1122.474) (-1112.455) (-1108.531) [-1111.290] * (-1115.288) (-1113.604) [-1114.525] (-1117.584) -- 0:00:41
781000 -- (-1108.477) (-1119.724) (-1109.731) [-1117.160] * (-1118.233) (-1114.197) (-1116.148) [-1116.161] -- 0:00:41
781500 -- (-1110.467) (-1113.955) (-1108.061) [-1113.496] * (-1120.250) [-1117.323] (-1123.213) (-1110.036) -- 0:00:41
782000 -- (-1118.504) [-1111.784] (-1115.645) (-1116.600) * (-1116.490) [-1114.889] (-1119.447) (-1112.587) -- 0:00:41
782500 -- [-1114.424] (-1114.836) (-1114.778) (-1117.373) * (-1114.393) (-1107.893) [-1118.212] (-1125.671) -- 0:00:41
783000 -- [-1114.322] (-1116.759) (-1115.699) (-1113.299) * (-1120.452) [-1113.029] (-1121.160) (-1121.962) -- 0:00:41
783500 -- (-1109.910) (-1118.839) [-1110.251] (-1114.701) * (-1122.643) (-1113.462) (-1112.281) [-1116.428] -- 0:00:41
784000 -- (-1111.160) [-1116.701] (-1107.194) (-1115.819) * (-1116.411) (-1115.833) [-1118.810] (-1118.937) -- 0:00:41
784500 -- (-1118.515) (-1114.367) (-1114.366) [-1113.949] * (-1109.877) (-1109.442) (-1111.309) [-1115.593] -- 0:00:41
785000 -- [-1111.977] (-1109.578) (-1114.650) (-1115.201) * (-1115.806) (-1112.068) [-1115.072] (-1119.749) -- 0:00:41
Average standard deviation of split frequencies: 0.003599
785500 -- (-1112.856) (-1114.441) (-1123.510) [-1111.002] * (-1119.824) (-1121.965) (-1110.286) [-1111.931] -- 0:00:40
786000 -- [-1106.072] (-1123.493) (-1113.347) (-1117.843) * [-1112.575] (-1117.592) (-1110.893) (-1112.617) -- 0:00:40
786500 -- [-1111.950] (-1114.505) (-1116.731) (-1107.968) * (-1116.077) (-1118.058) [-1108.987] (-1115.432) -- 0:00:40
787000 -- [-1113.899] (-1119.262) (-1115.071) (-1108.245) * [-1111.591] (-1110.245) (-1121.922) (-1110.320) -- 0:00:40
787500 -- (-1114.930) (-1119.229) (-1123.951) [-1114.450] * (-1111.463) [-1112.439] (-1112.840) (-1108.951) -- 0:00:40
788000 -- [-1113.907] (-1118.663) (-1114.838) (-1114.566) * [-1111.150] (-1113.440) (-1113.165) (-1117.287) -- 0:00:40
788500 -- (-1121.026) (-1125.095) [-1111.222] (-1110.057) * [-1114.293] (-1114.801) (-1117.909) (-1113.957) -- 0:00:40
789000 -- (-1111.549) (-1113.947) [-1110.833] (-1115.764) * [-1115.216] (-1114.179) (-1110.743) (-1115.450) -- 0:00:40
789500 -- (-1115.601) [-1109.817] (-1113.786) (-1120.496) * (-1111.834) (-1110.033) (-1107.390) [-1110.420] -- 0:00:40
790000 -- (-1111.752) (-1112.695) [-1119.837] (-1110.753) * (-1117.737) (-1114.116) [-1115.750] (-1115.468) -- 0:00:40
Average standard deviation of split frequencies: 0.003577
790500 -- (-1118.498) [-1113.493] (-1115.251) (-1110.960) * (-1112.272) (-1111.631) [-1119.569] (-1115.564) -- 0:00:40
791000 -- (-1115.478) [-1117.935] (-1114.313) (-1114.971) * (-1111.779) [-1112.635] (-1111.831) (-1111.548) -- 0:00:39
791500 -- (-1116.612) [-1112.978] (-1110.965) (-1113.360) * [-1109.139] (-1116.978) (-1112.260) (-1115.935) -- 0:00:39
792000 -- (-1118.564) [-1110.244] (-1115.268) (-1116.615) * (-1117.729) (-1122.683) [-1114.819] (-1111.080) -- 0:00:39
792500 -- (-1117.943) (-1112.319) [-1116.426] (-1110.982) * (-1115.205) (-1113.255) [-1115.391] (-1111.448) -- 0:00:39
793000 -- [-1110.454] (-1114.586) (-1114.694) (-1117.595) * [-1109.833] (-1111.763) (-1116.020) (-1123.794) -- 0:00:39
793500 -- (-1112.901) (-1116.864) (-1116.639) [-1110.694] * [-1111.697] (-1118.419) (-1113.622) (-1107.226) -- 0:00:39
794000 -- (-1118.179) (-1122.059) (-1111.872) [-1110.762] * (-1119.176) (-1111.384) [-1109.140] (-1117.504) -- 0:00:39
794500 -- (-1111.710) [-1113.774] (-1122.904) (-1109.893) * (-1120.508) [-1114.349] (-1115.230) (-1122.020) -- 0:00:39
795000 -- (-1117.310) [-1119.718] (-1116.787) (-1123.205) * (-1120.013) [-1111.079] (-1115.459) (-1122.352) -- 0:00:39
Average standard deviation of split frequencies: 0.004343
795500 -- (-1113.609) (-1117.414) [-1113.691] (-1110.625) * (-1114.719) [-1111.970] (-1109.311) (-1116.074) -- 0:00:39
796000 -- (-1116.224) (-1117.908) [-1114.075] (-1114.718) * (-1115.782) (-1118.295) (-1108.843) [-1114.691] -- 0:00:38
796500 -- [-1115.282] (-1109.753) (-1115.983) (-1114.881) * (-1115.521) (-1106.579) (-1113.624) [-1111.739] -- 0:00:38
797000 -- (-1109.720) (-1120.527) [-1108.462] (-1117.587) * [-1119.958] (-1121.554) (-1114.534) (-1107.571) -- 0:00:38
797500 -- [-1110.980] (-1120.348) (-1123.983) (-1112.864) * [-1111.558] (-1115.715) (-1121.673) (-1113.800) -- 0:00:38
798000 -- (-1114.015) (-1114.625) (-1111.455) [-1109.977] * (-1118.654) (-1111.702) (-1116.434) [-1115.155] -- 0:00:38
798500 -- (-1111.356) (-1133.987) (-1119.441) [-1112.665] * (-1110.292) (-1118.569) (-1116.810) [-1113.383] -- 0:00:38
799000 -- (-1113.942) (-1120.676) (-1119.101) [-1113.440] * (-1113.180) (-1116.600) [-1112.244] (-1125.932) -- 0:00:38
799500 -- (-1116.451) (-1119.890) [-1116.298] (-1112.927) * (-1116.777) (-1120.814) [-1113.206] (-1112.042) -- 0:00:38
800000 -- (-1123.706) (-1112.696) (-1124.331) [-1111.566] * (-1117.744) [-1109.844] (-1114.256) (-1116.472) -- 0:00:38
Average standard deviation of split frequencies: 0.004514
800500 -- (-1114.192) (-1120.349) [-1118.969] (-1119.000) * (-1116.137) (-1115.870) (-1110.600) [-1112.483] -- 0:00:38
801000 -- (-1122.125) (-1108.263) (-1120.647) [-1117.028] * (-1117.495) (-1114.397) (-1116.693) [-1110.868] -- 0:00:38
801500 -- [-1116.520] (-1126.629) (-1115.998) (-1111.591) * [-1110.149] (-1110.592) (-1114.728) (-1110.083) -- 0:00:37
802000 -- (-1124.051) (-1120.390) (-1115.956) [-1113.504] * (-1113.457) [-1109.321] (-1113.719) (-1110.379) -- 0:00:37
802500 -- [-1112.356] (-1111.716) (-1112.785) (-1111.005) * (-1118.229) (-1114.861) (-1126.808) [-1111.101] -- 0:00:37
803000 -- (-1115.712) (-1114.485) (-1110.948) [-1113.956] * (-1114.681) (-1113.287) [-1113.190] (-1113.870) -- 0:00:37
803500 -- [-1111.518] (-1111.537) (-1112.044) (-1116.306) * (-1109.642) (-1109.760) [-1111.110] (-1109.363) -- 0:00:37
804000 -- (-1125.336) (-1119.263) [-1112.750] (-1112.650) * (-1116.811) (-1115.635) [-1118.254] (-1111.682) -- 0:00:37
804500 -- (-1112.184) [-1116.825] (-1114.396) (-1115.995) * (-1115.268) [-1116.759] (-1116.218) (-1114.139) -- 0:00:37
805000 -- (-1114.082) [-1111.176] (-1120.038) (-1110.951) * [-1118.193] (-1113.431) (-1119.524) (-1114.520) -- 0:00:37
Average standard deviation of split frequencies: 0.004289
805500 -- [-1121.489] (-1115.054) (-1112.355) (-1113.457) * (-1116.520) (-1118.861) [-1114.114] (-1122.322) -- 0:00:37
806000 -- (-1116.667) (-1120.957) (-1112.933) [-1109.192] * (-1116.377) [-1114.257] (-1119.819) (-1113.299) -- 0:00:37
806500 -- (-1112.560) [-1112.058] (-1116.818) (-1109.829) * (-1116.957) [-1115.911] (-1113.332) (-1110.702) -- 0:00:36
807000 -- [-1111.527] (-1117.824) (-1118.074) (-1110.888) * [-1116.672] (-1111.438) (-1116.422) (-1111.519) -- 0:00:36
807500 -- (-1116.800) (-1114.241) (-1111.694) [-1115.808] * (-1116.407) [-1116.694] (-1117.544) (-1113.911) -- 0:00:36
808000 -- (-1119.172) (-1116.301) (-1113.962) [-1112.318] * (-1118.070) (-1112.789) (-1113.644) [-1111.164] -- 0:00:36
808500 -- (-1113.441) (-1112.908) [-1108.064] (-1123.989) * [-1112.086] (-1109.761) (-1111.430) (-1120.757) -- 0:00:36
809000 -- (-1119.306) (-1115.235) [-1117.234] (-1115.849) * (-1112.462) [-1113.025] (-1116.340) (-1124.771) -- 0:00:36
809500 -- (-1112.572) (-1117.035) (-1118.431) [-1120.384] * (-1116.172) [-1110.120] (-1117.956) (-1111.180) -- 0:00:36
810000 -- (-1107.149) (-1110.132) (-1112.503) [-1115.914] * (-1117.422) [-1115.063] (-1114.365) (-1117.618) -- 0:00:36
Average standard deviation of split frequencies: 0.004652
810500 -- (-1112.867) (-1111.877) (-1115.342) [-1115.617] * (-1122.562) (-1115.727) [-1111.083] (-1115.396) -- 0:00:36
811000 -- (-1113.120) (-1111.785) [-1112.037] (-1118.831) * (-1111.481) [-1108.589] (-1117.879) (-1112.543) -- 0:00:36
811500 -- (-1111.152) (-1109.921) [-1110.892] (-1117.747) * (-1120.123) [-1111.336] (-1122.590) (-1116.198) -- 0:00:36
812000 -- (-1116.785) [-1119.354] (-1111.757) (-1113.729) * (-1113.503) [-1110.027] (-1122.696) (-1113.891) -- 0:00:35
812500 -- (-1116.011) (-1115.458) (-1120.162) [-1111.422] * (-1114.458) [-1118.584] (-1118.017) (-1109.803) -- 0:00:35
813000 -- (-1120.609) (-1114.386) (-1113.556) [-1111.452] * (-1117.637) (-1112.835) (-1117.794) [-1112.986] -- 0:00:35
813500 -- [-1117.357] (-1108.826) (-1117.670) (-1113.785) * (-1116.999) (-1116.751) (-1115.722) [-1110.303] -- 0:00:35
814000 -- (-1118.721) (-1117.917) (-1115.278) [-1109.992] * (-1121.754) (-1119.396) (-1114.370) [-1115.423] -- 0:00:35
814500 -- [-1111.417] (-1113.877) (-1119.365) (-1112.143) * (-1115.042) (-1121.351) [-1108.735] (-1113.122) -- 0:00:35
815000 -- (-1111.627) (-1121.778) (-1115.541) [-1120.837] * (-1120.674) (-1115.589) (-1115.638) [-1117.293] -- 0:00:35
Average standard deviation of split frequencies: 0.004429
815500 -- (-1110.857) [-1116.782] (-1116.649) (-1113.244) * (-1124.815) [-1112.504] (-1109.431) (-1114.673) -- 0:00:35
816000 -- [-1112.099] (-1114.865) (-1114.527) (-1121.924) * (-1132.575) (-1118.947) (-1112.621) [-1112.519] -- 0:00:35
816500 -- [-1113.791] (-1112.071) (-1117.620) (-1115.681) * (-1122.493) (-1124.649) [-1114.501] (-1112.276) -- 0:00:35
817000 -- (-1119.406) [-1114.525] (-1123.383) (-1112.137) * [-1115.915] (-1118.339) (-1120.680) (-1116.435) -- 0:00:34
817500 -- [-1113.730] (-1111.429) (-1116.700) (-1115.247) * [-1117.408] (-1121.574) (-1114.695) (-1116.497) -- 0:00:34
818000 -- (-1119.816) (-1117.932) [-1119.688] (-1112.971) * [-1111.404] (-1117.975) (-1111.592) (-1118.861) -- 0:00:34
818500 -- (-1115.248) (-1122.998) (-1116.580) [-1121.676] * [-1119.254] (-1122.326) (-1109.892) (-1117.771) -- 0:00:34
819000 -- (-1110.402) [-1115.979] (-1113.936) (-1113.741) * (-1115.893) (-1124.945) (-1113.152) [-1117.267] -- 0:00:34
819500 -- (-1113.625) (-1116.425) (-1112.364) [-1121.363] * (-1115.388) (-1123.175) [-1112.311] (-1116.387) -- 0:00:34
820000 -- [-1115.458] (-1121.985) (-1119.368) (-1115.871) * [-1116.118] (-1120.853) (-1120.725) (-1117.417) -- 0:00:34
Average standard deviation of split frequencies: 0.004595
820500 -- [-1110.589] (-1120.463) (-1121.633) (-1114.881) * (-1123.856) (-1114.565) (-1113.894) [-1114.713] -- 0:00:34
821000 -- (-1116.841) [-1117.397] (-1117.242) (-1126.497) * [-1114.853] (-1123.330) (-1110.050) (-1116.546) -- 0:00:34
821500 -- (-1117.588) (-1122.194) [-1118.922] (-1121.715) * (-1118.459) (-1113.172) [-1112.834] (-1115.859) -- 0:00:34
822000 -- [-1114.732] (-1118.878) (-1119.166) (-1122.559) * (-1129.918) (-1113.872) [-1118.830] (-1112.137) -- 0:00:33
822500 -- (-1114.996) [-1114.637] (-1117.647) (-1112.772) * (-1114.034) (-1120.999) (-1125.857) [-1112.455] -- 0:00:33
823000 -- (-1116.252) [-1121.132] (-1110.916) (-1105.701) * (-1111.523) (-1112.099) [-1110.820] (-1111.263) -- 0:00:33
823500 -- (-1115.068) (-1113.231) (-1110.615) [-1114.128] * (-1112.106) (-1112.684) (-1117.176) [-1110.643] -- 0:00:33
824000 -- (-1112.953) [-1110.758] (-1114.773) (-1113.266) * (-1117.251) [-1116.230] (-1119.352) (-1110.578) -- 0:00:33
824500 -- (-1121.239) (-1112.994) [-1108.350] (-1117.243) * (-1118.332) (-1115.077) [-1115.708] (-1115.433) -- 0:00:33
825000 -- (-1111.207) (-1113.828) [-1114.839] (-1114.423) * (-1117.008) [-1111.154] (-1111.944) (-1113.914) -- 0:00:33
Average standard deviation of split frequencies: 0.004375
825500 -- (-1113.909) (-1115.561) (-1117.322) [-1115.054] * (-1112.617) (-1115.116) (-1110.690) [-1120.777] -- 0:00:33
826000 -- (-1111.172) (-1113.428) (-1118.932) [-1113.771] * (-1115.658) [-1111.716] (-1112.461) (-1111.946) -- 0:00:33
826500 -- (-1112.253) (-1118.193) (-1118.834) [-1117.619] * (-1118.486) (-1115.732) [-1115.060] (-1112.125) -- 0:00:33
827000 -- (-1111.033) (-1116.185) [-1112.409] (-1117.720) * (-1118.623) (-1112.220) (-1109.473) [-1112.321] -- 0:00:33
827500 -- [-1112.627] (-1117.731) (-1123.372) (-1111.618) * [-1111.069] (-1113.152) (-1113.731) (-1112.078) -- 0:00:32
828000 -- [-1111.957] (-1118.135) (-1121.753) (-1112.111) * (-1114.855) [-1112.404] (-1110.731) (-1115.934) -- 0:00:32
828500 -- (-1108.969) (-1116.080) (-1124.045) [-1113.333] * [-1110.708] (-1112.462) (-1110.529) (-1114.344) -- 0:00:32
829000 -- [-1110.998] (-1115.038) (-1117.793) (-1112.018) * [-1112.268] (-1121.610) (-1119.363) (-1119.328) -- 0:00:32
829500 -- [-1114.930] (-1114.176) (-1123.346) (-1114.427) * (-1119.197) (-1118.693) (-1114.861) [-1118.442] -- 0:00:32
830000 -- [-1114.204] (-1117.403) (-1119.672) (-1120.789) * (-1111.912) (-1113.311) [-1117.570] (-1116.452) -- 0:00:32
Average standard deviation of split frequencies: 0.004540
830500 -- [-1112.971] (-1114.726) (-1117.551) (-1111.532) * [-1112.052] (-1116.201) (-1119.501) (-1111.085) -- 0:00:32
831000 -- (-1112.749) [-1113.322] (-1116.713) (-1109.213) * (-1114.020) (-1113.532) [-1117.170] (-1115.060) -- 0:00:32
831500 -- [-1115.595] (-1118.920) (-1114.710) (-1114.266) * (-1114.992) [-1116.486] (-1116.701) (-1111.869) -- 0:00:32
832000 -- (-1117.104) (-1120.748) [-1110.767] (-1117.823) * (-1121.439) (-1108.188) [-1113.285] (-1114.815) -- 0:00:32
832500 -- (-1114.678) [-1117.957] (-1118.361) (-1114.331) * [-1119.052] (-1115.873) (-1111.342) (-1112.962) -- 0:00:31
833000 -- (-1112.802) (-1115.986) [-1113.297] (-1116.914) * [-1114.070] (-1115.955) (-1117.687) (-1109.710) -- 0:00:31
833500 -- [-1117.496] (-1115.957) (-1119.012) (-1108.883) * [-1113.645] (-1119.981) (-1114.144) (-1116.254) -- 0:00:31
834000 -- (-1115.384) (-1120.538) [-1116.071] (-1111.069) * (-1109.507) [-1114.129] (-1115.569) (-1117.082) -- 0:00:31
834500 -- (-1110.281) [-1119.100] (-1113.511) (-1115.852) * (-1110.734) [-1115.803] (-1117.320) (-1122.233) -- 0:00:31
835000 -- (-1111.595) (-1119.597) (-1114.438) [-1120.954] * (-1119.218) [-1114.583] (-1118.057) (-1117.567) -- 0:00:31
Average standard deviation of split frequencies: 0.004511
835500 -- [-1110.743] (-1119.185) (-1121.087) (-1114.788) * [-1114.054] (-1119.855) (-1113.736) (-1117.904) -- 0:00:31
836000 -- [-1112.226] (-1109.535) (-1113.695) (-1114.742) * (-1114.071) (-1118.617) (-1120.938) [-1112.878] -- 0:00:31
836500 -- (-1112.887) (-1112.732) [-1110.937] (-1111.585) * [-1113.370] (-1121.009) (-1113.936) (-1111.092) -- 0:00:31
837000 -- (-1114.178) (-1110.213) (-1111.760) [-1110.211] * [-1116.545] (-1116.761) (-1113.651) (-1115.700) -- 0:00:31
837500 -- (-1110.643) [-1107.925] (-1119.869) (-1115.245) * [-1113.634] (-1122.470) (-1117.704) (-1112.623) -- 0:00:31
838000 -- (-1116.002) (-1110.943) [-1114.509] (-1113.351) * [-1114.661] (-1120.436) (-1111.429) (-1110.921) -- 0:00:30
838500 -- (-1112.667) (-1114.498) [-1110.833] (-1116.090) * (-1117.248) (-1118.231) (-1116.925) [-1112.611] -- 0:00:30
839000 -- (-1113.057) (-1115.366) (-1118.156) [-1118.535] * (-1115.164) (-1119.850) [-1109.805] (-1109.729) -- 0:00:30
839500 -- (-1110.151) (-1114.952) [-1110.931] (-1129.372) * [-1110.762] (-1113.120) (-1108.004) (-1120.953) -- 0:00:30
840000 -- (-1111.425) (-1116.255) (-1124.060) [-1113.138] * [-1110.687] (-1113.681) (-1113.905) (-1120.666) -- 0:00:30
Average standard deviation of split frequencies: 0.004299
840500 -- [-1120.539] (-1121.886) (-1117.522) (-1114.620) * [-1114.977] (-1106.113) (-1116.308) (-1114.582) -- 0:00:30
841000 -- (-1121.227) (-1113.426) [-1112.099] (-1112.729) * (-1110.595) [-1111.911] (-1112.579) (-1116.222) -- 0:00:30
841500 -- (-1114.929) (-1124.601) (-1113.207) [-1120.339] * (-1116.450) (-1114.700) (-1113.049) [-1113.200] -- 0:00:30
842000 -- (-1109.683) (-1116.773) (-1119.226) [-1112.571] * (-1119.453) (-1114.724) (-1122.846) [-1115.216] -- 0:00:30
842500 -- (-1115.113) [-1114.149] (-1113.469) (-1117.429) * (-1112.677) (-1113.229) [-1115.621] (-1120.482) -- 0:00:30
843000 -- (-1113.777) (-1112.506) [-1118.719] (-1116.385) * (-1121.800) [-1114.899] (-1117.588) (-1110.928) -- 0:00:29
843500 -- (-1116.833) [-1115.354] (-1114.929) (-1118.151) * (-1117.521) (-1118.011) (-1114.551) [-1113.685] -- 0:00:29
844000 -- (-1118.901) (-1113.494) [-1108.172] (-1111.424) * [-1112.864] (-1114.994) (-1116.793) (-1122.696) -- 0:00:29
844500 -- [-1116.483] (-1114.245) (-1112.276) (-1108.750) * (-1117.230) (-1115.158) [-1119.326] (-1114.803) -- 0:00:29
845000 -- (-1111.964) (-1123.711) (-1118.119) [-1115.326] * (-1116.919) (-1115.720) (-1122.442) [-1111.894] -- 0:00:29
Average standard deviation of split frequencies: 0.003901
845500 -- (-1113.728) (-1123.588) (-1116.861) [-1117.216] * [-1113.006] (-1112.336) (-1121.429) (-1119.985) -- 0:00:29
846000 -- (-1115.314) [-1116.752] (-1117.536) (-1114.267) * (-1117.190) (-1111.087) (-1114.197) [-1116.807] -- 0:00:29
846500 -- [-1114.157] (-1114.922) (-1123.851) (-1109.202) * (-1117.881) (-1110.826) (-1122.906) [-1110.766] -- 0:00:29
847000 -- (-1117.656) (-1115.375) [-1113.584] (-1112.341) * (-1112.469) [-1114.334] (-1108.409) (-1114.328) -- 0:00:29
847500 -- (-1113.708) (-1111.279) (-1111.627) [-1109.786] * (-1111.185) [-1113.784] (-1114.146) (-1117.300) -- 0:00:29
848000 -- [-1113.057] (-1120.024) (-1112.113) (-1117.477) * (-1113.345) (-1112.755) [-1115.192] (-1122.192) -- 0:00:29
848500 -- [-1112.126] (-1112.526) (-1109.781) (-1109.798) * (-1126.035) (-1115.863) [-1115.388] (-1129.434) -- 0:00:28
849000 -- [-1111.999] (-1106.517) (-1115.904) (-1118.806) * (-1113.448) [-1115.409] (-1111.632) (-1111.203) -- 0:00:28
849500 -- [-1110.828] (-1111.202) (-1114.197) (-1117.638) * (-1127.773) [-1111.811] (-1112.595) (-1109.566) -- 0:00:28
850000 -- [-1117.481] (-1118.821) (-1122.199) (-1114.622) * [-1117.981] (-1113.706) (-1111.226) (-1121.228) -- 0:00:28
Average standard deviation of split frequencies: 0.004064
850500 -- (-1110.123) (-1113.950) [-1107.189] (-1123.522) * (-1118.127) (-1110.402) (-1113.091) [-1116.815] -- 0:00:28
851000 -- (-1112.916) (-1114.200) [-1113.587] (-1120.373) * (-1126.249) [-1109.562] (-1117.457) (-1113.689) -- 0:00:28
851500 -- (-1114.144) (-1113.098) [-1116.232] (-1117.885) * (-1114.354) [-1112.811] (-1112.267) (-1115.036) -- 0:00:28
852000 -- [-1112.973] (-1119.346) (-1120.183) (-1122.715) * (-1116.405) (-1111.650) [-1113.410] (-1113.416) -- 0:00:28
852500 -- (-1119.889) (-1113.528) [-1108.750] (-1121.074) * (-1113.999) (-1112.084) (-1117.037) [-1111.708] -- 0:00:28
853000 -- (-1116.827) (-1116.656) [-1116.844] (-1115.394) * (-1118.217) [-1111.891] (-1115.422) (-1114.081) -- 0:00:28
853500 -- (-1112.833) (-1119.327) (-1116.172) [-1110.413] * (-1115.900) (-1122.256) (-1113.560) [-1112.424] -- 0:00:27
854000 -- (-1113.844) [-1119.847] (-1115.725) (-1117.716) * (-1116.234) (-1111.347) (-1114.927) [-1115.862] -- 0:00:27
854500 -- (-1121.987) [-1110.974] (-1107.824) (-1117.720) * (-1113.441) [-1108.410] (-1112.475) (-1124.936) -- 0:00:27
855000 -- (-1111.455) (-1111.980) (-1112.349) [-1115.001] * (-1111.337) (-1109.961) [-1115.132] (-1110.767) -- 0:00:27
Average standard deviation of split frequencies: 0.004039
855500 -- (-1110.756) (-1108.169) [-1112.195] (-1114.391) * (-1112.842) (-1112.725) [-1114.993] (-1115.359) -- 0:00:27
856000 -- [-1111.534] (-1112.994) (-1119.203) (-1115.006) * [-1106.240] (-1118.182) (-1117.344) (-1116.163) -- 0:00:27
856500 -- (-1110.362) (-1113.754) (-1120.076) [-1111.518] * (-1113.467) (-1118.027) [-1111.551] (-1114.847) -- 0:00:27
857000 -- (-1109.305) (-1111.253) (-1113.215) [-1116.699] * (-1115.051) [-1114.880] (-1117.813) (-1118.215) -- 0:00:27
857500 -- (-1110.837) (-1111.026) [-1109.602] (-1120.816) * (-1121.734) [-1107.819] (-1114.480) (-1118.897) -- 0:00:27
858000 -- (-1111.500) (-1118.975) (-1118.084) [-1116.270] * (-1110.213) [-1108.690] (-1118.237) (-1119.310) -- 0:00:27
858500 -- (-1113.991) (-1110.154) [-1112.525] (-1115.347) * (-1110.066) (-1126.675) (-1131.138) [-1115.008] -- 0:00:27
859000 -- (-1115.165) [-1117.785] (-1113.925) (-1117.849) * (-1118.199) [-1118.410] (-1116.891) (-1113.208) -- 0:00:26
859500 -- [-1111.026] (-1110.009) (-1114.671) (-1111.425) * (-1111.419) [-1115.334] (-1117.373) (-1116.912) -- 0:00:26
860000 -- (-1114.778) (-1118.501) [-1113.459] (-1114.261) * (-1113.116) (-1114.283) [-1108.458] (-1117.308) -- 0:00:26
Average standard deviation of split frequencies: 0.003469
860500 -- (-1119.423) (-1121.303) [-1112.419] (-1125.557) * (-1116.891) (-1114.470) (-1110.507) [-1116.016] -- 0:00:26
861000 -- (-1118.766) (-1116.164) [-1123.286] (-1124.724) * (-1112.333) [-1111.386] (-1115.358) (-1120.017) -- 0:00:26
861500 -- (-1114.301) (-1109.859) [-1111.067] (-1119.469) * [-1109.713] (-1113.243) (-1113.629) (-1114.038) -- 0:00:26
862000 -- (-1112.355) (-1117.469) [-1121.937] (-1118.245) * (-1114.050) [-1107.924] (-1120.820) (-1115.848) -- 0:00:26
862500 -- (-1117.489) [-1113.421] (-1114.091) (-1115.279) * [-1116.465] (-1111.209) (-1112.342) (-1110.910) -- 0:00:26
863000 -- (-1114.646) (-1119.223) (-1118.122) [-1113.181] * [-1110.267] (-1114.248) (-1114.827) (-1115.800) -- 0:00:26
863500 -- (-1117.618) (-1114.659) (-1115.948) [-1112.613] * (-1116.272) (-1116.449) [-1112.572] (-1112.228) -- 0:00:26
864000 -- (-1119.353) (-1114.849) [-1114.383] (-1114.246) * (-1124.829) (-1111.965) (-1116.560) [-1114.779] -- 0:00:25
864500 -- (-1112.231) (-1117.290) (-1119.225) [-1117.090] * (-1115.578) (-1115.062) (-1118.336) [-1105.515] -- 0:00:25
865000 -- (-1118.318) (-1114.194) [-1113.521] (-1115.510) * [-1116.409] (-1110.511) (-1115.645) (-1113.034) -- 0:00:25
Average standard deviation of split frequencies: 0.003266
865500 -- (-1118.929) (-1113.256) [-1111.311] (-1109.718) * (-1128.896) [-1117.628] (-1116.977) (-1107.336) -- 0:00:25
866000 -- (-1115.459) (-1114.280) [-1111.369] (-1112.503) * (-1117.480) (-1120.460) (-1115.752) [-1112.031] -- 0:00:25
866500 -- (-1117.554) [-1113.786] (-1114.149) (-1116.378) * (-1121.672) (-1122.473) (-1119.999) [-1115.018] -- 0:00:25
867000 -- [-1123.279] (-1124.359) (-1114.458) (-1118.441) * (-1119.393) [-1111.644] (-1114.777) (-1116.662) -- 0:00:25
867500 -- [-1110.954] (-1110.918) (-1121.266) (-1118.500) * (-1124.224) (-1117.195) [-1116.007] (-1120.356) -- 0:00:25
868000 -- (-1113.855) (-1117.047) (-1116.874) [-1111.993] * (-1126.789) [-1111.548] (-1108.436) (-1111.427) -- 0:00:25
868500 -- (-1114.263) (-1116.527) (-1114.079) [-1108.024] * (-1115.925) [-1112.008] (-1117.161) (-1118.724) -- 0:00:25
869000 -- (-1116.621) [-1125.144] (-1113.665) (-1112.733) * [-1110.353] (-1120.676) (-1116.232) (-1112.992) -- 0:00:25
869500 -- (-1116.314) [-1113.573] (-1119.928) (-1114.938) * [-1111.020] (-1123.857) (-1120.248) (-1114.794) -- 0:00:24
870000 -- (-1122.010) (-1114.248) (-1116.121) [-1115.319] * [-1110.938] (-1116.753) (-1119.153) (-1114.785) -- 0:00:24
Average standard deviation of split frequencies: 0.002707
870500 -- [-1113.179] (-1117.333) (-1116.334) (-1121.691) * [-1113.057] (-1111.071) (-1117.874) (-1126.899) -- 0:00:24
871000 -- (-1115.048) (-1114.459) [-1113.653] (-1114.344) * (-1116.365) [-1114.079] (-1113.153) (-1112.620) -- 0:00:24
871500 -- (-1116.603) [-1119.634] (-1112.651) (-1120.659) * (-1121.394) [-1111.238] (-1116.923) (-1115.765) -- 0:00:24
872000 -- (-1116.466) (-1112.439) (-1111.330) [-1114.447] * (-1115.242) [-1107.122] (-1113.862) (-1114.979) -- 0:00:24
872500 -- (-1115.646) (-1110.972) [-1111.123] (-1118.898) * (-1117.807) (-1115.186) (-1115.846) [-1112.128] -- 0:00:24
873000 -- (-1115.713) (-1112.987) (-1121.525) [-1115.610] * (-1111.815) [-1113.022] (-1115.251) (-1112.138) -- 0:00:24
873500 -- (-1113.788) [-1121.489] (-1114.993) (-1119.564) * [-1113.056] (-1111.993) (-1118.754) (-1113.232) -- 0:00:24
874000 -- (-1114.751) (-1120.860) [-1113.157] (-1113.206) * (-1112.811) (-1116.054) (-1118.980) [-1117.363] -- 0:00:24
874500 -- (-1115.041) [-1113.064] (-1121.287) (-1118.969) * [-1118.570] (-1112.178) (-1122.246) (-1115.427) -- 0:00:23
875000 -- (-1116.905) [-1117.250] (-1111.752) (-1113.074) * (-1113.493) [-1117.631] (-1115.105) (-1113.589) -- 0:00:23
Average standard deviation of split frequencies: 0.003049
875500 -- [-1111.501] (-1116.572) (-1117.088) (-1116.808) * (-1115.318) [-1112.758] (-1117.258) (-1117.181) -- 0:00:23
876000 -- (-1109.114) (-1119.278) [-1117.170] (-1111.261) * (-1112.255) [-1116.001] (-1115.476) (-1113.055) -- 0:00:23
876500 -- (-1110.934) [-1115.306] (-1132.169) (-1124.056) * (-1115.886) (-1114.738) [-1115.794] (-1110.984) -- 0:00:23
877000 -- (-1113.214) (-1121.578) [-1118.829] (-1121.680) * (-1113.796) (-1122.211) (-1114.847) [-1119.655] -- 0:00:23
877500 -- [-1110.153] (-1111.180) (-1114.242) (-1113.853) * (-1112.347) (-1111.322) (-1120.412) [-1113.611] -- 0:00:23
878000 -- [-1112.679] (-1118.709) (-1115.362) (-1114.369) * (-1119.670) [-1118.791] (-1121.702) (-1112.767) -- 0:00:23
878500 -- (-1114.639) (-1115.443) (-1111.860) [-1112.889] * [-1115.759] (-1117.931) (-1124.188) (-1111.626) -- 0:00:23
879000 -- (-1114.541) [-1115.909] (-1120.114) (-1116.988) * (-1119.002) [-1112.267] (-1112.020) (-1109.133) -- 0:00:23
879500 -- (-1117.822) (-1120.925) [-1112.150] (-1127.038) * (-1117.753) [-1110.252] (-1113.443) (-1111.981) -- 0:00:23
880000 -- (-1116.176) [-1123.884] (-1111.738) (-1117.426) * [-1120.820] (-1113.526) (-1117.334) (-1114.041) -- 0:00:22
Average standard deviation of split frequencies: 0.002676
880500 -- (-1114.904) (-1122.208) (-1116.617) [-1113.364] * [-1111.073] (-1116.359) (-1112.336) (-1114.418) -- 0:00:22
881000 -- (-1122.414) (-1115.985) (-1117.390) [-1120.160] * (-1118.502) (-1117.013) [-1114.203] (-1109.838) -- 0:00:22
881500 -- (-1118.048) (-1123.656) (-1117.101) [-1114.223] * (-1116.793) (-1113.651) (-1119.177) [-1115.058] -- 0:00:22
882000 -- [-1115.066] (-1118.538) (-1107.567) (-1116.101) * [-1112.005] (-1114.837) (-1112.465) (-1113.949) -- 0:00:22
882500 -- (-1111.098) [-1111.647] (-1118.521) (-1112.375) * (-1106.338) [-1116.538] (-1120.007) (-1112.212) -- 0:00:22
883000 -- (-1113.300) (-1110.800) (-1116.505) [-1113.220] * [-1109.457] (-1115.789) (-1131.601) (-1116.432) -- 0:00:22
883500 -- (-1117.733) [-1113.785] (-1114.214) (-1117.076) * (-1117.900) [-1114.940] (-1118.954) (-1115.210) -- 0:00:22
884000 -- (-1114.537) (-1111.925) (-1109.265) [-1113.068] * [-1118.372] (-1120.186) (-1116.888) (-1111.531) -- 0:00:22
884500 -- (-1119.475) (-1114.464) (-1114.480) [-1108.384] * (-1119.816) [-1112.447] (-1107.681) (-1117.443) -- 0:00:22
885000 -- (-1115.134) [-1116.093] (-1116.944) (-1113.371) * (-1114.031) [-1109.367] (-1112.261) (-1110.626) -- 0:00:21
Average standard deviation of split frequencies: 0.002660
885500 -- (-1110.618) (-1113.613) (-1116.876) [-1112.972] * (-1113.182) (-1112.925) [-1112.452] (-1117.440) -- 0:00:21
886000 -- (-1119.294) (-1112.213) (-1123.474) [-1113.018] * (-1114.098) (-1113.543) [-1114.961] (-1117.739) -- 0:00:21
886500 -- (-1122.454) (-1117.481) [-1114.400] (-1109.067) * (-1111.239) (-1111.786) [-1112.150] (-1111.821) -- 0:00:21
887000 -- (-1117.286) (-1120.174) (-1116.161) [-1109.933] * (-1113.098) (-1115.466) (-1117.417) [-1109.343] -- 0:00:21
887500 -- (-1115.606) (-1120.985) [-1121.840] (-1108.404) * [-1112.169] (-1114.897) (-1116.603) (-1121.226) -- 0:00:21
888000 -- (-1115.017) [-1113.094] (-1118.643) (-1121.474) * [-1115.066] (-1125.509) (-1111.437) (-1119.771) -- 0:00:21
888500 -- (-1117.482) (-1117.711) (-1120.342) [-1115.084] * [-1112.659] (-1114.941) (-1117.962) (-1115.184) -- 0:00:21
889000 -- [-1118.364] (-1118.791) (-1119.318) (-1119.985) * (-1110.932) (-1121.133) (-1117.025) [-1117.977] -- 0:00:21
889500 -- (-1113.884) (-1115.993) (-1116.576) [-1111.920] * (-1124.194) (-1113.530) [-1110.820] (-1119.026) -- 0:00:21
890000 -- (-1117.915) (-1110.893) [-1116.049] (-1114.493) * (-1113.987) (-1111.971) [-1115.608] (-1109.982) -- 0:00:21
Average standard deviation of split frequencies: 0.002294
890500 -- (-1119.196) (-1116.418) [-1112.370] (-1120.575) * [-1115.052] (-1112.791) (-1117.238) (-1115.371) -- 0:00:20
891000 -- (-1117.654) [-1117.178] (-1114.885) (-1118.617) * [-1112.920] (-1112.233) (-1119.302) (-1117.492) -- 0:00:20
891500 -- [-1112.901] (-1115.033) (-1120.947) (-1113.354) * [-1116.551] (-1108.305) (-1118.668) (-1114.459) -- 0:00:20
892000 -- (-1115.434) (-1108.181) (-1111.907) [-1114.800] * (-1114.612) [-1111.341] (-1113.831) (-1118.256) -- 0:00:20
892500 -- (-1123.456) (-1121.522) (-1112.198) [-1115.148] * (-1113.111) (-1118.797) [-1117.401] (-1114.716) -- 0:00:20
893000 -- [-1112.628] (-1114.158) (-1117.036) (-1117.376) * [-1109.327] (-1111.424) (-1115.245) (-1113.952) -- 0:00:20
893500 -- (-1115.423) [-1112.230] (-1115.715) (-1113.175) * [-1113.662] (-1126.108) (-1115.139) (-1106.332) -- 0:00:20
894000 -- (-1113.062) [-1109.069] (-1116.160) (-1115.661) * (-1125.934) (-1110.009) (-1110.690) [-1117.193] -- 0:00:20
894500 -- (-1112.216) (-1114.866) (-1114.259) [-1114.651] * (-1113.419) (-1115.672) [-1117.356] (-1112.826) -- 0:00:20
895000 -- [-1115.606] (-1113.498) (-1110.638) (-1113.232) * (-1111.822) (-1113.638) [-1107.438] (-1115.242) -- 0:00:20
Average standard deviation of split frequencies: 0.002455
895500 -- [-1111.540] (-1117.838) (-1119.219) (-1120.983) * (-1114.792) (-1111.451) (-1111.445) [-1115.755] -- 0:00:19
896000 -- (-1112.456) [-1119.027] (-1118.705) (-1115.246) * (-1123.621) (-1110.344) [-1111.216] (-1117.889) -- 0:00:19
896500 -- (-1111.748) (-1110.017) [-1119.202] (-1109.975) * (-1118.473) (-1112.267) [-1112.291] (-1119.936) -- 0:00:19
897000 -- [-1111.216] (-1108.396) (-1114.379) (-1126.211) * (-1120.153) [-1116.347] (-1112.389) (-1112.409) -- 0:00:19
897500 -- (-1109.163) [-1113.927] (-1115.823) (-1120.883) * (-1125.330) (-1112.479) [-1113.386] (-1119.835) -- 0:00:19
898000 -- [-1113.898] (-1121.364) (-1115.193) (-1119.288) * (-1121.307) (-1123.166) [-1114.247] (-1113.242) -- 0:00:19
898500 -- [-1109.975] (-1118.733) (-1112.703) (-1118.507) * (-1113.350) (-1111.349) (-1119.024) [-1112.657] -- 0:00:19
899000 -- (-1110.140) [-1114.504] (-1110.758) (-1113.139) * (-1113.074) [-1114.843] (-1119.241) (-1116.222) -- 0:00:19
899500 -- (-1113.279) [-1115.540] (-1111.221) (-1114.148) * (-1119.335) (-1110.021) (-1121.966) [-1111.665] -- 0:00:19
900000 -- (-1113.802) (-1119.610) (-1111.743) [-1114.389] * (-1117.465) (-1109.354) [-1108.585] (-1118.291) -- 0:00:19
Average standard deviation of split frequencies: 0.003140
900500 -- [-1113.682] (-1120.460) (-1113.716) (-1111.830) * (-1120.408) (-1115.840) [-1111.701] (-1118.397) -- 0:00:19
901000 -- (-1110.513) [-1113.723] (-1115.522) (-1114.484) * (-1112.512) (-1112.570) [-1117.744] (-1116.554) -- 0:00:18
901500 -- (-1117.081) (-1113.177) (-1115.310) [-1110.392] * [-1110.471] (-1117.344) (-1120.395) (-1111.553) -- 0:00:18
902000 -- (-1130.343) [-1112.486] (-1119.251) (-1117.536) * (-1114.251) (-1116.191) (-1116.997) [-1117.374] -- 0:00:18
902500 -- (-1121.142) [-1114.347] (-1125.065) (-1118.803) * [-1114.026] (-1112.911) (-1122.203) (-1114.599) -- 0:00:18
903000 -- (-1115.611) [-1113.678] (-1114.836) (-1116.350) * (-1111.572) (-1113.051) (-1116.606) [-1116.671] -- 0:00:18
903500 -- (-1113.917) (-1113.295) (-1112.860) [-1114.513] * [-1109.743] (-1113.648) (-1121.223) (-1118.169) -- 0:00:18
904000 -- (-1117.828) (-1113.286) [-1115.730] (-1114.250) * [-1121.224] (-1113.459) (-1113.050) (-1126.819) -- 0:00:18
904500 -- [-1112.526] (-1114.430) (-1117.683) (-1112.335) * (-1118.186) (-1117.477) [-1113.252] (-1118.223) -- 0:00:18
905000 -- (-1121.996) (-1116.779) (-1109.707) [-1115.935] * (-1114.710) (-1118.028) (-1116.447) [-1111.405] -- 0:00:18
Average standard deviation of split frequencies: 0.003469
905500 -- (-1124.211) (-1124.875) [-1109.237] (-1118.455) * (-1116.708) (-1120.338) (-1115.614) [-1113.243] -- 0:00:18
906000 -- (-1121.610) (-1116.574) [-1113.354] (-1113.528) * [-1111.103] (-1114.681) (-1115.821) (-1111.131) -- 0:00:17
906500 -- (-1115.221) [-1109.541] (-1115.415) (-1120.511) * (-1112.676) (-1117.791) [-1114.627] (-1109.565) -- 0:00:17
907000 -- (-1110.954) (-1113.755) (-1110.736) [-1114.182] * (-1120.973) (-1113.406) (-1118.386) [-1118.237] -- 0:00:17
907500 -- (-1111.674) [-1117.113] (-1121.366) (-1122.862) * [-1109.828] (-1117.217) (-1116.899) (-1122.725) -- 0:00:17
908000 -- [-1118.050] (-1114.735) (-1110.826) (-1118.682) * (-1125.465) (-1111.441) (-1114.588) [-1114.683] -- 0:00:17
908500 -- (-1122.430) [-1109.574] (-1110.794) (-1118.469) * (-1119.769) (-1119.214) [-1113.114] (-1114.483) -- 0:00:17
909000 -- (-1111.656) [-1113.329] (-1129.969) (-1115.163) * (-1119.933) (-1106.668) [-1112.189] (-1123.726) -- 0:00:17
909500 -- (-1124.763) (-1118.182) [-1115.978] (-1113.036) * (-1115.803) [-1115.435] (-1119.839) (-1126.760) -- 0:00:17
910000 -- (-1113.371) (-1115.494) (-1112.800) [-1115.471] * (-1117.205) (-1114.978) [-1111.363] (-1117.958) -- 0:00:17
Average standard deviation of split frequencies: 0.004141
910500 -- (-1110.640) (-1115.122) (-1117.241) [-1110.225] * (-1120.165) [-1112.719] (-1109.845) (-1113.989) -- 0:00:17
911000 -- (-1113.882) (-1118.243) (-1113.927) [-1113.566] * (-1116.656) [-1110.994] (-1111.171) (-1109.980) -- 0:00:16
911500 -- (-1119.869) (-1115.438) (-1111.985) [-1113.729] * (-1119.466) (-1119.498) [-1113.935] (-1113.738) -- 0:00:16
912000 -- (-1111.874) (-1110.891) [-1109.028] (-1120.352) * (-1118.090) (-1114.409) (-1114.426) [-1116.692] -- 0:00:16
912500 -- (-1114.116) (-1116.804) [-1113.905] (-1116.350) * [-1109.954] (-1110.853) (-1111.722) (-1111.250) -- 0:00:16
913000 -- (-1119.836) (-1125.274) [-1114.777] (-1121.054) * [-1112.450] (-1125.649) (-1111.214) (-1116.252) -- 0:00:16
913500 -- (-1111.459) (-1109.838) [-1112.408] (-1113.685) * (-1121.633) (-1113.489) (-1112.206) [-1114.111] -- 0:00:16
914000 -- (-1114.553) (-1114.682) [-1111.853] (-1116.108) * (-1117.806) (-1115.436) [-1114.183] (-1115.048) -- 0:00:16
914500 -- [-1112.183] (-1115.380) (-1116.268) (-1110.943) * (-1118.333) [-1115.311] (-1112.772) (-1122.742) -- 0:00:16
915000 -- (-1112.011) (-1116.939) (-1111.117) [-1112.467] * (-1118.927) (-1116.319) [-1115.599] (-1119.978) -- 0:00:16
Average standard deviation of split frequencies: 0.003946
915500 -- [-1108.286] (-1110.524) (-1115.410) (-1113.676) * (-1116.520) (-1115.698) [-1112.656] (-1112.925) -- 0:00:16
916000 -- (-1115.853) (-1116.337) [-1110.052] (-1116.413) * (-1111.421) (-1120.134) (-1118.114) [-1110.948] -- 0:00:16
916500 -- (-1115.992) (-1117.402) (-1110.183) [-1110.999] * [-1113.641] (-1115.609) (-1116.148) (-1116.610) -- 0:00:15
917000 -- [-1115.540] (-1114.931) (-1115.547) (-1113.454) * (-1107.824) (-1117.915) (-1118.711) [-1111.555] -- 0:00:15
917500 -- (-1114.555) (-1118.307) (-1116.461) [-1115.719] * (-1112.472) [-1109.501] (-1121.672) (-1113.815) -- 0:00:15
918000 -- (-1119.338) (-1118.931) [-1115.359] (-1114.748) * (-1115.952) [-1110.611] (-1113.858) (-1119.738) -- 0:00:15
918500 -- (-1114.096) [-1111.051] (-1118.096) (-1120.800) * (-1114.778) [-1107.022] (-1110.544) (-1116.443) -- 0:00:15
919000 -- (-1116.977) [-1112.198] (-1117.710) (-1115.170) * (-1118.121) (-1118.871) (-1111.240) [-1110.262] -- 0:00:15
919500 -- [-1115.679] (-1112.434) (-1132.874) (-1113.478) * [-1113.031] (-1116.389) (-1108.272) (-1111.587) -- 0:00:15
920000 -- (-1110.375) (-1112.818) (-1111.240) [-1113.070] * (-1118.971) [-1114.721] (-1113.728) (-1110.948) -- 0:00:15
Average standard deviation of split frequencies: 0.004267
920500 -- (-1116.694) (-1116.213) [-1108.691] (-1116.545) * (-1119.070) (-1118.621) [-1112.814] (-1111.142) -- 0:00:15
921000 -- (-1120.989) [-1110.088] (-1116.832) (-1111.160) * (-1114.677) (-1114.945) [-1118.040] (-1113.279) -- 0:00:15
921500 -- [-1117.958] (-1114.782) (-1118.045) (-1116.184) * (-1118.106) (-1110.322) [-1116.297] (-1115.700) -- 0:00:14
922000 -- (-1123.316) [-1111.158] (-1116.713) (-1115.803) * [-1118.594] (-1107.014) (-1117.100) (-1125.000) -- 0:00:14
922500 -- (-1112.977) [-1114.913] (-1114.676) (-1116.858) * (-1122.498) (-1132.701) (-1119.277) [-1114.585] -- 0:00:14
923000 -- (-1113.785) (-1120.486) (-1121.288) [-1116.390] * (-1118.589) [-1117.947] (-1115.833) (-1117.886) -- 0:00:14
923500 -- (-1121.253) [-1117.861] (-1115.203) (-1122.830) * (-1124.960) (-1118.902) [-1114.775] (-1111.110) -- 0:00:14
924000 -- (-1111.102) [-1115.601] (-1118.884) (-1114.959) * (-1117.912) [-1112.357] (-1119.978) (-1115.185) -- 0:00:14
924500 -- (-1118.010) (-1109.675) (-1123.255) [-1115.713] * (-1115.975) [-1111.741] (-1120.674) (-1113.964) -- 0:00:14
925000 -- [-1114.351] (-1114.743) (-1112.146) (-1120.257) * (-1109.791) (-1114.615) (-1112.836) [-1116.180] -- 0:00:14
Average standard deviation of split frequencies: 0.004921
925500 -- (-1115.858) (-1122.417) [-1111.349] (-1122.394) * (-1110.903) (-1114.472) [-1116.058] (-1126.757) -- 0:00:14
926000 -- (-1113.691) (-1109.855) [-1117.832] (-1118.377) * (-1114.661) (-1114.781) [-1113.854] (-1119.072) -- 0:00:14
926500 -- (-1117.419) [-1112.165] (-1118.503) (-1121.227) * [-1117.885] (-1123.942) (-1112.278) (-1115.772) -- 0:00:14
927000 -- (-1112.893) (-1110.345) (-1116.859) [-1114.691] * (-1117.912) (-1119.089) [-1114.721] (-1120.744) -- 0:00:13
927500 -- (-1116.655) (-1110.985) (-1122.276) [-1112.041] * (-1114.411) [-1111.250] (-1112.731) (-1111.389) -- 0:00:13
928000 -- (-1122.186) (-1119.637) [-1111.079] (-1121.312) * (-1115.055) [-1114.344] (-1111.227) (-1116.059) -- 0:00:13
928500 -- (-1111.460) (-1119.615) [-1109.485] (-1117.699) * (-1119.928) (-1113.862) [-1119.704] (-1115.399) -- 0:00:13
929000 -- (-1116.040) (-1120.965) (-1112.440) [-1116.903] * (-1122.507) (-1116.455) [-1113.366] (-1118.401) -- 0:00:13
929500 -- [-1119.267] (-1124.129) (-1113.228) (-1118.887) * [-1109.472] (-1122.073) (-1112.217) (-1124.923) -- 0:00:13
930000 -- [-1117.120] (-1124.943) (-1115.340) (-1109.149) * (-1117.242) (-1112.517) [-1112.797] (-1115.440) -- 0:00:13
Average standard deviation of split frequencies: 0.004896
930500 -- (-1113.061) (-1113.842) (-1116.869) [-1115.832] * (-1118.228) [-1111.576] (-1112.630) (-1110.006) -- 0:00:13
931000 -- (-1115.680) [-1116.441] (-1120.748) (-1111.757) * [-1118.211] (-1117.649) (-1116.525) (-1113.891) -- 0:00:13
931500 -- (-1114.170) (-1120.735) (-1116.204) [-1110.100] * (-1117.109) [-1117.421] (-1110.734) (-1109.952) -- 0:00:13
932000 -- [-1113.213] (-1122.648) (-1112.941) (-1112.888) * (-1120.903) (-1115.302) [-1115.377] (-1115.394) -- 0:00:12
932500 -- (-1116.309) (-1110.382) [-1118.666] (-1111.096) * (-1118.279) [-1110.426] (-1117.813) (-1108.991) -- 0:00:12
933000 -- (-1119.620) [-1114.749] (-1115.177) (-1115.963) * (-1112.055) [-1112.126] (-1118.397) (-1112.020) -- 0:00:12
933500 -- (-1119.511) (-1111.647) [-1109.183] (-1113.779) * (-1111.348) [-1124.400] (-1114.939) (-1120.035) -- 0:00:12
934000 -- [-1115.418] (-1121.873) (-1113.627) (-1114.017) * (-1115.044) [-1117.039] (-1114.872) (-1117.598) -- 0:00:12
934500 -- (-1111.360) (-1120.489) [-1112.080] (-1117.229) * (-1114.350) [-1109.722] (-1120.254) (-1116.862) -- 0:00:12
935000 -- (-1114.329) (-1112.940) [-1110.915] (-1123.725) * (-1118.781) (-1122.073) [-1110.767] (-1118.168) -- 0:00:12
Average standard deviation of split frequencies: 0.004701
935500 -- (-1117.754) (-1114.619) [-1111.500] (-1113.886) * [-1113.638] (-1120.967) (-1120.761) (-1110.143) -- 0:00:12
936000 -- [-1114.804] (-1112.456) (-1107.876) (-1116.503) * (-1111.609) (-1123.437) [-1117.188] (-1114.673) -- 0:00:12
936500 -- (-1115.764) (-1114.826) (-1111.388) [-1109.846] * (-1117.492) (-1119.124) (-1120.141) [-1118.820] -- 0:00:12
937000 -- (-1119.486) [-1110.320] (-1115.194) (-1115.942) * (-1119.234) [-1121.431] (-1115.577) (-1124.705) -- 0:00:12
937500 -- [-1112.189] (-1117.060) (-1110.375) (-1111.151) * (-1116.218) [-1114.196] (-1115.307) (-1127.026) -- 0:00:11
938000 -- (-1115.740) (-1112.856) [-1117.299] (-1112.948) * (-1116.088) (-1124.635) [-1114.572] (-1112.368) -- 0:00:11
938500 -- (-1116.341) [-1110.825] (-1114.178) (-1117.793) * (-1110.496) (-1115.987) (-1117.115) [-1112.993] -- 0:00:11
939000 -- (-1125.029) (-1114.237) [-1116.729] (-1117.244) * (-1119.406) [-1112.296] (-1112.863) (-1109.071) -- 0:00:11
939500 -- (-1110.964) (-1122.619) [-1107.801] (-1109.389) * (-1114.680) (-1112.865) (-1122.705) [-1116.575] -- 0:00:11
940000 -- (-1113.130) [-1117.157] (-1116.739) (-1118.781) * (-1113.151) [-1116.955] (-1115.373) (-1111.591) -- 0:00:11
Average standard deviation of split frequencies: 0.004343
940500 -- (-1121.261) (-1113.270) (-1115.919) [-1115.664] * (-1115.956) [-1118.545] (-1112.719) (-1116.018) -- 0:00:11
941000 -- [-1120.822] (-1119.533) (-1117.710) (-1113.024) * [-1112.195] (-1112.739) (-1124.017) (-1116.849) -- 0:00:11
941500 -- (-1118.058) [-1116.433] (-1117.766) (-1115.570) * (-1116.288) (-1114.707) [-1112.448] (-1117.257) -- 0:00:11
942000 -- (-1113.119) [-1116.560] (-1118.903) (-1114.610) * (-1112.702) (-1109.830) (-1114.347) [-1113.080] -- 0:00:11
942500 -- (-1115.254) [-1109.951] (-1118.356) (-1107.888) * (-1114.971) [-1114.649] (-1112.490) (-1115.886) -- 0:00:10
943000 -- (-1117.339) (-1114.869) (-1117.725) [-1108.179] * (-1112.276) (-1113.124) (-1115.866) [-1107.135] -- 0:00:10
943500 -- [-1112.393] (-1114.625) (-1115.726) (-1110.649) * (-1124.740) (-1115.909) (-1112.465) [-1110.520] -- 0:00:10
944000 -- (-1116.690) (-1112.889) [-1116.481] (-1118.980) * (-1114.678) (-1119.786) [-1111.321] (-1113.173) -- 0:00:10
944500 -- (-1112.740) [-1114.170] (-1113.671) (-1111.593) * (-1111.159) (-1109.970) [-1112.406] (-1112.289) -- 0:00:10
945000 -- (-1115.564) (-1111.661) (-1114.365) [-1110.552] * (-1110.956) [-1122.790] (-1109.297) (-1116.176) -- 0:00:10
Average standard deviation of split frequencies: 0.004319
945500 -- (-1123.487) [-1113.276] (-1114.743) (-1111.354) * (-1110.735) (-1119.968) (-1113.708) [-1118.766] -- 0:00:10
946000 -- (-1115.434) (-1114.029) [-1108.391] (-1115.927) * (-1116.084) (-1119.599) [-1109.214] (-1116.576) -- 0:00:10
946500 -- (-1120.019) (-1112.408) (-1116.896) [-1108.539] * (-1111.168) (-1111.992) [-1115.484] (-1116.783) -- 0:00:10
947000 -- (-1114.044) (-1114.707) [-1117.672] (-1111.292) * (-1119.612) (-1122.555) (-1112.269) [-1114.115] -- 0:00:10
947500 -- (-1114.687) (-1116.409) (-1117.029) [-1114.466] * (-1120.052) [-1118.568] (-1126.038) (-1114.064) -- 0:00:10
948000 -- [-1112.457] (-1112.652) (-1122.663) (-1111.088) * [-1110.291] (-1117.031) (-1114.407) (-1118.167) -- 0:00:09
948500 -- (-1115.245) (-1115.206) [-1114.296] (-1116.313) * (-1111.427) (-1119.697) [-1117.755] (-1121.113) -- 0:00:09
949000 -- (-1113.624) [-1116.390] (-1124.747) (-1119.792) * (-1111.976) (-1119.581) [-1114.408] (-1123.960) -- 0:00:09
949500 -- (-1116.775) (-1119.592) (-1121.585) [-1117.501] * (-1113.980) (-1114.331) [-1113.001] (-1124.024) -- 0:00:09
950000 -- (-1125.302) [-1119.894] (-1114.999) (-1113.543) * (-1110.299) (-1116.464) [-1114.568] (-1118.998) -- 0:00:09
Average standard deviation of split frequencies: 0.004463
950500 -- (-1119.589) (-1120.062) (-1124.282) [-1120.486] * (-1115.868) [-1115.458] (-1113.726) (-1108.801) -- 0:00:09
951000 -- [-1110.728] (-1118.358) (-1118.435) (-1116.143) * (-1111.079) [-1109.028] (-1113.836) (-1118.462) -- 0:00:09
951500 -- (-1119.472) [-1114.389] (-1118.340) (-1112.200) * (-1115.736) (-1114.642) (-1117.424) [-1109.730] -- 0:00:09
952000 -- (-1113.732) (-1119.245) [-1117.308] (-1120.186) * (-1111.830) [-1114.561] (-1119.243) (-1115.560) -- 0:00:09
952500 -- (-1117.923) (-1114.265) [-1114.151] (-1114.143) * [-1113.739] (-1112.947) (-1111.494) (-1120.187) -- 0:00:09
953000 -- (-1111.904) (-1119.046) [-1116.196] (-1112.045) * (-1115.118) [-1114.881] (-1112.056) (-1120.224) -- 0:00:08
953500 -- [-1114.359] (-1123.497) (-1114.327) (-1112.030) * (-1108.900) (-1122.099) (-1111.853) [-1114.036] -- 0:00:08
954000 -- [-1113.472] (-1115.955) (-1116.755) (-1112.004) * [-1113.275] (-1113.256) (-1110.836) (-1115.899) -- 0:00:08
954500 -- [-1111.957] (-1115.001) (-1117.995) (-1116.489) * [-1112.594] (-1113.952) (-1122.846) (-1110.192) -- 0:00:08
955000 -- (-1121.549) (-1118.333) (-1116.624) [-1115.258] * (-1114.630) [-1112.954] (-1108.675) (-1113.317) -- 0:00:08
Average standard deviation of split frequencies: 0.004274
955500 -- [-1115.237] (-1114.671) (-1121.582) (-1120.643) * (-1112.924) (-1116.617) (-1113.317) [-1108.626] -- 0:00:08
956000 -- (-1114.274) (-1117.904) (-1116.148) [-1108.176] * (-1120.902) (-1114.256) [-1114.721] (-1121.428) -- 0:00:08
956500 -- [-1112.346] (-1112.835) (-1117.053) (-1115.299) * (-1114.636) (-1120.852) [-1114.173] (-1113.217) -- 0:00:08
957000 -- [-1113.021] (-1130.203) (-1118.818) (-1115.417) * [-1117.197] (-1113.716) (-1111.944) (-1115.518) -- 0:00:08
957500 -- (-1116.427) (-1118.132) (-1124.769) [-1113.083] * [-1112.408] (-1114.613) (-1116.669) (-1114.775) -- 0:00:08
958000 -- (-1114.982) (-1115.883) [-1118.232] (-1115.882) * (-1115.231) (-1119.537) [-1114.712] (-1113.718) -- 0:00:08
958500 -- (-1115.732) (-1122.154) (-1113.768) [-1122.807] * (-1117.122) [-1117.547] (-1111.288) (-1113.864) -- 0:00:07
959000 -- (-1113.127) [-1114.034] (-1121.777) (-1117.527) * (-1119.960) [-1115.629] (-1115.288) (-1117.191) -- 0:00:07
959500 -- (-1119.992) (-1118.407) (-1115.174) [-1111.739] * [-1114.315] (-1112.387) (-1115.898) (-1117.414) -- 0:00:07
960000 -- [-1116.232] (-1120.545) (-1112.982) (-1111.228) * [-1114.874] (-1120.943) (-1116.028) (-1113.267) -- 0:00:07
Average standard deviation of split frequencies: 0.004416
960500 -- (-1112.283) (-1116.131) (-1113.425) [-1106.284] * (-1112.809) (-1118.723) (-1121.205) [-1113.539] -- 0:00:07
961000 -- (-1110.794) (-1114.857) [-1113.602] (-1112.422) * (-1121.249) (-1119.428) (-1112.942) [-1121.882] -- 0:00:07
961500 -- [-1110.496] (-1109.158) (-1112.262) (-1112.599) * [-1116.144] (-1115.855) (-1115.899) (-1109.600) -- 0:00:07
962000 -- (-1120.523) (-1116.298) (-1119.860) [-1113.502] * (-1115.562) (-1112.864) [-1116.604] (-1111.842) -- 0:00:07
962500 -- (-1116.034) (-1115.448) [-1115.754] (-1113.207) * (-1119.808) (-1116.952) (-1119.239) [-1115.829] -- 0:00:07
963000 -- [-1117.244] (-1115.892) (-1114.549) (-1114.746) * (-1117.143) (-1117.022) (-1116.859) [-1113.855] -- 0:00:07
963500 -- (-1112.648) [-1110.704] (-1114.049) (-1118.219) * (-1113.826) (-1113.037) (-1115.515) [-1112.598] -- 0:00:06
964000 -- (-1118.988) (-1114.175) [-1119.408] (-1112.789) * [-1121.069] (-1122.832) (-1117.792) (-1111.197) -- 0:00:06
964500 -- (-1125.260) [-1116.294] (-1126.032) (-1114.017) * (-1119.468) [-1110.655] (-1112.467) (-1115.089) -- 0:00:06
965000 -- (-1117.811) (-1117.335) [-1120.952] (-1113.709) * (-1115.751) (-1125.387) [-1120.476] (-1113.841) -- 0:00:06
Average standard deviation of split frequencies: 0.004067
965500 -- (-1118.717) [-1115.790] (-1112.205) (-1115.065) * [-1112.075] (-1117.158) (-1110.184) (-1117.439) -- 0:00:06
966000 -- [-1112.116] (-1112.556) (-1111.467) (-1122.257) * (-1109.910) (-1123.825) (-1119.114) [-1114.187] -- 0:00:06
966500 -- (-1116.052) (-1111.355) (-1114.779) [-1112.531] * (-1111.579) (-1120.508) (-1113.648) [-1114.492] -- 0:00:06
967000 -- (-1122.443) (-1111.138) [-1114.397] (-1111.161) * (-1109.263) (-1116.347) [-1113.296] (-1125.133) -- 0:00:06
967500 -- (-1120.438) (-1113.123) [-1113.418] (-1113.657) * [-1109.909] (-1114.804) (-1113.508) (-1118.733) -- 0:00:06
968000 -- (-1120.202) (-1112.029) [-1112.498] (-1114.474) * (-1114.748) (-1115.375) [-1113.906] (-1122.327) -- 0:00:06
968500 -- [-1113.153] (-1112.624) (-1113.295) (-1116.723) * [-1109.354] (-1112.178) (-1118.545) (-1111.896) -- 0:00:06
969000 -- (-1121.875) (-1111.282) (-1113.021) [-1118.275] * (-1118.085) (-1115.504) (-1120.568) [-1113.674] -- 0:00:05
969500 -- [-1114.608] (-1110.942) (-1109.921) (-1118.323) * [-1113.917] (-1119.868) (-1115.262) (-1120.019) -- 0:00:05
970000 -- [-1114.333] (-1114.437) (-1111.714) (-1121.127) * (-1116.115) [-1115.173] (-1106.745) (-1119.284) -- 0:00:05
Average standard deviation of split frequencies: 0.003723
970500 -- (-1113.981) [-1111.336] (-1110.828) (-1109.473) * (-1111.792) (-1114.081) [-1115.560] (-1116.543) -- 0:00:05
971000 -- (-1115.449) (-1117.711) (-1112.443) [-1120.865] * (-1122.908) (-1117.984) (-1112.384) [-1115.096] -- 0:00:05
971500 -- (-1112.942) (-1118.381) (-1113.110) [-1115.247] * [-1116.958] (-1112.803) (-1111.216) (-1127.230) -- 0:00:05
972000 -- (-1117.033) [-1108.614] (-1116.342) (-1117.216) * (-1118.736) (-1111.800) (-1124.291) [-1114.056] -- 0:00:05
972500 -- (-1117.468) (-1116.297) [-1112.713] (-1113.925) * (-1113.469) [-1107.808] (-1116.848) (-1114.133) -- 0:00:05
973000 -- (-1115.606) (-1119.416) (-1122.805) [-1114.714] * (-1116.037) [-1113.522] (-1115.949) (-1120.154) -- 0:00:05
973500 -- (-1118.007) [-1113.396] (-1118.536) (-1116.293) * [-1110.116] (-1113.753) (-1120.128) (-1116.280) -- 0:00:05
974000 -- (-1114.486) [-1116.818] (-1121.664) (-1111.590) * [-1113.657] (-1118.758) (-1112.215) (-1110.355) -- 0:00:04
974500 -- (-1110.282) (-1116.334) [-1113.588] (-1117.632) * (-1112.357) [-1116.535] (-1114.807) (-1109.138) -- 0:00:04
975000 -- (-1115.359) (-1111.505) (-1109.664) [-1108.524] * (-1113.837) [-1118.793] (-1116.157) (-1110.654) -- 0:00:04
Average standard deviation of split frequencies: 0.003703
975500 -- (-1111.431) (-1118.717) (-1109.922) [-1109.204] * [-1119.568] (-1124.095) (-1114.596) (-1117.756) -- 0:00:04
976000 -- (-1120.939) [-1113.064] (-1112.863) (-1113.277) * (-1113.536) (-1112.853) (-1117.710) [-1107.556] -- 0:00:04
976500 -- (-1110.444) (-1115.450) (-1116.787) [-1112.029] * [-1114.377] (-1113.494) (-1127.089) (-1107.823) -- 0:00:04
977000 -- [-1116.848] (-1116.863) (-1114.670) (-1120.172) * (-1118.500) (-1114.865) (-1117.144) [-1108.651] -- 0:00:04
977500 -- (-1124.642) [-1114.601] (-1111.784) (-1109.516) * (-1117.241) (-1121.084) (-1112.858) [-1112.341] -- 0:00:04
978000 -- (-1121.144) (-1117.474) (-1121.400) [-1110.074] * (-1114.446) (-1115.808) [-1116.635] (-1108.810) -- 0:00:04
978500 -- (-1125.403) [-1113.033] (-1114.108) (-1115.180) * [-1112.558] (-1109.194) (-1125.723) (-1114.129) -- 0:00:04
979000 -- (-1122.375) (-1114.999) [-1112.544] (-1118.191) * [-1114.782] (-1115.546) (-1116.304) (-1122.110) -- 0:00:04
979500 -- [-1110.693] (-1118.851) (-1107.338) (-1119.066) * [-1107.755] (-1114.172) (-1124.566) (-1115.354) -- 0:00:03
980000 -- (-1115.275) (-1125.989) (-1112.676) [-1114.572] * (-1111.692) [-1111.638] (-1114.239) (-1119.643) -- 0:00:03
Average standard deviation of split frequencies: 0.003365
980500 -- [-1114.563] (-1116.014) (-1114.838) (-1113.806) * [-1109.408] (-1115.932) (-1118.347) (-1119.786) -- 0:00:03
981000 -- (-1119.102) (-1127.308) [-1111.483] (-1112.308) * [-1113.757] (-1118.949) (-1118.346) (-1115.916) -- 0:00:03
981500 -- (-1114.254) [-1119.274] (-1118.478) (-1113.554) * (-1111.637) (-1128.405) [-1114.061] (-1122.349) -- 0:00:03
982000 -- (-1118.785) (-1110.890) (-1119.838) [-1120.126] * (-1117.074) (-1116.953) (-1114.755) [-1115.756] -- 0:00:03
982500 -- [-1111.277] (-1113.651) (-1120.173) (-1120.817) * (-1114.767) (-1119.801) [-1114.351] (-1118.733) -- 0:00:03
983000 -- [-1117.251] (-1115.885) (-1121.521) (-1120.498) * (-1115.667) (-1118.319) (-1117.036) [-1113.405] -- 0:00:03
983500 -- [-1111.020] (-1115.263) (-1117.043) (-1115.855) * (-1122.859) (-1114.591) (-1112.988) [-1116.939] -- 0:00:03
984000 -- [-1110.653] (-1118.797) (-1127.216) (-1113.695) * (-1117.308) (-1119.731) (-1115.589) [-1121.075] -- 0:00:03
984500 -- [-1111.656] (-1114.910) (-1120.237) (-1108.830) * [-1111.613] (-1119.580) (-1107.968) (-1116.429) -- 0:00:02
985000 -- [-1117.545] (-1115.830) (-1112.977) (-1117.196) * [-1115.573] (-1117.663) (-1121.379) (-1119.220) -- 0:00:02
Average standard deviation of split frequencies: 0.003187
985500 -- (-1125.120) (-1119.145) [-1109.569] (-1112.508) * [-1118.464] (-1114.733) (-1111.546) (-1121.729) -- 0:00:02
986000 -- (-1117.479) (-1111.903) [-1113.766] (-1113.505) * (-1114.545) (-1116.685) (-1118.802) [-1119.858] -- 0:00:02
986500 -- (-1119.095) (-1114.294) [-1114.423] (-1120.173) * [-1110.837] (-1114.667) (-1118.081) (-1116.849) -- 0:00:02
987000 -- (-1117.707) (-1114.173) [-1112.673] (-1115.392) * (-1110.832) [-1117.462] (-1122.382) (-1119.325) -- 0:00:02
987500 -- (-1119.579) [-1112.044] (-1111.871) (-1122.646) * (-1117.037) [-1110.400] (-1109.933) (-1125.013) -- 0:00:02
988000 -- (-1121.404) [-1112.370] (-1116.223) (-1123.678) * (-1127.935) [-1108.822] (-1110.272) (-1134.227) -- 0:00:02
988500 -- (-1126.620) (-1116.863) [-1112.945] (-1115.714) * (-1113.073) (-1116.421) (-1109.072) [-1113.742] -- 0:00:02
989000 -- (-1117.856) (-1113.603) [-1117.911] (-1120.420) * (-1114.357) (-1125.497) (-1112.263) [-1110.587] -- 0:00:02
989500 -- (-1120.240) (-1127.849) (-1113.386) [-1118.859] * (-1116.999) (-1113.551) [-1116.540] (-1110.617) -- 0:00:02
990000 -- (-1111.715) (-1113.127) (-1121.893) [-1114.434] * (-1115.628) [-1114.865] (-1117.635) (-1124.525) -- 0:00:01
Average standard deviation of split frequencies: 0.003172
990500 -- (-1113.662) [-1112.964] (-1117.809) (-1115.744) * (-1121.910) (-1115.706) (-1116.224) [-1114.170] -- 0:00:01
991000 -- (-1113.457) (-1115.218) [-1113.212] (-1114.690) * (-1115.563) [-1111.214] (-1118.793) (-1112.435) -- 0:00:01
991500 -- (-1117.361) (-1112.163) (-1120.020) [-1114.046] * [-1115.561] (-1111.050) (-1120.349) (-1123.802) -- 0:00:01
992000 -- (-1113.194) (-1118.921) [-1116.248] (-1112.346) * (-1116.893) [-1110.387] (-1117.689) (-1109.812) -- 0:00:01
992500 -- [-1111.347] (-1117.349) (-1119.722) (-1119.797) * (-1116.269) (-1109.428) (-1115.995) [-1111.877] -- 0:00:01
993000 -- (-1118.754) (-1113.793) [-1111.134] (-1120.837) * (-1115.831) [-1110.524] (-1112.788) (-1120.418) -- 0:00:01
993500 -- [-1113.387] (-1114.652) (-1115.586) (-1125.713) * (-1113.671) [-1115.799] (-1122.438) (-1110.660) -- 0:00:01
994000 -- (-1118.427) (-1115.989) (-1116.988) [-1113.905] * (-1113.583) (-1117.445) (-1120.736) [-1115.067] -- 0:00:01
994500 -- (-1126.525) (-1116.447) (-1121.873) [-1112.105] * (-1115.109) (-1121.308) [-1115.378] (-1116.135) -- 0:00:01
995000 -- (-1118.141) (-1116.245) [-1118.188] (-1112.973) * [-1116.413] (-1114.177) (-1114.113) (-1120.860) -- 0:00:00
Average standard deviation of split frequencies: 0.002682
995500 -- [-1118.590] (-1121.156) (-1119.092) (-1111.259) * (-1119.474) (-1128.023) [-1113.628] (-1110.616) -- 0:00:00
996000 -- (-1114.264) (-1109.981) (-1117.677) [-1120.783] * (-1112.819) (-1115.362) [-1120.101] (-1110.510) -- 0:00:00
996500 -- (-1112.741) [-1115.540] (-1115.101) (-1114.020) * (-1118.882) (-1113.710) (-1122.853) [-1111.949] -- 0:00:00
997000 -- (-1114.633) (-1116.474) (-1115.723) [-1116.873] * [-1109.905] (-1116.815) (-1113.005) (-1111.489) -- 0:00:00
997500 -- (-1113.326) (-1115.897) [-1112.759] (-1119.499) * (-1119.902) [-1114.946] (-1116.250) (-1113.805) -- 0:00:00
998000 -- (-1127.499) [-1116.243] (-1113.082) (-1111.895) * [-1117.282] (-1114.435) (-1123.597) (-1120.851) -- 0:00:00
998500 -- (-1115.489) (-1110.622) (-1111.488) [-1113.607] * (-1115.427) [-1111.164] (-1125.485) (-1118.240) -- 0:00:00
999000 -- (-1109.600) [-1114.290] (-1116.708) (-1122.239) * (-1117.691) [-1113.884] (-1115.860) (-1120.324) -- 0:00:00
999500 -- (-1111.614) [-1108.996] (-1118.767) (-1118.143) * (-1111.677) (-1112.956) (-1131.346) [-1119.703] -- 0:00:00
1000000 -- (-1115.216) [-1111.570] (-1123.152) (-1116.508) * (-1116.461) [-1112.833] (-1115.101) (-1108.896) -- 0:00:00
Average standard deviation of split frequencies: 0.002355
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1115.215537 -- 14.900256
Chain 1 -- -1115.215537 -- 14.900256
Chain 2 -- -1111.570209 -- 12.868720
Chain 2 -- -1111.570209 -- 12.868720
Chain 3 -- -1123.151775 -- 15.534558
Chain 3 -- -1123.151775 -- 15.534558
Chain 4 -- -1116.508151 -- 12.179389
Chain 4 -- -1116.508151 -- 12.179389
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1116.460643 -- 11.241330
Chain 1 -- -1116.460644 -- 11.241330
Chain 2 -- -1112.832629 -- 15.646682
Chain 2 -- -1112.832629 -- 15.646682
Chain 3 -- -1115.100674 -- 15.951925
Chain 3 -- -1115.100679 -- 15.951925
Chain 4 -- -1108.895540 -- 11.249257
Chain 4 -- -1108.895536 -- 11.249257
Analysis completed in 3 mins 11 seconds
Analysis used 190.61 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1103.74
Likelihood of best state for "cold" chain of run 2 was -1103.74
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
58.2 % ( 41 %) Dirichlet(Revmat{all})
72.9 % ( 66 %) Slider(Revmat{all})
30.1 % ( 33 %) Dirichlet(Pi{all})
31.2 % ( 21 %) Slider(Pi{all})
48.1 % ( 32 %) Multiplier(Alpha{1,2})
48.0 % ( 20 %) Multiplier(Alpha{3})
62.1 % ( 32 %) Slider(Pinvar{all})
2.3 % ( 0 %) ExtSPR(Tau{all},V{all})
1.3 % ( 1 %) ExtTBR(Tau{all},V{all})
4.0 % ( 4 %) NNI(Tau{all},V{all})
5.3 % ( 2 %) ParsSPR(Tau{all},V{all})
26.5 % ( 33 %) Multiplier(V{all})
42.1 % ( 50 %) Nodeslider(V{all})
26.0 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
58.9 % ( 49 %) Dirichlet(Revmat{all})
72.9 % ( 54 %) Slider(Revmat{all})
30.0 % ( 25 %) Dirichlet(Pi{all})
31.1 % ( 24 %) Slider(Pi{all})
47.1 % ( 31 %) Multiplier(Alpha{1,2})
47.7 % ( 26 %) Multiplier(Alpha{3})
62.5 % ( 33 %) Slider(Pinvar{all})
2.3 % ( 1 %) ExtSPR(Tau{all},V{all})
1.3 % ( 0 %) ExtTBR(Tau{all},V{all})
4.1 % ( 9 %) NNI(Tau{all},V{all})
5.3 % ( 5 %) ParsSPR(Tau{all},V{all})
26.6 % ( 28 %) Multiplier(V{all})
42.3 % ( 43 %) Nodeslider(V{all})
26.3 % ( 15 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166025 0.82 0.67
3 | 166426 166571 0.83
4 | 166797 167492 166689
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 165979 0.82 0.66
3 | 166539 167203 0.83
4 | 166501 166908 166870
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1112.18
| 1 |
| 2 1 2 |
| 1 2 |
| 2 2 |
| 2 1 11 2 2 2 2 2 1 * 1* 1 |
|2 2 1* 2 2 2 1 |
| 2 2 2 2 *1 2 2 2 2 1 2|
| 11 2 111 2 1 1 2 1 2 2 11 2 |
| 2 1 1 22 2 1 11 1 1 * 2* 2 |
| 11 *2 21 1 1 2 121 1 2 22 1 1 1|
| 2 2 2 2 1 1 |
|1 1 1 12 1 |
| 1 2 |
| 1 2 1 |
| 1 * 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1115.78
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1110.56 -1122.48
2 -1110.39 -1119.91
--------------------------------------
TOTAL -1110.47 -1121.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.594192 0.014355 0.370684 0.816880 0.577600 846.10 982.31 1.000
r(A<->C){all} 0.066901 0.001130 0.007743 0.131574 0.063217 596.73 665.19 1.000
r(A<->G){all} 0.114560 0.001481 0.050063 0.196252 0.109525 570.93 694.39 1.000
r(A<->T){all} 0.143289 0.002627 0.047122 0.243359 0.138426 763.70 791.44 1.000
r(C<->G){all} 0.073510 0.000811 0.022915 0.129814 0.070676 772.72 886.10 1.000
r(C<->T){all} 0.541517 0.005377 0.392300 0.674869 0.542034 580.82 591.67 1.000
r(G<->T){all} 0.060224 0.000896 0.005079 0.118287 0.056525 853.26 932.66 1.000
pi(A){all} 0.256444 0.000388 0.216810 0.294496 0.255909 891.48 1055.47 1.000
pi(C){all} 0.234852 0.000332 0.198324 0.269051 0.234726 999.41 1154.48 1.001
pi(G){all} 0.316632 0.000435 0.276391 0.356971 0.316422 1237.77 1278.29 1.000
pi(T){all} 0.192072 0.000288 0.158985 0.225398 0.191393 1237.59 1274.76 1.000
alpha{1,2} 0.098261 0.002036 0.002442 0.170310 0.100684 1203.31 1352.15 1.000
alpha{3} 1.986478 0.617666 0.634869 3.552134 1.848621 1501.00 1501.00 1.000
pinvar{all} 0.382179 0.010600 0.168103 0.565538 0.393649 1018.70 1095.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...***
8 -- ...*.*
9 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 2959 0.985676 0.000471 0.985343 0.986009 2
8 2890 0.962692 0.000942 0.962025 0.963358 2
9 2772 0.923384 0.005653 0.919387 0.927382 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.044092 0.000284 0.014378 0.076360 0.041838 1.000 2
length{all}[2] 0.010601 0.000046 0.000097 0.023429 0.009269 1.000 2
length{all}[3] 0.016310 0.000075 0.003120 0.033969 0.014911 1.000 2
length{all}[4] 0.017400 0.000252 0.000002 0.048664 0.012849 1.000 2
length{all}[5] 0.088159 0.000821 0.039804 0.145799 0.084798 1.000 2
length{all}[6] 0.305452 0.007218 0.171888 0.487632 0.293839 1.000 2
length{all}[7] 0.047629 0.000430 0.009761 0.088417 0.044747 1.000 2
length{all}[8] 0.047107 0.000410 0.008330 0.084313 0.044931 1.000 2
length{all}[9] 0.019106 0.000121 0.001266 0.040118 0.017483 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.002355
Maximum standard deviation of split frequencies = 0.005653
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C4 (4)
| /-----------96----------+
| | \------------------------ C6 (6)
+-----------99----------+
| \------------------------------------------------ C5 (5)
|
| /------------------------ C2 (2)
\-----------------------92----------------------+
\------------------------ C3 (3)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
| /-- C4 (4)
| /--------+
| | \------------------------------------------------------- C6 (6)
+-------+
| \---------------- C5 (5)
|
| /-- C2 (2)
\--+
\--- C3 (3)
|--------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 3 trees
99 % credible set contains 7 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 6 ls = 444
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
96 patterns at 148 / 148 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
93696 bytes for conP
13056 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 6), 5), (2, 3)); MP score: 103
187392 bytes for conP, adjusted
0.085855 0.064900 0.074464 0.021989 0.388520 0.168552 0.023128 0.024926 0.017525 0.300000 1.300000
ntime & nrate & np: 9 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 11
lnL0 = -1197.908332
Iterating by ming2
Initial: fx= 1197.908332
x= 0.08585 0.06490 0.07446 0.02199 0.38852 0.16855 0.02313 0.02493 0.01752 0.30000 1.30000
1 h-m-p 0.0000 0.0007 164.7878 +++YCYYCCC 1190.455316 6 0.0005 29 | 0/11
2 h-m-p 0.0002 0.0011 526.8086 +YCCC 1179.969662 3 0.0005 49 | 0/11
3 h-m-p 0.0004 0.0019 464.9238 +YYCCCC 1156.775702 5 0.0012 72 | 0/11
4 h-m-p 0.0001 0.0005 787.9262 +YCYYYCC 1133.473087 6 0.0004 95 | 0/11
5 h-m-p 0.0000 0.0002 3287.1150 +CYYYYC 1105.763271 5 0.0002 116 | 0/11
6 h-m-p 0.0002 0.0008 732.2976 +YYYCCYCCC 1052.345672 8 0.0007 144 | 0/11
7 h-m-p 0.0001 0.0003 161.3880 YYYC 1051.998200 3 0.0001 161 | 0/11
8 h-m-p 0.0002 0.0096 49.3158 ++CYC 1049.627866 2 0.0029 180 | 0/11
9 h-m-p 0.0015 0.0075 28.4587 YCCC 1049.455317 3 0.0006 199 | 0/11
10 h-m-p 0.0011 0.0055 8.4574 CCCC 1049.392589 3 0.0013 219 | 0/11
11 h-m-p 0.0120 0.2138 0.8912 ++YYCCC 1044.859191 4 0.1819 241 | 0/11
12 h-m-p 0.0010 0.0048 74.3129 +YYCYCCC 1034.711683 6 0.0034 276 | 0/11
13 h-m-p 0.1724 0.8620 0.4338 +YYYYCC 1025.409748 5 0.6823 297 | 0/11
14 h-m-p 0.1915 0.9575 0.4013 +CYC 1018.400634 2 0.7321 326 | 0/11
15 h-m-p 0.5934 2.9671 0.0943 CYCC 1016.479146 3 0.6376 356 | 0/11
16 h-m-p 0.1800 0.8999 0.1767 ++ 1014.850528 m 0.8999 381 | 1/11
17 h-m-p 1.6000 8.0000 0.0284 CCC 1014.413781 2 1.7291 410 | 1/11
18 h-m-p 0.4704 7.1379 0.1042 CCC 1014.291028 2 0.6808 438 | 1/11
19 h-m-p 1.1830 8.0000 0.0600 CCC 1014.183498 2 1.2821 466 | 1/11
20 h-m-p 1.6000 8.0000 0.0313 CC 1014.074955 1 1.5816 492 | 1/11
21 h-m-p 1.6000 8.0000 0.0077 C 1014.063519 0 1.6000 516 | 1/11
22 h-m-p 1.6000 8.0000 0.0035 CC 1014.052865 1 2.1151 542 | 1/11
23 h-m-p 1.3415 8.0000 0.0055 CC 1014.051073 1 1.1911 568 | 1/11
24 h-m-p 1.6000 8.0000 0.0020 CC 1014.050064 1 2.4518 594 | 1/11
25 h-m-p 1.6000 8.0000 0.0019 YC 1014.049910 1 1.2537 619 | 1/11
26 h-m-p 1.6000 8.0000 0.0001 ++ 1014.049693 m 8.0000 643 | 1/11
27 h-m-p 1.6000 8.0000 0.0001 Y 1014.049670 0 1.1924 667 | 1/11
28 h-m-p 1.6000 8.0000 0.0001 C 1014.049667 0 1.9830 691 | 1/11
29 h-m-p 1.6000 8.0000 0.0000 Y 1014.049667 0 3.0205 715 | 1/11
30 h-m-p 1.6000 8.0000 0.0000 C 1014.049666 0 2.3251 739 | 1/11
31 h-m-p 1.6000 8.0000 0.0000 Y 1014.049666 0 0.9511 763 | 1/11
32 h-m-p 1.6000 8.0000 0.0000 C 1014.049666 0 0.4000 787 | 1/11
33 h-m-p 0.6571 8.0000 0.0000 ---------------Y 1014.049666 0 0.0000 826
Out..
lnL = -1014.049666
827 lfun, 827 eigenQcodon, 7443 P(t)
Time used: 0:03
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 6), 5), (2, 3)); MP score: 103
0.085855 0.064900 0.074464 0.021989 0.388520 0.168552 0.023128 0.024926 0.017525 0.961168 0.747245 0.296991
ntime & nrate & np: 9 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.389907
np = 12
lnL0 = -1087.791122
Iterating by ming2
Initial: fx= 1087.791122
x= 0.08585 0.06490 0.07446 0.02199 0.38852 0.16855 0.02313 0.02493 0.01752 0.96117 0.74724 0.29699
1 h-m-p 0.0000 0.0013 179.5332 ++++ 1059.118489 m 0.0013 19 | 0/12
2 h-m-p 0.0000 0.0000 10190.8745 +YYYYCCCCC 1036.548194 8 0.0000 47 | 0/12
3 h-m-p 0.0000 0.0002 136.7829 +CYC 1035.468921 2 0.0001 66 | 0/12
4 h-m-p 0.0001 0.0003 218.0572 ++ 1031.852920 m 0.0003 81 | 1/12
5 h-m-p 0.0000 0.0002 58.8411 ++ 1031.523079 m 0.0002 96 | 2/12
6 h-m-p 0.0005 0.0161 20.2271 +YC 1030.833930 1 0.0039 113 | 2/12
7 h-m-p 0.0031 0.0172 25.8530 YCCC 1030.492800 3 0.0021 133 | 2/12
8 h-m-p 0.0036 0.0298 15.4460 CCC 1030.263762 2 0.0032 152 | 2/12
9 h-m-p 0.0013 0.0066 12.7673 ++ 1029.700554 m 0.0066 167 | 2/12
10 h-m-p 0.0000 0.0000 42.2533
h-m-p: 2.92768453e-20 1.46384226e-19 4.22533052e+01 1029.700554
.. | 2/12
11 h-m-p 0.0000 0.0018 155.8965 ++YCCCC 1028.565192 4 0.0001 203 | 2/12
12 h-m-p 0.0001 0.0009 191.0286 +YCYYCCC 1019.733392 6 0.0007 229 | 2/12
13 h-m-p 0.0001 0.0004 165.9733 YCYCCC 1018.243375 5 0.0002 252 | 2/12
14 h-m-p 0.0001 0.0004 217.2917 +YCYCCC 1015.999303 5 0.0003 276 | 2/12
15 h-m-p 0.0039 0.0204 14.1841 CCC 1015.922742 2 0.0008 295 | 2/12
16 h-m-p 0.0014 0.0377 8.4507 YC 1015.821602 1 0.0033 311 | 2/12
17 h-m-p 0.0014 0.0708 20.0816 YC 1015.619753 1 0.0034 327 | 2/12
18 h-m-p 0.0055 0.0333 12.6402 YCCC 1015.507955 3 0.0033 347 | 2/12
19 h-m-p 0.0079 0.2113 5.2675 +CCCC 1015.126418 3 0.0333 369 | 2/12
20 h-m-p 0.0056 0.0278 20.9496 CC 1015.070449 1 0.0014 386 | 2/12
21 h-m-p 0.1112 0.7492 0.2629 +YYCCC 1014.413138 4 0.3322 408 | 2/12
22 h-m-p 1.6000 8.0000 0.0096 YYCC 1014.070517 3 1.3916 437 | 2/12
23 h-m-p 1.4034 8.0000 0.0095 YC 1014.054435 1 0.6803 463 | 2/12
24 h-m-p 1.0113 8.0000 0.0064 CC 1014.051680 1 0.8575 490 | 2/12
25 h-m-p 1.6000 8.0000 0.0016 YC 1014.050392 1 0.8940 516 | 2/12
26 h-m-p 0.9321 8.0000 0.0016 C 1014.050258 0 1.0559 541 | 2/12
27 h-m-p 1.6000 8.0000 0.0001 Y 1014.050256 0 0.9600 566 | 2/12
28 h-m-p 1.6000 8.0000 0.0000 Y 1014.050256 0 1.1288 591 | 2/12
29 h-m-p 1.6000 8.0000 0.0000 Y 1014.050256 0 1.0824 616 | 2/12
30 h-m-p 1.6000 8.0000 0.0000 C 1014.050256 0 0.4840 641 | 2/12
31 h-m-p 0.9915 8.0000 0.0000 --------Y 1014.050256 0 0.0000 674
Out..
lnL = -1014.050256
675 lfun, 2025 eigenQcodon, 12150 P(t)
Time used: 0:07
Model 2: PositiveSelection
TREE # 1
(1, ((4, 6), 5), (2, 3)); MP score: 103
initial w for M2:NSpselection reset.
0.085855 0.064900 0.074464 0.021989 0.388520 0.168552 0.023128 0.024926 0.017525 0.961183 0.896732 0.199894 0.157918 2.073080
ntime & nrate & np: 9 3 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.506226
np = 14
lnL0 = -1107.745821
Iterating by ming2
Initial: fx= 1107.745821
x= 0.08585 0.06490 0.07446 0.02199 0.38852 0.16855 0.02313 0.02493 0.01752 0.96118 0.89673 0.19989 0.15792 2.07308
1 h-m-p 0.0000 0.0020 174.2067 ++++ 1091.190157 m 0.0020 21 | 1/14
2 h-m-p 0.0007 0.0035 82.6711 ++ 1079.193112 m 0.0035 38 | 1/14
3 h-m-p 0.0002 0.0019 1397.7470 CYCCC 1070.900067 4 0.0003 62 | 1/14
4 h-m-p 0.0007 0.0037 40.0086 ++ 1066.974248 m 0.0037 79 | 1/14
5 h-m-p 0.0000 0.0000 46193.9891 +YCCCC 1058.246531 4 0.0000 104 | 1/14
6 h-m-p 0.0025 0.0123 55.5961 CCCC 1055.575216 3 0.0033 127 | 1/14
7 h-m-p 0.0059 0.0322 31.4525 YCCCC 1050.919790 4 0.0145 151 | 1/14
8 h-m-p 0.0038 0.0188 47.9587 YCCC 1048.366324 3 0.0068 173 | 1/14
9 h-m-p 0.0333 0.1665 7.0438 CCCCC 1046.679029 4 0.0386 198 | 1/14
10 h-m-p 0.0082 0.0412 29.8194 CCCCC 1044.702598 4 0.0104 223 | 1/14
11 h-m-p 0.0145 0.0724 10.7618 +YCYCCC 1041.936394 5 0.0419 249 | 0/14
12 h-m-p 0.0048 0.0242 43.6006 YCCC 1040.450323 3 0.0086 271 | 0/14
13 h-m-p 0.0022 0.0112 106.0425 +YYCYCCC 1035.748474 6 0.0075 298 | 0/14
14 h-m-p 0.0227 0.1135 18.3297 +YCYCCC 1030.286981 5 0.0700 324 | 0/14
15 h-m-p 0.0189 0.0945 7.9071 YCCCC 1028.436162 4 0.0468 348 | 0/14
16 h-m-p 0.0449 0.2244 7.7487 +YCCC 1023.519849 3 0.1434 371 | 0/14
17 h-m-p 0.0384 0.1919 0.5895 ++ 1021.919806 m 0.1919 388 | 1/14
18 h-m-p 0.0609 0.7140 1.8470 +YCYCCCCC 1018.274883 7 0.3313 432 | 0/14
19 h-m-p 0.0117 0.0584 14.2558 -YCCC 1018.238554 3 0.0012 455 | 0/14
20 h-m-p 0.0143 0.2544 1.1839 +++ 1017.625503 m 0.2544 473 | 1/14
21 h-m-p 0.3006 3.4261 1.0017 +YYYCCCC 1016.417342 6 1.2534 500 | 1/14
22 h-m-p 1.3437 6.7184 0.5109 CYC 1015.864770 2 1.1953 520 | 1/14
23 h-m-p 1.0813 6.6596 0.5648 YYYC 1015.269980 3 1.0348 553 | 1/14
24 h-m-p 1.5401 8.0000 0.3795 CYC 1015.034405 2 1.5559 586 | 1/14
25 h-m-p 0.5217 3.9512 1.1318 YYC 1014.888923 2 0.4468 618 | 1/14
26 h-m-p 0.4312 6.2328 1.1726 +YCC 1014.565618 2 1.2034 639 | 1/14
27 h-m-p 1.6000 8.0000 0.6940 CYC 1014.294945 2 1.8471 659 | 1/14
28 h-m-p 1.5556 8.0000 0.8241 YYC 1014.165711 2 1.2971 691 | 1/14
29 h-m-p 1.6000 8.0000 0.4278 YCC 1014.135344 2 1.2294 724 | 1/14
30 h-m-p 1.5609 8.0000 0.3369 CCC 1014.113277 2 1.9057 758 | 1/14
31 h-m-p 1.0594 8.0000 0.6061 YC 1014.083122 1 2.5542 789 | 1/14
32 h-m-p 1.6000 8.0000 0.7678 CYC 1014.064007 2 2.1063 822 | 1/14
33 h-m-p 1.6000 8.0000 0.8880 CY 1014.057367 1 1.6875 854 | 1/14
34 h-m-p 1.6000 8.0000 0.8912 C 1014.053676 0 1.5844 884 | 1/14
35 h-m-p 1.6000 8.0000 0.8669 CY 1014.051477 1 1.7841 916 | 1/14
36 h-m-p 1.6000 8.0000 0.8468 CY 1014.050524 1 1.9896 948 | 1/14
37 h-m-p 1.6000 8.0000 0.8663 CC 1014.050011 1 2.2449 980 | 1/14
38 h-m-p 1.6000 8.0000 0.7994 YC 1014.049801 1 2.5133 1011 | 1/14
39 h-m-p 1.6000 8.0000 0.7839 C 1014.049723 0 2.4781 1041 | 1/14
40 h-m-p 1.6000 8.0000 0.7217 C 1014.049691 0 2.3715 1071 | 1/14
41 h-m-p 1.6000 8.0000 0.7738 C 1014.049676 0 2.5381 1101 | 1/14
42 h-m-p 1.6000 8.0000 0.7471 C 1014.049670 0 2.3219 1131 | 1/14
43 h-m-p 1.6000 8.0000 0.7536 Y 1014.049668 0 2.7180 1161 | 1/14
44 h-m-p 1.6000 8.0000 0.7487 C 1014.049667 0 2.3284 1191 | 1/14
45 h-m-p 1.6000 8.0000 0.7481 Y 1014.049666 0 2.8258 1221 | 1/14
46 h-m-p 1.6000 8.0000 0.7439 C 1014.049666 0 2.3047 1251 | 1/14
47 h-m-p 1.6000 8.0000 0.7580 Y 1014.049666 0 2.9270 1281 | 1/14
48 h-m-p 1.6000 8.0000 0.7229 C 1014.049666 0 2.1835 1311 | 1/14
49 h-m-p 1.6000 8.0000 0.8178 Y 1014.049666 0 3.4438 1341 | 1/14
50 h-m-p 1.6000 8.0000 0.7167 C 1014.049666 0 1.8132 1371 | 1/14
51 h-m-p 1.6000 8.0000 0.6358 Y 1014.049666 0 3.8977 1401 | 1/14
52 h-m-p 1.6000 8.0000 0.1197 Y 1014.049666 0 1.2279 1431 | 1/14
53 h-m-p 0.1945 8.0000 0.7558 ++Y 1014.049666 0 2.4126 1463 | 1/14
54 h-m-p 1.6000 8.0000 0.7092 C 1014.049666 0 0.6312 1493 | 1/14
55 h-m-p 1.2042 8.0000 0.3717 C 1014.049666 0 1.2174 1523 | 1/14
56 h-m-p 1.6000 8.0000 0.1623 C 1014.049666 0 2.0714 1553 | 1/14
57 h-m-p 0.2001 8.0000 1.6803 C 1014.049666 0 0.2555 1583 | 1/14
58 h-m-p 1.0282 8.0000 0.4175 C 1014.049666 0 0.3283 1600 | 1/14
59 h-m-p 1.6000 8.0000 0.0023 C 1014.049666 0 2.0172 1630 | 1/14
60 h-m-p 0.2755 8.0000 0.0165 ++Y 1014.049666 0 2.9182 1662 | 1/14
61 h-m-p 1.5757 8.0000 0.0306 Y 1014.049666 0 0.3939 1692 | 1/14
62 h-m-p 1.0016 8.0000 0.0120 ----------------.. | 1/14
63 h-m-p 0.0160 8.0000 0.0005 -----C 1014.049666 0 0.0000 1771 | 1/14
64 h-m-p 0.0160 8.0000 0.0002 -------------.. | 1/14
65 h-m-p 0.0160 8.0000 0.0005 ------------- | 1/14
66 h-m-p 0.0160 8.0000 0.0005 -------------
Out..
lnL = -1014.049666
1895 lfun, 7580 eigenQcodon, 51165 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1033.156074 S = -998.976065 -26.803282
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 96 patterns 0:23
did 20 / 96 patterns 0:24
did 30 / 96 patterns 0:24
did 40 / 96 patterns 0:24
did 50 / 96 patterns 0:24
did 60 / 96 patterns 0:24
did 70 / 96 patterns 0:24
did 80 / 96 patterns 0:24
did 90 / 96 patterns 0:24
did 96 / 96 patterns 0:24
Time used: 0:24
Model 3: discrete
TREE # 1
(1, ((4, 6), 5), (2, 3)); MP score: 103
0.085855 0.064900 0.074464 0.021989 0.388520 0.168552 0.023128 0.024926 0.017525 0.961168 0.215184 0.509770 0.014367 0.035989 0.052154
ntime & nrate & np: 9 4 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 25.020776
np = 15
lnL0 = -1017.900805
Iterating by ming2
Initial: fx= 1017.900805
x= 0.08585 0.06490 0.07446 0.02199 0.38852 0.16855 0.02313 0.02493 0.01752 0.96117 0.21518 0.50977 0.01437 0.03599 0.05215
1 h-m-p 0.0000 0.0007 114.5872 ++YCYCC 1016.293806 4 0.0003 43 | 0/15
2 h-m-p 0.0000 0.0002 62.4298 ++ 1015.637979 m 0.0002 76 | 1/15
3 h-m-p 0.0001 0.0006 152.2508 +YCCC 1015.010501 3 0.0002 115 | 1/15
4 h-m-p 0.0001 0.0006 51.2293 ++ 1014.364510 m 0.0006 147 | 1/15
5 h-m-p 0.0000 0.0000 69.3551
h-m-p: 1.13010380e-19 5.65051901e-19 6.93551055e+01 1014.364510
.. | 1/15
6 h-m-p 0.0000 0.0007 55.6189 ++CYCCC 1013.834273 4 0.0003 217 | 1/15
7 h-m-p 0.0003 0.0014 32.0129 +YCCC 1013.486947 3 0.0008 255 | 1/15
8 h-m-p 0.0001 0.0005 74.0060 ++ 1013.004627 m 0.0005 287 | 2/15
9 h-m-p 0.0000 0.0002 37.0653 ++ 1012.895690 m 0.0002 319 | 2/15
10 h-m-p 0.0000 0.0000 12370.0848 YCCC 1012.781788 3 0.0000 355 | 2/15
11 h-m-p 0.0008 0.0153 22.5050 CYC 1012.650907 2 0.0008 389 | 2/15
12 h-m-p 0.0011 0.0121 17.7834 YCCC 1012.481028 3 0.0021 425 | 2/15
13 h-m-p 0.0014 0.0070 18.8825 CC 1012.382807 1 0.0014 458 | 2/15
14 h-m-p 0.0026 0.0130 5.5929 YC 1012.369803 1 0.0011 490 | 1/15
15 h-m-p 0.0008 0.4009 12.6175 CYC 1012.349310 2 0.0003 524 | 1/15
16 h-m-p 0.0038 0.2627 0.8992 CC 1012.344949 1 0.0058 558 | 1/15
17 h-m-p 0.0042 0.2005 1.2444 YC 1012.343325 1 0.0022 591 | 1/15
18 h-m-p 0.0039 0.4380 0.6929 CC 1012.342570 1 0.0034 625 | 1/15
19 h-m-p 0.0028 0.2427 0.8525 ++YC 1012.318414 1 0.1058 660 | 1/15
20 h-m-p 0.0212 0.1062 1.1723 ++ 1012.281329 m 0.1062 692 | 2/15
21 h-m-p 0.5720 8.0000 0.2175 YCC 1012.272733 2 0.4179 727 | 2/15
22 h-m-p 1.6000 8.0000 0.0357 YC 1012.267580 1 1.1144 759 | 2/15
23 h-m-p 1.6000 8.0000 0.0043 CC 1012.266971 1 1.3600 792 | 2/15
24 h-m-p 1.2292 8.0000 0.0048 +YC 1012.266679 1 3.3440 825 | 2/15
25 h-m-p 1.2218 6.1092 0.0087 ++ 1012.263901 m 6.1092 856 | 3/15
26 h-m-p 1.3628 8.0000 0.0390 YC 1012.263612 1 0.8124 888 | 3/15
27 h-m-p 1.2445 8.0000 0.0254 YC 1012.263541 1 0.5079 919 | 3/15
28 h-m-p 1.6000 8.0000 0.0019 C 1012.263531 0 1.2878 949 | 3/15
29 h-m-p 1.6000 8.0000 0.0001 Y 1012.263531 0 1.0595 979 | 3/15
30 h-m-p 1.6000 8.0000 0.0000 Y 1012.263531 0 0.9783 1009 | 3/15
31 h-m-p 1.6000 8.0000 0.0000 C 1012.263531 0 0.5036 1039 | 3/15
32 h-m-p 0.9076 8.0000 0.0000 C 1012.263531 0 0.2269 1069 | 3/15
33 h-m-p 0.4480 8.0000 0.0000 Y 1012.263531 0 0.4480 1099 | 3/15
34 h-m-p 0.5643 8.0000 0.0000 -----C 1012.263531 0 0.0001 1134
Out..
lnL = -1012.263531
1135 lfun, 4540 eigenQcodon, 30645 P(t)
Time used: 0:34
Model 7: beta
TREE # 1
(1, ((4, 6), 5), (2, 3)); MP score: 103
0.085855 0.064900 0.074464 0.021989 0.388520 0.168552 0.023128 0.024926 0.017525 0.951571 0.603915 1.022819
ntime & nrate & np: 9 1 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.055296
np = 12
lnL0 = -1071.011441
Iterating by ming2
Initial: fx= 1071.011441
x= 0.08585 0.06490 0.07446 0.02199 0.38852 0.16855 0.02313 0.02493 0.01752 0.95157 0.60392 1.02282
1 h-m-p 0.0000 0.0025 138.6901 +++CCYCC 1067.336127 4 0.0006 39 | 0/12
2 h-m-p 0.0007 0.0042 128.1069 ++ 1025.077001 m 0.0042 66 | 1/12
3 h-m-p 0.0000 0.0000 3339.2947 CYCCC 1023.073866 4 0.0000 100 | 1/12
4 h-m-p 0.0002 0.0008 78.2640 YCCCC 1022.430438 4 0.0003 133 | 1/12
5 h-m-p 0.0007 0.0090 34.6366 +CYCCCC 1020.545635 5 0.0038 169 | 1/12
6 h-m-p 0.0013 0.0068 97.5133 CCCCC 1018.571392 4 0.0018 203 | 1/12
7 h-m-p 0.0018 0.0089 55.1784 CCC 1017.710981 2 0.0017 233 | 1/12
8 h-m-p 0.0078 0.0391 9.1775 YCC 1017.484714 2 0.0057 262 | 1/12
9 h-m-p 0.0022 0.0436 23.3492 +YYCC 1016.810277 3 0.0068 293 | 1/12
10 h-m-p 0.0353 0.1961 4.4903 CCCC 1016.294685 3 0.0360 325 | 0/12
11 h-m-p 0.0018 0.0130 88.8533 CCCC 1015.804009 3 0.0019 357 | 0/12
12 h-m-p 0.0002 0.0010 50.4419 ++ 1015.542843 m 0.0010 384 | 1/12
13 h-m-p 0.0623 0.3113 0.7645 YCYCCC 1014.595090 5 0.1352 419 | 1/12
14 h-m-p 0.3285 1.6424 0.0951 CYCCC 1013.989685 4 0.5486 452 | 1/12
15 h-m-p 0.6627 4.9598 0.0787 YYC 1013.841356 2 0.5542 480 | 1/12
16 h-m-p 0.4345 8.0000 0.1004 +CYC 1013.637401 2 1.4343 510 | 1/12
17 h-m-p 1.6000 8.0000 0.0815 CCC 1013.517861 2 1.9836 540 | 1/12
18 h-m-p 1.3801 8.0000 0.1171 YCCC 1013.380078 3 2.6672 571 | 1/12
19 h-m-p 1.6000 8.0000 0.1942 CYC 1013.258884 2 1.7793 600 | 1/12
20 h-m-p 1.4554 8.0000 0.2374 +YC 1012.897502 1 4.4463 628 | 1/12
21 h-m-p 1.6000 8.0000 0.4599 CCCC 1012.593158 3 2.2264 660 | 1/12
22 h-m-p 1.6000 8.0000 0.4461 CCC 1012.512542 2 2.2070 690 | 1/12
23 h-m-p 1.6000 8.0000 0.4412 YCC 1012.471760 2 2.5880 719 | 1/12
24 h-m-p 1.6000 8.0000 0.3232 CCC 1012.461414 2 1.9191 749 | 1/12
25 h-m-p 1.6000 8.0000 0.1415 CC 1012.459427 1 2.2507 777 | 1/12
26 h-m-p 1.6000 8.0000 0.0223 +YC 1012.457490 1 4.3846 805 | 1/12
27 h-m-p 1.3326 8.0000 0.0735 C 1012.456970 0 1.3954 831 | 1/12
28 h-m-p 1.6000 8.0000 0.0305 Y 1012.456944 0 1.2744 857 | 1/12
29 h-m-p 1.6000 8.0000 0.0014 Y 1012.456943 0 1.2025 883 | 1/12
30 h-m-p 1.6000 8.0000 0.0003 Y 1012.456943 0 1.0468 909 | 1/12
31 h-m-p 1.6000 8.0000 0.0000 Y 1012.456943 0 0.9655 935 | 1/12
32 h-m-p 1.6000 8.0000 0.0000 C 1012.456943 0 1.5882 961 | 1/12
33 h-m-p 1.6000 8.0000 0.0000 C 1012.456943 0 0.3929 987 | 1/12
34 h-m-p 0.1331 8.0000 0.0000 -----Y 1012.456943 0 0.0000 1018
Out..
lnL = -1012.456943
1019 lfun, 11209 eigenQcodon, 91710 P(t)
Time used: 1:03
Model 8: beta&w>1
TREE # 1
(1, ((4, 6), 5), (2, 3)); MP score: 103
initial w for M8:NSbetaw>1 reset.
0.085855 0.064900 0.074464 0.021989 0.388520 0.168552 0.023128 0.024926 0.017525 0.951680 0.900000 0.523761 1.873198 2.941449
ntime & nrate & np: 9 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.244850
np = 14
lnL0 = -1071.871256
Iterating by ming2
Initial: fx= 1071.871256
x= 0.08585 0.06490 0.07446 0.02199 0.38852 0.16855 0.02313 0.02493 0.01752 0.95168 0.90000 0.52376 1.87320 2.94145
1 h-m-p 0.0000 0.0004 315.4774 +++ 1044.901028 m 0.0004 34 | 1/14
2 h-m-p 0.0002 0.0011 90.4658 +YYYCCCCC 1040.371739 7 0.0009 77 | 1/14
3 h-m-p 0.0001 0.0003 632.7489 ++ 1027.318172 m 0.0003 107 | 2/14
4 h-m-p 0.0000 0.0002 1220.8295 +YYCYCCC 1018.757997 6 0.0002 147 | 2/14
5 h-m-p 0.0033 0.0165 21.1185 CCCCC 1016.900396 4 0.0054 184 | 2/14
6 h-m-p 0.0011 0.0055 41.9443 YCYCCC 1015.421656 5 0.0026 221 | 2/14
7 h-m-p 0.0028 0.0141 11.4992 YCC 1015.299755 2 0.0017 253 | 2/14
8 h-m-p 0.0024 0.0223 8.0176 CYC 1015.230038 2 0.0022 285 | 2/14
9 h-m-p 0.0020 0.0796 9.0703 +YCCC 1014.795786 3 0.0146 320 | 2/14
10 h-m-p 0.0049 0.0245 22.7712 YCCC 1014.636180 3 0.0025 354 | 2/14
11 h-m-p 0.0093 0.1063 6.2402 CCC 1014.480901 2 0.0117 387 | 2/14
12 h-m-p 0.0178 0.3666 4.1258 +YCCCCC 1013.837315 5 0.0751 426 | 2/14
13 h-m-p 0.4923 2.4613 0.4791 YCYC 1013.501754 3 0.2970 459 | 2/14
14 h-m-p 1.6000 8.0000 0.0531 YCCC 1013.372533 3 0.6699 493 | 2/14
15 h-m-p 0.3883 8.0000 0.0915 +YCC 1013.272371 2 1.1365 526 | 2/14
16 h-m-p 1.3020 8.0000 0.0799 YC 1013.181532 1 2.4285 556 | 2/14
17 h-m-p 1.5045 8.0000 0.1290 YCCC 1013.068708 3 2.5109 590 | 2/14
18 h-m-p 1.4355 8.0000 0.2256 YCCC 1012.907179 3 2.4411 624 | 2/14
19 h-m-p 1.2842 8.0000 0.4288 +YC 1012.610143 1 3.4108 655 | 2/14
20 h-m-p 1.6000 8.0000 0.5306 CY 1012.512164 1 1.6083 686 | 2/14
21 h-m-p 1.6000 8.0000 0.4558 CCC 1012.475680 2 2.2744 719 | 2/14
22 h-m-p 1.6000 8.0000 0.4446 C 1012.461310 0 1.5937 748 | 2/14
23 h-m-p 1.6000 8.0000 0.1877 CC 1012.459265 1 1.4500 779 | 2/14
24 h-m-p 1.6000 8.0000 0.0735 C 1012.458694 0 1.8767 808 | 2/14
25 h-m-p 1.6000 8.0000 0.0172 CC 1012.458417 1 2.5157 839 | 2/14
26 h-m-p 1.2251 8.0000 0.0353 C 1012.458387 0 1.2326 868 | 2/14
27 h-m-p 1.6000 8.0000 0.0021 Y 1012.458387 0 1.0468 897 | 2/14
28 h-m-p 1.6000 8.0000 0.0001 +Y 1012.458387 0 4.3168 927 | 2/14
29 h-m-p 1.1345 8.0000 0.0002 ++ 1012.458387 m 8.0000 956 | 2/14
30 h-m-p 0.0325 8.0000 0.0475 +++C 1012.458385 0 2.2846 988 | 2/14
31 h-m-p 1.6000 8.0000 0.0614 ++ 1012.458351 m 8.0000 1017 | 2/14
32 h-m-p 0.5277 8.0000 0.9314 ---------------N 1012.458351 0 0.0000 1061 | 2/14
33 h-m-p 0.0160 8.0000 0.0022 +++C 1012.458344 0 1.2037 1093 | 2/14
34 h-m-p 1.6000 8.0000 0.0004 C 1012.458344 0 0.5756 1122 | 2/14
35 h-m-p 1.6000 8.0000 0.0000 --------------C 1012.458344 0 0.0000 1165
Out..
lnL = -1012.458344
1166 lfun, 13992 eigenQcodon, 115434 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1038.488105 S = -999.125583 -32.357923
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 96 patterns 1:41
did 20 / 96 patterns 1:41
did 30 / 96 patterns 1:41
did 40 / 96 patterns 1:41
did 50 / 96 patterns 1:41
did 60 / 96 patterns 1:42
did 70 / 96 patterns 1:42
did 80 / 96 patterns 1:42
did 90 / 96 patterns 1:42
did 96 / 96 patterns 1:42
Time used: 1:42
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=148
D_melanogaster_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
D_sechellia_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
D_simulans_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
D_yakuba_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
D_erecta_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD
D_biarmipes_Acam-PA MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD
*********************:***** :**************:*.****
D_melanogaster_Acam-PA LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
D_sechellia_Acam-PA LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
D_simulans_Acam-PA LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
D_yakuba_Acam-PA LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
D_erecta_Acam-PA LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI
D_biarmipes_Acam-PA LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI
*:*:.:.*.:* *:*:***.******************************
D_melanogaster_Acam-PA SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
D_sechellia_Acam-PA SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
D_simulans_Acam-PA SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
D_yakuba_Acam-PA SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
D_erecta_Acam-PA SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
D_biarmipes_Acam-PA SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
************************************************
>D_melanogaster_Acam-PA ATGTCCGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA CATTGATGCGCACCTTGGGCCAGAATCCAACGGAGGCCGAGTTGCAAGAT TTGATAGCTGAGGCCGAGAACAACAACAATGGCCAACTGAACTTCACTGA GTTCTGCGGTATAATGGCCAAGCAAATGCGGGAAACTGACACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGTGATGGCGATGGCTTTATA TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGATGAGATGATTCGCGAGGCTGATTTTGATGGGGATG GCATGATCAACTACGAGGAATTCGTATGGATGATAAGCCAGAAG >D_sechellia_Acam-PA ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACTCGTGAGCTGGGCA CCTTGATGCGCACCTTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA GTTTTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG >D_simulans_Acam-PA ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA GTTCTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCACCAGCCGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG GCATGATCAACTACGAGGAATTCGTTTGGATGATTAGCCAGAAG >D_yakuba_Acam-PA ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTCGT GCAGTTCGACAAGGAGGGAACCGGCAAGATAGCCACCCGTGAGCTGGGCA CTTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAC TTGATTGCTGAGGCCGACAACAACAGCAATGGCCAACTGGACTTCAGTGA GTTCTGTGGCATTATGGCCAAGCAGATGCGCGAAACGGATACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCGCCAGCTGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGACGAGATGATACGCGAGGCGGATTTTGATGGAGATG GCATGATCAACTACGAGGAGTTCGTTTGGATGATAAGCCAGAAG >D_erecta_Acam-PA ATGTCGGAACTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTCGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT TTAATTGCCGATGCCGACAATAACAGCAATGGCCAACTGGACTTCACTGA GTTCTGTGGTATCATGGCAAAGCAAATGCGTGAAACGGATACGGAGGAGG AAATGCGGGAGGCTTTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCACCAGCTGAGCTTCGCTTTGTAATGATTAATCTCGGCGAGAAGGTCAC CGATGAAGAGATCGACGAGATGATACGCGAGGCTGATTTTGATGGGGATG GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG >D_biarmipes_Acam-PA ATGTCCGAGCTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTTGT GCAGTTCGATAAGGACGGAACCGGGAAGATAAACAGCCGTGAGTTGGGCA CCTTGATGCGCACCCTTGGCCAGAATCCCTCGGAGGGCGAGCTGCAGGAC CTGATGGCCGAGGTCGAGAACAACAGCGAGGGGCTACTGGACTTCAGTGA GTTCTGTGCCATCATGGCCAAGCAGATGCGCGAAACCGATACCGAGGAGG AGATGCGCGAGGCCTTTAAGATCTTCGATCGCGATGGGGATGGCTTTATA TCGCCGGCTGAGCTCCGCTTTGTGATGATCAATCTGGGAGAAAAGGTCAC CGACGAGGAGATCGACGAGATGATCCGCGAGGCCGATTTCGATGGCGACG GTATGATCAACTACGAGGAGTTCGTCTGGATGATCAGCCAGAAG
>D_melanogaster_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >D_sechellia_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >D_simulans_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >D_yakuba_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >D_erecta_Acam-PA MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >D_biarmipes_Acam-PA MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK
#NEXUS
[ID: 6977031477]
begin taxa;
dimensions ntax=6;
taxlabels
D_melanogaster_Acam-PA
D_sechellia_Acam-PA
D_simulans_Acam-PA
D_yakuba_Acam-PA
D_erecta_Acam-PA
D_biarmipes_Acam-PA
;
end;
begin trees;
translate
1 D_melanogaster_Acam-PA,
2 D_sechellia_Acam-PA,
3 D_simulans_Acam-PA,
4 D_yakuba_Acam-PA,
5 D_erecta_Acam-PA,
6 D_biarmipes_Acam-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.04183796,((4:0.01284892,6:0.2938387)0.963:0.04493101,5:0.08479835)0.986:0.0447466,(2:0.009269159,3:0.01491051)0.923:0.01748321);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.04183796,((4:0.01284892,6:0.2938387):0.04493101,5:0.08479835):0.0447466,(2:0.009269159,3:0.01491051):0.01748321);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1110.56 -1122.48
2 -1110.39 -1119.91
--------------------------------------
TOTAL -1110.47 -1121.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.594192 0.014355 0.370684 0.816880 0.577600 846.10 982.31 1.000
r(A<->C){all} 0.066901 0.001130 0.007743 0.131574 0.063217 596.73 665.19 1.000
r(A<->G){all} 0.114560 0.001481 0.050063 0.196252 0.109525 570.93 694.39 1.000
r(A<->T){all} 0.143289 0.002627 0.047122 0.243359 0.138426 763.70 791.44 1.000
r(C<->G){all} 0.073510 0.000811 0.022915 0.129814 0.070676 772.72 886.10 1.000
r(C<->T){all} 0.541517 0.005377 0.392300 0.674869 0.542034 580.82 591.67 1.000
r(G<->T){all} 0.060224 0.000896 0.005079 0.118287 0.056525 853.26 932.66 1.000
pi(A){all} 0.256444 0.000388 0.216810 0.294496 0.255909 891.48 1055.47 1.000
pi(C){all} 0.234852 0.000332 0.198324 0.269051 0.234726 999.41 1154.48 1.001
pi(G){all} 0.316632 0.000435 0.276391 0.356971 0.316422 1237.77 1278.29 1.000
pi(T){all} 0.192072 0.000288 0.158985 0.225398 0.191393 1237.59 1274.76 1.000
alpha{1,2} 0.098261 0.002036 0.002442 0.170310 0.100684 1203.31 1352.15 1.000
alpha{3} 1.986478 0.617666 0.634869 3.552134 1.848621 1501.00 1501.00 1.000
pinvar{all} 0.382179 0.010600 0.168103 0.565538 0.393649 1018.70 1095.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/2/Acam-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 148
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 5 5 4 4 4 4 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 1 1 1
TTC 6 6 7 7 7 7 | TCC 1 0 0 0 0 1 | TAC 1 1 1 1 1 1 | TGC 1 1 1 0 0 0
Leu TTA 0 0 0 0 1 0 | TCA 1 1 1 0 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 3 3 2 2 | TCG 0 1 1 2 1 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 0 0 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 2 2 1
CTC 0 0 0 0 1 1 | CCC 0 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 3 4 4 5 4 6
CTA 1 1 2 2 1 2 | CCA 2 1 1 1 1 0 | Gln CAA 3 2 2 1 2 0 | CGA 0 0 0 0 0 0
CTG 3 3 4 4 3 4 | CCG 0 0 0 0 0 1 | CAG 4 5 5 6 5 6 | CGG 1 0 0 0 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 3 4 3 0 | Thr ACT 3 3 2 2 1 0 | Asn AAT 3 3 3 3 4 2 | Ser AGT 0 0 0 1 0 1
ATC 4 5 5 3 4 7 | ACC 4 5 6 4 5 6 | AAC 5 4 4 3 2 4 | AGC 1 2 2 2 2 3
ATA 4 4 3 4 4 3 | ACA 1 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 9 9 9 9 9 10 | ACG 2 2 2 3 4 1 | AAG 7 7 7 7 7 7 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 1 1 1 1 0 | Ala GCT 3 3 2 2 3 1 | Asp GAT 9 10 10 8 11 8 | Gly GGT 1 0 0 0 1 1
GTC 2 2 2 1 2 3 | GCC 6 6 7 6 6 7 | GAC 3 2 2 6 4 6 | GGC 8 9 9 9 8 5
GTA 1 0 0 0 1 0 | GCA 1 1 1 1 1 0 | Glu GAA 5 5 5 4 5 2 | GGA 1 1 1 2 1 2
GTG 1 1 1 2 0 2 | GCG 0 0 0 1 0 0 | GAG 19 19 19 19 17 22 | GGG 1 1 1 0 1 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Acam-PA
position 1: T:0.13514 C:0.14189 A:0.31081 G:0.41216
position 2: T:0.29730 C:0.16216 A:0.39865 G:0.14189
position 3: T:0.20946 C:0.30405 A:0.13514 G:0.35135
Average T:0.21396 C:0.20270 A:0.28153 G:0.30180
#2: D_sechellia_Acam-PA
position 1: T:0.13514 C:0.14189 A:0.31081 G:0.41216
position 2: T:0.29730 C:0.16216 A:0.39189 G:0.14865
position 3: T:0.20946 C:0.32432 A:0.10811 G:0.35811
Average T:0.21396 C:0.20946 A:0.27027 G:0.30631
#3: D_simulans_Acam-PA
position 1: T:0.12838 C:0.14865 A:0.31081 G:0.41216
position 2: T:0.29730 C:0.16216 A:0.39189 G:0.14865
position 3: T:0.18919 C:0.34459 A:0.10811 G:0.35811
Average T:0.20495 C:0.21847 A:0.27027 G:0.30631
#4: D_yakuba_Acam-PA
position 1: T:0.12838 C:0.14865 A:0.30405 G:0.41892
position 2: T:0.29730 C:0.15541 A:0.39189 G:0.15541
position 3: T:0.18919 C:0.32432 A:0.10135 G:0.38514
Average T:0.20495 C:0.20946 A:0.26577 G:0.31982
#5: D_erecta_Acam-PA
position 1: T:0.12838 C:0.14865 A:0.30405 G:0.41892
position 2: T:0.29730 C:0.16216 A:0.39189 G:0.14865
position 3: T:0.21622 C:0.31757 A:0.12162 G:0.34459
Average T:0.21396 C:0.20946 A:0.27252 G:0.30405
#6: D_biarmipes_Acam-PA
position 1: T:0.12838 C:0.15541 A:0.29730 G:0.41892
position 2: T:0.31081 C:0.13514 A:0.39189 G:0.16216
position 3: T:0.13514 C:0.39189 A:0.06081 G:0.41216
Average T:0.19144 C:0.22748 A:0.25000 G:0.33108
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 26 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 3
TTC 40 | TCC 2 | TAC 6 | TGC 3
Leu L TTA 1 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 7 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 4 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 14
CTC 2 | CCC 5 | CAC 0 | CGC 26
CTA 9 | CCA 6 | Gln Q CAA 10 | CGA 0
CTG 21 | CCG 1 | CAG 31 | CGG 2
------------------------------------------------------------------------------
Ile I ATT 15 | Thr T ACT 11 | Asn N AAT 18 | Ser S AGT 2
ATC 28 | ACC 30 | AAC 22 | AGC 12
ATA 22 | ACA 1 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 55 | ACG 14 | AAG 42 | AGG 0
------------------------------------------------------------------------------
Val V GTT 4 | Ala A GCT 14 | Asp D GAT 56 | Gly G GGT 3
GTC 12 | GCC 38 | GAC 23 | GGC 48
GTA 2 | GCA 5 | Glu E GAA 26 | GGA 8
GTG 7 | GCG 1 | GAG 115 | GGG 7
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13063 C:0.14752 A:0.30631 G:0.41554
position 2: T:0.29955 C:0.15653 A:0.39302 G:0.15090
position 3: T:0.19144 C:0.33446 A:0.10586 G:0.36824
Average T:0.20721 C:0.21284 A:0.26839 G:0.31156
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Acam-PA
D_sechellia_Acam-PA 0.0150 (0.0028 0.1887)
D_simulans_Acam-PA 0.0131 (0.0028 0.2165)-1.0000 (0.0000 0.0696)
D_yakuba_Acam-PA 0.0312 (0.0114 0.3648) 0.0455 (0.0143 0.3130) 0.0513 (0.0143 0.2782)
D_erecta_Acam-PA 0.0259 (0.0114 0.4396) 0.0339 (0.0143 0.4208) 0.0342 (0.0143 0.4178) 0.0148 (0.0057 0.3823)
D_biarmipes_Acam-PA 0.0536 (0.0465 0.8679) 0.0670 (0.0495 0.7396) 0.0662 (0.0466 0.7038) 0.0709 (0.0376 0.5304) 0.0483 (0.0436 0.9016)
Model 0: one-ratio
TREE # 1: (1, ((4, 6), 5), (2, 3)); MP score: 103
lnL(ntime: 9 np: 11): -1014.049666 +0.000000
7..1 7..8 8..9 9..4 9..6 8..5 7..10 10..2 10..3
0.081547 0.095091 0.108729 0.000004 0.597590 0.163743 0.042575 0.018591 0.030671 0.961168 0.028734
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.13854
(1: 0.081547, ((4: 0.000004, 6: 0.597590): 0.108729, 5: 0.163743): 0.095091, (2: 0.018591, 3: 0.030671): 0.042575);
(D_melanogaster_Acam-PA: 0.081547, ((D_yakuba_Acam-PA: 0.000004, D_biarmipes_Acam-PA: 0.597590): 0.108729, D_erecta_Acam-PA: 0.163743): 0.095091, (D_sechellia_Acam-PA: 0.018591, D_simulans_Acam-PA: 0.030671): 0.042575);
Detailed output identifying parameters
kappa (ts/tv) = 0.96117
omega (dN/dS) = 0.02873
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.082 360.4 83.6 0.0287 0.0037 0.1285 1.3 10.7
7..8 0.095 360.4 83.6 0.0287 0.0043 0.1498 1.6 12.5
8..9 0.109 360.4 83.6 0.0287 0.0049 0.1713 1.8 14.3
9..4 0.000 360.4 83.6 0.0287 0.0000 0.0000 0.0 0.0
9..6 0.598 360.4 83.6 0.0287 0.0271 0.9415 9.8 78.7
8..5 0.164 360.4 83.6 0.0287 0.0074 0.2580 2.7 21.6
7..10 0.043 360.4 83.6 0.0287 0.0019 0.0671 0.7 5.6
10..2 0.019 360.4 83.6 0.0287 0.0008 0.0293 0.3 2.4
10..3 0.031 360.4 83.6 0.0287 0.0014 0.0483 0.5 4.0
tree length for dN: 0.0515
tree length for dS: 1.7937
Time used: 0:03
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 6), 5), (2, 3)); MP score: 103
lnL(ntime: 9 np: 12): -1014.050256 +0.000000
7..1 7..8 8..9 9..4 9..6 8..5 7..10 10..2 10..3
0.081548 0.095092 0.108731 0.000004 0.597597 0.163745 0.042575 0.018591 0.030672 0.961183 0.999990 0.028733
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.13855
(1: 0.081548, ((4: 0.000004, 6: 0.597597): 0.108731, 5: 0.163745): 0.095092, (2: 0.018591, 3: 0.030672): 0.042575);
(D_melanogaster_Acam-PA: 0.081548, ((D_yakuba_Acam-PA: 0.000004, D_biarmipes_Acam-PA: 0.597597): 0.108731, D_erecta_Acam-PA: 0.163745): 0.095092, (D_sechellia_Acam-PA: 0.018591, D_simulans_Acam-PA: 0.030672): 0.042575);
Detailed output identifying parameters
kappa (ts/tv) = 0.96118
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.02873 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.082 360.4 83.6 0.0287 0.0037 0.1285 1.3 10.7
7..8 0.095 360.4 83.6 0.0287 0.0043 0.1498 1.6 12.5
8..9 0.109 360.4 83.6 0.0287 0.0049 0.1713 1.8 14.3
9..4 0.000 360.4 83.6 0.0287 0.0000 0.0000 0.0 0.0
9..6 0.598 360.4 83.6 0.0287 0.0271 0.9415 9.8 78.7
8..5 0.164 360.4 83.6 0.0287 0.0074 0.2580 2.7 21.6
7..10 0.043 360.4 83.6 0.0287 0.0019 0.0671 0.7 5.6
10..2 0.019 360.4 83.6 0.0287 0.0008 0.0293 0.3 2.4
10..3 0.031 360.4 83.6 0.0287 0.0014 0.0483 0.5 4.0
Time used: 0:07
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 6), 5), (2, 3)); MP score: 103
check convergence..
lnL(ntime: 9 np: 14): -1014.049666 +0.000000
7..1 7..8 8..9 9..4 9..6 8..5 7..10 10..2 10..3
0.081547 0.095091 0.108729 0.000004 0.597591 0.163743 0.042575 0.018591 0.030671 0.961168 1.000000 0.000000 0.028734 50.055301
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.13854
(1: 0.081547, ((4: 0.000004, 6: 0.597591): 0.108729, 5: 0.163743): 0.095091, (2: 0.018591, 3: 0.030671): 0.042575);
(D_melanogaster_Acam-PA: 0.081547, ((D_yakuba_Acam-PA: 0.000004, D_biarmipes_Acam-PA: 0.597591): 0.108729, D_erecta_Acam-PA: 0.163743): 0.095091, (D_sechellia_Acam-PA: 0.018591, D_simulans_Acam-PA: 0.030671): 0.042575);
Detailed output identifying parameters
kappa (ts/tv) = 0.96117
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.02873 1.00000 50.05530
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.082 360.4 83.6 0.0287 0.0037 0.1285 1.3 10.7
7..8 0.095 360.4 83.6 0.0287 0.0043 0.1498 1.6 12.5
8..9 0.109 360.4 83.6 0.0287 0.0049 0.1713 1.8 14.3
9..4 0.000 360.4 83.6 0.0287 0.0000 0.0000 0.0 0.0
9..6 0.598 360.4 83.6 0.0287 0.0271 0.9415 9.8 78.7
8..5 0.164 360.4 83.6 0.0287 0.0074 0.2580 2.7 21.6
7..10 0.043 360.4 83.6 0.0287 0.0019 0.0671 0.7 5.6
10..2 0.019 360.4 83.6 0.0287 0.0008 0.0293 0.3 2.4
10..3 0.031 360.4 83.6 0.0287 0.0014 0.0483 0.5 4.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acam-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.160 0.104 0.095 0.093 0.092 0.092 0.091 0.091 0.091 0.091
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 0:24
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 6), 5), (2, 3)); MP score: 103
lnL(ntime: 9 np: 15): -1012.263531 +0.000000
7..1 7..8 8..9 9..4 9..6 8..5 7..10 10..2 10..3
0.081864 0.094838 0.109650 0.000004 0.606067 0.164763 0.042705 0.018648 0.030713 0.951571 0.375084 0.315158 0.000001 0.000001 0.097630
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14925
(1: 0.081864, ((4: 0.000004, 6: 0.606067): 0.109650, 5: 0.164763): 0.094838, (2: 0.018648, 3: 0.030713): 0.042705);
(D_melanogaster_Acam-PA: 0.081864, ((D_yakuba_Acam-PA: 0.000004, D_biarmipes_Acam-PA: 0.606067): 0.109650, D_erecta_Acam-PA: 0.164763): 0.094838, (D_sechellia_Acam-PA: 0.018648, D_simulans_Acam-PA: 0.030713): 0.042705);
Detailed output identifying parameters
kappa (ts/tv) = 0.95157
dN/dS (w) for site classes (K=3)
p: 0.37508 0.31516 0.30976
w: 0.00000 0.00000 0.09763
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.082 360.6 83.4 0.0302 0.0039 0.1284 1.4 10.7
7..8 0.095 360.6 83.4 0.0302 0.0045 0.1488 1.6 12.4
8..9 0.110 360.6 83.4 0.0302 0.0052 0.1720 1.9 14.4
9..4 0.000 360.6 83.4 0.0302 0.0000 0.0000 0.0 0.0
9..6 0.606 360.6 83.4 0.0302 0.0288 0.9509 10.4 79.3
8..5 0.165 360.6 83.4 0.0302 0.0078 0.2585 2.8 21.6
7..10 0.043 360.6 83.4 0.0302 0.0020 0.0670 0.7 5.6
10..2 0.019 360.6 83.4 0.0302 0.0009 0.0293 0.3 2.4
10..3 0.031 360.6 83.4 0.0302 0.0015 0.0482 0.5 4.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:34
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 6), 5), (2, 3)); MP score: 103
lnL(ntime: 9 np: 12): -1012.456943 +0.000000
7..1 7..8 8..9 9..4 9..6 8..5 7..10 10..2 10..3
0.081816 0.094703 0.109624 0.000004 0.605544 0.164725 0.042705 0.018637 0.030693 0.951680 0.267806 7.900029
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14845
(1: 0.081816, ((4: 0.000004, 6: 0.605544): 0.109624, 5: 0.164725): 0.094703, (2: 0.018637, 3: 0.030693): 0.042705);
(D_melanogaster_Acam-PA: 0.081816, ((D_yakuba_Acam-PA: 0.000004, D_biarmipes_Acam-PA: 0.605544): 0.109624, D_erecta_Acam-PA: 0.164725): 0.094703, (D_sechellia_Acam-PA: 0.018637, D_simulans_Acam-PA: 0.030693): 0.042705);
Detailed output identifying parameters
kappa (ts/tv) = 0.95168
Parameters in M7 (beta):
p = 0.26781 q = 7.90003
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00008 0.00051 0.00181 0.00471 0.01027 0.02020 0.03772 0.07082 0.15489
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.082 360.6 83.4 0.0301 0.0039 0.1284 1.4 10.7
7..8 0.095 360.6 83.4 0.0301 0.0045 0.1487 1.6 12.4
8..9 0.110 360.6 83.4 0.0301 0.0052 0.1721 1.9 14.4
9..4 0.000 360.6 83.4 0.0301 0.0000 0.0000 0.0 0.0
9..6 0.606 360.6 83.4 0.0301 0.0286 0.9505 10.3 79.3
8..5 0.165 360.6 83.4 0.0301 0.0078 0.2586 2.8 21.6
7..10 0.043 360.6 83.4 0.0301 0.0020 0.0670 0.7 5.6
10..2 0.019 360.6 83.4 0.0301 0.0009 0.0293 0.3 2.4
10..3 0.031 360.6 83.4 0.0301 0.0015 0.0482 0.5 4.0
Time used: 1:03
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 6), 5), (2, 3)); MP score: 103
lnL(ntime: 9 np: 14): -1012.458344 +0.000000
7..1 7..8 8..9 9..4 9..6 8..5 7..10 10..2 10..3
0.081823 0.094711 0.109633 0.000004 0.605599 0.164738 0.042708 0.018639 0.030695 0.951690 0.999990 0.267980 7.906099 2.296270
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14855
(1: 0.081823, ((4: 0.000004, 6: 0.605599): 0.109633, 5: 0.164738): 0.094711, (2: 0.018639, 3: 0.030695): 0.042708);
(D_melanogaster_Acam-PA: 0.081823, ((D_yakuba_Acam-PA: 0.000004, D_biarmipes_Acam-PA: 0.605599): 0.109633, D_erecta_Acam-PA: 0.164738): 0.094711, (D_sechellia_Acam-PA: 0.018639, D_simulans_Acam-PA: 0.030695): 0.042708);
Detailed output identifying parameters
kappa (ts/tv) = 0.95169
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.26798 q = 7.90610
(p1 = 0.00001) w = 2.29627
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00008 0.00051 0.00182 0.00472 0.01028 0.02021 0.03773 0.07082 0.15484 2.29627
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.082 360.6 83.4 0.0301 0.0039 0.1284 1.4 10.7
7..8 0.095 360.6 83.4 0.0301 0.0045 0.1487 1.6 12.4
8..9 0.110 360.6 83.4 0.0301 0.0052 0.1721 1.9 14.4
9..4 0.000 360.6 83.4 0.0301 0.0000 0.0000 0.0 0.0
9..6 0.606 360.6 83.4 0.0301 0.0286 0.9505 10.3 79.3
8..5 0.165 360.6 83.4 0.0301 0.0078 0.2586 2.8 21.6
7..10 0.043 360.6 83.4 0.0301 0.0020 0.0670 0.7 5.6
10..2 0.019 360.6 83.4 0.0301 0.0009 0.0293 0.3 2.4
10..3 0.031 360.6 83.4 0.0301 0.0015 0.0482 0.5 4.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acam-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.002 0.018 0.079 0.253 0.648
ws: 0.169 0.104 0.094 0.091 0.091 0.090 0.090 0.090 0.090 0.090
Time used: 1:42
Model 1: NearlyNeutral -1014.050256 Model 2: PositiveSelection -1014.049666 Model 0: one-ratio -1014.049666 Model 3: discrete -1012.263531 Model 7: beta -1012.456943 Model 8: beta&w>1 -1012.458344 Model 0 vs 1 0.0011799999999766442 Model 2 vs 1 0.0011799999999766442 Model 8 vs 7 0.002801999999974214
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
