--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Sat Nov 12 06:20:08 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/2/Acam-PA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1110.56 -1122.48 2 -1110.39 -1119.91 -------------------------------------- TOTAL -1110.47 -1121.86 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.594192 0.014355 0.370684 0.816880 0.577600 846.10 982.31 1.000 r(A<->C){all} 0.066901 0.001130 0.007743 0.131574 0.063217 596.73 665.19 1.000 r(A<->G){all} 0.114560 0.001481 0.050063 0.196252 0.109525 570.93 694.39 1.000 r(A<->T){all} 0.143289 0.002627 0.047122 0.243359 0.138426 763.70 791.44 1.000 r(C<->G){all} 0.073510 0.000811 0.022915 0.129814 0.070676 772.72 886.10 1.000 r(C<->T){all} 0.541517 0.005377 0.392300 0.674869 0.542034 580.82 591.67 1.000 r(G<->T){all} 0.060224 0.000896 0.005079 0.118287 0.056525 853.26 932.66 1.000 pi(A){all} 0.256444 0.000388 0.216810 0.294496 0.255909 891.48 1055.47 1.000 pi(C){all} 0.234852 0.000332 0.198324 0.269051 0.234726 999.41 1154.48 1.001 pi(G){all} 0.316632 0.000435 0.276391 0.356971 0.316422 1237.77 1278.29 1.000 pi(T){all} 0.192072 0.000288 0.158985 0.225398 0.191393 1237.59 1274.76 1.000 alpha{1,2} 0.098261 0.002036 0.002442 0.170310 0.100684 1203.31 1352.15 1.000 alpha{3} 1.986478 0.617666 0.634869 3.552134 1.848621 1501.00 1501.00 1.000 pinvar{all} 0.382179 0.010600 0.168103 0.565538 0.393649 1018.70 1095.82 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1014.050256 Model 2: PositiveSelection -1014.049666 Model 0: one-ratio -1014.049666 Model 3: discrete -1012.263531 Model 7: beta -1012.456943 Model 8: beta&w>1 -1012.458344 Model 0 vs 1 0.0011799999999766442 Model 2 vs 1 0.0011799999999766442 Model 8 vs 7 0.002801999999974214
>C1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C2 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C3 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C4 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C5 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C6 MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=148 C1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD C2 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD C3 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD C4 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD C5 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD C6 MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD *********************:***** :**************:*.**** C1 LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI C2 LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI C3 LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI C4 LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI C5 LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI C6 LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI *:*:.:.*.:* *:*:***.****************************** C1 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK C2 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK C3 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK C4 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK C5 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK C6 SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK ************************************************ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 148 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 148 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [4440] Library Relaxation: Multi_proc [72] Relaxation Summary: [4440]--->[4440] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/2/Acam-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.311 Mb, Max= 30.535 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C2 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C3 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C4 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C5 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C6 MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK FORMAT of file /tmp/tmp1103344606009295275aln Not Supported[FATAL:T-COFFEE] >C1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C2 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C3 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C4 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C5 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C6 MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:148 S:100 BS:148 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 99.32 C1 C2 99.32 TOP 1 0 99.32 C2 C1 99.32 BOT 0 2 99.32 C1 C3 99.32 TOP 2 0 99.32 C3 C1 99.32 BOT 0 3 97.30 C1 C4 97.30 TOP 3 0 97.30 C4 C1 97.30 BOT 0 4 97.30 C1 C5 97.30 TOP 4 0 97.30 C5 C1 97.30 BOT 0 5 91.22 C1 C6 91.22 TOP 5 0 91.22 C6 C1 91.22 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 96.62 C2 C4 96.62 TOP 3 1 96.62 C4 C2 96.62 BOT 1 4 96.62 C2 C5 96.62 TOP 4 1 96.62 C5 C2 96.62 BOT 1 5 90.54 C2 C6 90.54 TOP 5 1 90.54 C6 C2 90.54 BOT 2 3 96.62 C3 C4 96.62 TOP 3 2 96.62 C4 C3 96.62 BOT 2 4 96.62 C3 C5 96.62 TOP 4 2 96.62 C5 C3 96.62 BOT 2 5 90.54 C3 C6 90.54 TOP 5 2 90.54 C6 C3 90.54 BOT 3 4 98.65 C4 C5 98.65 TOP 4 3 98.65 C5 C4 98.65 BOT 3 5 92.57 C4 C6 92.57 TOP 5 3 92.57 C6 C4 92.57 BOT 4 5 91.22 C5 C6 91.22 TOP 5 4 91.22 C6 C5 91.22 AVG 0 C1 * 96.89 AVG 1 C2 * 96.62 AVG 2 C3 * 96.62 AVG 3 C4 * 96.35 AVG 4 C5 * 96.08 AVG 5 C6 * 91.22 TOT TOT * 95.63 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCCGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT C2 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT C3 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT C4 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTCGT C5 ATGTCGGAACTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTCGT C6 ATGTCCGAGCTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTTGT ***** **.*****************:******************** ** C1 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA C2 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACTCGTGAGCTGGGCA C3 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA C4 GCAGTTCGACAAGGAGGGAACCGGCAAGATAGCCACCCGTGAGCTGGGCA C5 CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA C6 GCAGTTCGATAAGGACGGAACCGGGAAGATAAACAGCCGTGAGTTGGGCA ******** ***** ******** *****...** ****** ****** C1 CATTGATGCGCACCTTGGGCCAGAATCCAACGGAGGCCGAGTTGCAAGAT C2 CCTTGATGCGCACCTTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT C3 CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT C4 CTTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAC C5 CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT C6 CCTTGATGCGCACCCTTGGCCAGAATCCCTCGGAGGGCGAGCTGCAGGAC * ************ * ***********.:****** **** ****.** C1 TTGATAGCTGAGGCCGAGAACAACAACAATGGCCAACTGAACTTCACTGA C2 TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA C3 TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA C4 TTGATTGCTGAGGCCGACAACAACAGCAATGGCCAACTGGACTTCAGTGA C5 TTAATTGCCGATGCCGACAATAACAGCAATGGCCAACTGGACTTCACTGA C6 CTGATGGCCGAGGTCGAGAACAACAGCGAGGGGCTACTGGACTTCAGTGA *.** ** ** * *** *. ****.*.* ** *:****.****** ** C1 GTTCTGCGGTATAATGGCCAAGCAAATGCGGGAAACTGACACTGAGGAGG C2 GTTTTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG C3 GTTCTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG C4 GTTCTGTGGCATTATGGCCAAGCAGATGCGCGAAACGGATACTGAGGAGG C5 GTTCTGTGGTATCATGGCAAAGCAAATGCGTGAAACGGATACGGAGGAGG C6 GTTCTGTGCCATCATGGCCAAGCAGATGCGCGAAACCGATACCGAGGAGG *** ** * ** *****.*****.***** ***** ** ** ******* C1 AAATGCGTGAGGCATTCAAGATTTTTGATCGTGATGGCGATGGCTTTATA C2 AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA C3 AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA C4 AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA C5 AAATGCGGGAGGCTTTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA C6 AGATGCGCGAGGCCTTTAAGATCTTCGATCGCGATGGGGATGGCTTTATA *.***** ***** ** ***** ** ***** ***** ************ C1 TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC C2 TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC C3 TCACCAGCCGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC C4 TCGCCAGCTGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC C5 TCACCAGCTGAGCTTCGCTTTGTAATGATTAATCTCGGCGAGAAGGTCAC C6 TCGCCGGCTGAGCTCCGCTTTGTGATGATCAATCTGGGAGAAAAGGTCAC **.**.** ***** ********.***** ***** **.**.******** C1 CGACGAGGAGATCGATGAGATGATTCGCGAGGCTGATTTTGATGGGGATG C2 CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG C3 CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG C4 CGACGAGGAGATCGACGAGATGATACGCGAGGCGGATTTTGATGGAGATG C5 CGATGAAGAGATCGACGAGATGATACGCGAGGCTGATTTTGATGGGGATG C6 CGACGAGGAGATCGACGAGATGATCCGCGAGGCCGATTTCGATGGCGACG *** **.******** ******** ** ***** ***** ***** ** * C1 GCATGATCAACTACGAGGAATTCGTATGGATGATAAGCCAGAAG C2 GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG C3 GCATGATCAACTACGAGGAATTCGTTTGGATGATTAGCCAGAAG C4 GCATGATCAACTACGAGGAGTTCGTTTGGATGATAAGCCAGAAG C5 GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG C6 GTATGATCAACTACGAGGAGTTCGTCTGGATGATCAGCCAGAAG * *****************.***** ******** ********* >C1 ATGTCCGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA CATTGATGCGCACCTTGGGCCAGAATCCAACGGAGGCCGAGTTGCAAGAT TTGATAGCTGAGGCCGAGAACAACAACAATGGCCAACTGAACTTCACTGA GTTCTGCGGTATAATGGCCAAGCAAATGCGGGAAACTGACACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGTGATGGCGATGGCTTTATA TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGATGAGATGATTCGCGAGGCTGATTTTGATGGGGATG GCATGATCAACTACGAGGAATTCGTATGGATGATAAGCCAGAAG >C2 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACTCGTGAGCTGGGCA CCTTGATGCGCACCTTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA GTTTTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCACCAGCTGAGCTTCGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG >C3 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTTGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT TTGATAGCTGAGGCCGAGAGCAACAACAATGGCCAACTGAACTTCACCGA GTTCTGCGGCATAATGGCCAAGCAAATGCGCGAAACTGATACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCACCAGCCGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGATGAGATGATCCGTGAGGCTGATTTCGATGGGGATG GCATGATCAACTACGAGGAATTCGTTTGGATGATTAGCCAGAAG >C4 ATGTCGGAACTAACGGAGGAGCAGATTGCCGAGTTCAAGGATGCCTTCGT GCAGTTCGACAAGGAGGGAACCGGCAAGATAGCCACCCGTGAGCTGGGCA CTTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAC TTGATTGCTGAGGCCGACAACAACAGCAATGGCCAACTGGACTTCAGTGA GTTCTGTGGCATTATGGCCAAGCAGATGCGCGAAACGGATACTGAGGAGG AAATGCGTGAGGCATTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCGCCAGCTGAGCTACGCTTTGTGATGATCAATCTGGGCGAAAAGGTCAC CGACGAGGAGATCGACGAGATGATACGCGAGGCGGATTTTGATGGAGATG GCATGATCAACTACGAGGAGTTCGTTTGGATGATAAGCCAGAAG >C5 ATGTCGGAACTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTCGT CCAGTTCGACAAGGAGGGAACCGGCAAGATCGCCACCCGTGAGCTGGGCA CCTTGATGCGCACCCTGGGCCAGAATCCCACGGAGGCCGAGTTGCAGGAT TTAATTGCCGATGCCGACAATAACAGCAATGGCCAACTGGACTTCACTGA GTTCTGTGGTATCATGGCAAAGCAAATGCGTGAAACGGATACGGAGGAGG AAATGCGGGAGGCTTTCAAGATTTTTGATCGCGATGGCGATGGCTTTATA TCACCAGCTGAGCTTCGCTTTGTAATGATTAATCTCGGCGAGAAGGTCAC CGATGAAGAGATCGACGAGATGATACGCGAGGCTGATTTTGATGGGGATG GCATGATCAACTACGAGGAATTCGTTTGGATGATAAGCCAGAAG >C6 ATGTCCGAGCTAACGGAGGAGCAGATAGCCGAGTTCAAGGATGCCTTTGT GCAGTTCGATAAGGACGGAACCGGGAAGATAAACAGCCGTGAGTTGGGCA CCTTGATGCGCACCCTTGGCCAGAATCCCTCGGAGGGCGAGCTGCAGGAC CTGATGGCCGAGGTCGAGAACAACAGCGAGGGGCTACTGGACTTCAGTGA GTTCTGTGCCATCATGGCCAAGCAGATGCGCGAAACCGATACCGAGGAGG AGATGCGCGAGGCCTTTAAGATCTTCGATCGCGATGGGGATGGCTTTATA TCGCCGGCTGAGCTCCGCTTTGTGATGATCAATCTGGGAGAAAAGGTCAC CGACGAGGAGATCGACGAGATGATCCGCGAGGCCGATTTCGATGGCGACG GTATGATCAACTACGAGGAGTTCGTCTGGATGATCAGCCAGAAG >C1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAENNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C2 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C3 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEAESNNNGQLNFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C4 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIAEADNNSNGQLDFSEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C5 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQD LIADADNNSNGQLDFTEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK >C6 MSELTEEQIAEFKDAFVQFDKDGTGKINSRELGTLMRTLGQNPSEGELQD LMAEVENNSEGLLDFSEFCAIMAKQMRETDTEEEMREAFKIFDRDGDGFI SPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWMISQK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 444 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1478931315 Setting output file names to "/opt/ADOPS/2/Acam-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1442698259 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 6977031477 Seed = 342288503 Swapseed = 1478931315 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 11 unique site patterns Division 2 has 12 unique site patterns Division 3 has 52 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1405.225762 -- -24.965149 Chain 2 -- -1356.074043 -- -24.965149 Chain 3 -- -1386.309770 -- -24.965149 Chain 4 -- -1406.723757 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1391.640676 -- -24.965149 Chain 2 -- -1372.697897 -- -24.965149 Chain 3 -- -1350.064742 -- -24.965149 Chain 4 -- -1384.100425 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1405.226] (-1356.074) (-1386.310) (-1406.724) * [-1391.641] (-1372.698) (-1350.065) (-1384.100) 500 -- (-1152.355) [-1154.883] (-1157.420) (-1151.673) * [-1132.267] (-1152.197) (-1158.459) (-1153.613) -- 0:00:00 1000 -- (-1138.930) [-1148.002] (-1150.916) (-1148.252) * [-1124.434] (-1142.814) (-1159.062) (-1146.987) -- 0:00:00 1500 -- (-1143.605) [-1141.882] (-1148.726) (-1135.175) * [-1117.493] (-1131.805) (-1152.266) (-1137.626) -- 0:00:00 2000 -- (-1135.121) [-1132.419] (-1155.477) (-1121.183) * [-1117.784] (-1121.915) (-1140.739) (-1123.078) -- 0:00:00 2500 -- (-1122.701) (-1132.821) (-1146.755) [-1119.765] * (-1113.303) [-1117.321] (-1138.671) (-1118.743) -- 0:06:39 3000 -- [-1118.572] (-1126.776) (-1147.572) (-1112.189) * (-1113.196) (-1122.169) [-1133.273] (-1120.137) -- 0:05:32 3500 -- [-1110.256] (-1129.690) (-1126.634) (-1111.358) * [-1117.623] (-1116.599) (-1138.706) (-1115.337) -- 0:04:44 4000 -- [-1113.451] (-1115.561) (-1138.056) (-1110.200) * [-1115.139] (-1120.179) (-1124.107) (-1114.380) -- 0:04:09 4500 -- [-1110.743] (-1117.858) (-1126.899) (-1120.842) * (-1120.338) (-1118.653) (-1131.861) [-1121.962] -- 0:03:41 5000 -- (-1117.436) (-1117.077) [-1115.299] (-1116.790) * (-1116.929) (-1124.972) (-1127.555) [-1107.907] -- 0:03:19 Average standard deviation of split frequencies: 0.062854 5500 -- (-1113.903) (-1125.315) [-1115.470] (-1126.596) * [-1115.076] (-1118.928) (-1122.222) (-1110.316) -- 0:03:00 6000 -- (-1116.319) [-1113.823] (-1114.566) (-1118.500) * [-1115.135] (-1118.710) (-1128.535) (-1112.859) -- 0:02:45 6500 -- [-1115.338] (-1113.911) (-1111.578) (-1118.993) * [-1111.713] (-1113.184) (-1132.039) (-1114.045) -- 0:02:32 7000 -- (-1112.977) (-1118.851) [-1118.933] (-1114.515) * (-1112.527) (-1113.591) [-1121.922] (-1113.127) -- 0:02:21 7500 -- [-1112.099] (-1111.916) (-1111.901) (-1113.861) * (-1119.175) [-1112.639] (-1123.627) (-1112.730) -- 0:02:12 8000 -- (-1112.957) (-1121.341) (-1115.196) [-1111.403] * (-1116.891) (-1112.325) (-1122.875) [-1111.571] -- 0:04:08 8500 -- [-1109.645] (-1117.004) (-1116.275) (-1118.349) * (-1114.246) [-1121.146] (-1120.584) (-1113.173) -- 0:03:53 9000 -- [-1113.832] (-1112.030) (-1120.503) (-1111.367) * [-1115.274] (-1118.273) (-1122.403) (-1111.693) -- 0:03:40 9500 -- (-1113.404) (-1116.923) (-1118.086) [-1111.748] * (-1113.177) [-1115.166] (-1118.570) (-1114.433) -- 0:03:28 10000 -- [-1108.278] (-1111.561) (-1113.758) (-1109.532) * [-1114.859] (-1123.066) (-1120.857) (-1118.028) -- 0:03:18 Average standard deviation of split frequencies: 0.079550 10500 -- [-1117.705] (-1118.580) (-1114.316) (-1108.520) * (-1120.304) [-1118.062] (-1117.020) (-1114.900) -- 0:03:08 11000 -- (-1117.679) [-1112.402] (-1110.891) (-1115.916) * (-1121.901) (-1115.742) [-1117.542] (-1115.874) -- 0:02:59 11500 -- (-1119.789) (-1112.932) [-1115.287] (-1123.926) * (-1114.623) (-1122.886) [-1111.461] (-1119.909) -- 0:02:51 12000 -- [-1109.421] (-1114.196) (-1117.090) (-1112.969) * (-1111.825) (-1115.600) [-1111.676] (-1114.045) -- 0:02:44 12500 -- (-1113.015) [-1116.354] (-1111.060) (-1116.083) * (-1109.206) (-1115.658) (-1116.128) [-1118.453] -- 0:02:38 13000 -- (-1116.331) (-1124.255) (-1113.522) [-1110.406] * (-1116.323) (-1126.248) [-1111.983] (-1111.625) -- 0:03:47 13500 -- (-1116.785) (-1121.224) (-1112.508) [-1115.355] * (-1123.796) (-1115.048) [-1112.050] (-1114.346) -- 0:03:39 14000 -- [-1114.661] (-1124.114) (-1108.401) (-1115.749) * (-1114.984) (-1116.653) (-1115.032) [-1112.820] -- 0:03:31 14500 -- [-1113.981] (-1116.167) (-1111.345) (-1113.857) * (-1111.747) (-1116.898) (-1111.068) [-1115.372] -- 0:03:23 15000 -- (-1119.403) [-1116.805] (-1114.174) (-1121.496) * (-1111.600) [-1126.311] (-1122.481) (-1123.172) -- 0:03:17 Average standard deviation of split frequencies: 0.051560 15500 -- (-1112.619) (-1117.699) (-1120.698) [-1120.675] * (-1114.415) [-1114.152] (-1116.999) (-1118.591) -- 0:03:10 16000 -- (-1119.093) (-1113.655) (-1116.287) [-1120.636] * [-1114.807] (-1118.005) (-1115.503) (-1121.746) -- 0:03:04 16500 -- (-1118.623) [-1110.918] (-1113.828) (-1118.970) * (-1118.960) [-1119.211] (-1114.258) (-1125.036) -- 0:02:58 17000 -- (-1116.196) (-1110.406) [-1116.756] (-1121.105) * (-1119.053) (-1117.775) (-1114.132) [-1117.970] -- 0:02:53 17500 -- (-1118.629) (-1115.705) (-1112.113) [-1118.996] * (-1118.861) (-1126.224) (-1122.835) [-1114.321] -- 0:02:48 18000 -- (-1115.815) (-1114.600) (-1120.331) [-1118.665] * (-1115.052) (-1117.581) [-1110.418] (-1114.269) -- 0:02:43 18500 -- [-1117.346] (-1114.773) (-1113.531) (-1123.268) * (-1115.106) (-1114.259) (-1118.778) [-1115.389] -- 0:03:32 19000 -- [-1110.659] (-1113.464) (-1118.235) (-1116.968) * [-1115.380] (-1123.404) (-1113.035) (-1122.748) -- 0:03:26 19500 -- (-1116.303) (-1113.669) (-1114.005) [-1116.395] * (-1112.811) (-1118.661) (-1124.144) [-1116.629] -- 0:03:21 20000 -- (-1121.634) (-1115.796) [-1110.257] (-1116.299) * (-1115.646) (-1117.166) [-1110.745] (-1121.804) -- 0:03:16 Average standard deviation of split frequencies: 0.022810 20500 -- [-1114.749] (-1117.684) (-1112.371) (-1114.531) * [-1113.029] (-1114.351) (-1110.004) (-1116.323) -- 0:03:11 21000 -- [-1118.880] (-1114.057) (-1114.328) (-1114.361) * (-1115.970) (-1126.838) (-1113.484) [-1114.872] -- 0:03:06 21500 -- (-1122.340) (-1113.576) [-1112.892] (-1110.844) * [-1119.116] (-1120.655) (-1113.862) (-1113.681) -- 0:03:02 22000 -- [-1123.272] (-1111.955) (-1115.205) (-1118.077) * (-1119.462) (-1118.813) (-1114.305) [-1109.758] -- 0:02:57 22500 -- [-1113.785] (-1111.206) (-1114.652) (-1117.279) * (-1121.913) (-1119.665) (-1116.825) [-1113.249] -- 0:02:53 23000 -- (-1114.303) [-1108.833] (-1112.816) (-1120.057) * (-1114.146) (-1116.578) [-1111.991] (-1115.547) -- 0:02:49 23500 -- (-1117.472) (-1110.102) (-1122.648) [-1113.201] * [-1114.153] (-1121.047) (-1109.305) (-1111.686) -- 0:03:27 24000 -- (-1117.703) [-1111.106] (-1120.663) (-1114.824) * (-1119.446) [-1113.938] (-1115.398) (-1114.549) -- 0:03:23 24500 -- (-1118.540) (-1117.487) (-1112.942) [-1111.029] * (-1110.639) [-1109.911] (-1115.331) (-1112.169) -- 0:03:19 25000 -- [-1108.925] (-1114.815) (-1112.543) (-1114.858) * [-1108.525] (-1115.651) (-1122.180) (-1114.567) -- 0:03:15 Average standard deviation of split frequencies: 0.018131 25500 -- [-1118.147] (-1112.981) (-1112.885) (-1118.071) * (-1111.370) (-1113.946) (-1119.882) [-1110.939] -- 0:03:11 26000 -- (-1113.666) (-1112.619) [-1114.433] (-1114.870) * [-1114.828] (-1110.067) (-1109.978) (-1113.691) -- 0:03:07 26500 -- (-1115.517) (-1115.192) (-1113.378) [-1115.511] * [-1118.430] (-1111.005) (-1116.931) (-1114.831) -- 0:03:03 27000 -- (-1118.473) (-1111.713) [-1115.824] (-1116.043) * (-1118.378) (-1119.472) [-1113.817] (-1112.602) -- 0:03:00 27500 -- (-1114.370) (-1114.252) [-1117.266] (-1118.921) * (-1121.154) (-1113.809) [-1112.667] (-1115.578) -- 0:02:56 28000 -- [-1110.514] (-1112.107) (-1118.336) (-1123.078) * (-1119.649) (-1113.168) [-1117.593] (-1112.696) -- 0:02:53 28500 -- [-1115.697] (-1115.558) (-1121.915) (-1115.376) * (-1115.211) (-1112.233) (-1119.462) [-1116.771] -- 0:02:50 29000 -- (-1119.232) (-1115.273) (-1120.717) [-1117.307] * (-1113.183) (-1118.237) [-1119.103] (-1112.523) -- 0:03:20 29500 -- (-1123.385) [-1111.185] (-1112.839) (-1116.743) * (-1117.648) (-1108.060) [-1116.577] (-1112.810) -- 0:03:17 30000 -- (-1119.895) (-1113.411) [-1114.760] (-1127.108) * [-1119.128] (-1115.660) (-1127.180) (-1120.741) -- 0:03:14 Average standard deviation of split frequencies: 0.020496 30500 -- (-1119.958) [-1114.504] (-1120.454) (-1124.364) * (-1123.075) [-1114.896] (-1123.156) (-1110.314) -- 0:03:10 31000 -- [-1112.503] (-1114.500) (-1119.476) (-1118.757) * (-1127.298) (-1117.965) [-1116.418] (-1113.983) -- 0:03:07 31500 -- [-1113.733] (-1113.036) (-1119.195) (-1114.971) * (-1118.584) [-1115.746] (-1116.590) (-1127.512) -- 0:03:04 32000 -- (-1119.151) [-1110.964] (-1115.802) (-1114.133) * [-1113.088] (-1111.655) (-1110.720) (-1114.838) -- 0:03:01 32500 -- [-1112.858] (-1111.687) (-1115.828) (-1117.773) * [-1114.591] (-1114.222) (-1116.659) (-1117.124) -- 0:02:58 33000 -- [-1113.093] (-1118.783) (-1121.935) (-1114.633) * [-1112.458] (-1113.178) (-1121.092) (-1119.368) -- 0:02:55 33500 -- (-1124.770) [-1114.605] (-1117.600) (-1125.859) * (-1124.680) (-1115.685) (-1109.663) [-1113.229] -- 0:02:53 34000 -- (-1110.630) (-1115.191) [-1114.087] (-1118.363) * (-1116.578) [-1113.096] (-1108.812) (-1115.473) -- 0:03:18 34500 -- (-1118.510) (-1119.681) [-1123.758] (-1116.959) * (-1109.811) (-1112.815) [-1114.134] (-1116.297) -- 0:03:15 35000 -- [-1118.526] (-1119.758) (-1116.670) (-1124.171) * [-1118.295] (-1117.843) (-1117.650) (-1114.105) -- 0:03:13 Average standard deviation of split frequencies: 0.013095 35500 -- (-1111.473) (-1114.502) [-1114.612] (-1117.956) * (-1116.822) [-1113.995] (-1117.587) (-1113.640) -- 0:03:10 36000 -- [-1110.588] (-1115.065) (-1117.766) (-1121.358) * (-1113.554) [-1110.109] (-1113.212) (-1119.185) -- 0:03:07 36500 -- (-1108.565) [-1111.539] (-1125.483) (-1113.432) * [-1114.864] (-1112.195) (-1119.338) (-1122.040) -- 0:03:04 37000 -- (-1114.978) (-1115.043) [-1118.710] (-1116.295) * (-1115.728) (-1121.052) (-1111.149) [-1111.553] -- 0:03:02 37500 -- (-1110.337) [-1118.766] (-1129.968) (-1118.112) * (-1111.924) (-1112.764) (-1116.453) [-1111.668] -- 0:02:59 38000 -- (-1113.836) (-1114.394) [-1118.612] (-1114.553) * [-1113.367] (-1116.773) (-1113.913) (-1116.773) -- 0:02:57 38500 -- (-1119.190) (-1117.643) (-1123.075) [-1108.522] * (-1116.248) [-1116.413] (-1114.311) (-1115.002) -- 0:02:54 39000 -- (-1117.464) (-1115.459) [-1120.851] (-1114.655) * (-1107.567) [-1116.379] (-1120.204) (-1116.566) -- 0:02:52 39500 -- (-1117.435) (-1124.268) (-1119.098) [-1118.954] * (-1110.004) (-1123.884) [-1111.210] (-1114.478) -- 0:03:14 40000 -- (-1116.383) [-1111.919] (-1117.980) (-1117.515) * [-1118.425] (-1117.877) (-1115.455) (-1114.823) -- 0:03:12 Average standard deviation of split frequencies: 0.015456 40500 -- (-1111.970) (-1111.054) (-1119.413) [-1108.447] * (-1116.679) [-1113.768] (-1120.880) (-1110.076) -- 0:03:09 41000 -- (-1111.679) (-1113.395) [-1118.950] (-1110.368) * (-1111.139) [-1116.728] (-1117.198) (-1111.316) -- 0:03:07 41500 -- [-1115.112] (-1116.083) (-1122.204) (-1109.876) * (-1113.271) (-1120.072) [-1114.640] (-1119.589) -- 0:03:04 42000 -- [-1112.722] (-1121.175) (-1126.095) (-1116.138) * (-1120.335) (-1117.417) [-1113.526] (-1114.022) -- 0:03:02 42500 -- [-1117.305] (-1118.291) (-1121.031) (-1117.623) * [-1116.280] (-1113.140) (-1128.975) (-1116.378) -- 0:03:00 43000 -- (-1114.525) [-1113.469] (-1119.402) (-1111.159) * [-1113.023] (-1113.368) (-1118.945) (-1113.190) -- 0:02:58 43500 -- (-1112.515) (-1117.743) [-1113.015] (-1110.783) * (-1118.855) [-1111.276] (-1122.483) (-1116.600) -- 0:02:55 44000 -- [-1111.458] (-1116.032) (-1118.890) (-1116.956) * (-1119.440) (-1110.844) [-1114.699] (-1112.949) -- 0:02:53 44500 -- (-1112.478) [-1110.745] (-1113.081) (-1116.665) * (-1109.250) (-1113.495) (-1121.016) [-1114.703] -- 0:02:51 45000 -- (-1121.808) (-1116.165) (-1113.365) [-1115.618] * (-1115.674) (-1116.296) (-1112.912) [-1115.506] -- 0:03:11 Average standard deviation of split frequencies: 0.010248 45500 -- (-1120.289) [-1108.507] (-1112.789) (-1114.889) * [-1109.937] (-1114.831) (-1115.829) (-1115.878) -- 0:03:08 46000 -- (-1108.207) [-1111.610] (-1116.266) (-1117.726) * [-1115.284] (-1117.923) (-1108.211) (-1124.982) -- 0:03:06 46500 -- (-1115.049) (-1119.511) (-1112.658) [-1110.338] * (-1113.077) (-1117.622) [-1110.781] (-1118.150) -- 0:03:04 47000 -- [-1115.789] (-1114.584) (-1113.983) (-1122.825) * (-1119.808) (-1113.339) [-1111.797] (-1114.374) -- 0:03:02 47500 -- [-1106.546] (-1111.951) (-1119.925) (-1117.101) * [-1120.027] (-1114.694) (-1114.510) (-1118.648) -- 0:03:00 48000 -- [-1112.761] (-1117.226) (-1120.654) (-1109.875) * (-1112.941) [-1119.258] (-1118.264) (-1116.322) -- 0:02:58 48500 -- (-1110.912) (-1120.667) (-1127.454) [-1111.269] * (-1119.075) (-1117.330) (-1111.654) [-1111.590] -- 0:02:56 49000 -- [-1113.784] (-1124.942) (-1113.183) (-1113.394) * (-1112.720) [-1111.372] (-1116.016) (-1118.284) -- 0:02:54 49500 -- (-1112.364) (-1122.238) [-1113.067] (-1113.048) * [-1116.704] (-1112.849) (-1112.162) (-1113.779) -- 0:02:52 50000 -- [-1113.654] (-1121.841) (-1118.802) (-1113.019) * (-1115.755) (-1125.173) (-1111.402) [-1113.822] -- 0:03:10 Average standard deviation of split frequencies: 0.009304 50500 -- [-1113.712] (-1113.879) (-1109.994) (-1116.704) * (-1113.622) [-1110.695] (-1114.265) (-1117.279) -- 0:03:08 51000 -- [-1120.126] (-1123.143) (-1111.247) (-1115.698) * (-1112.319) (-1111.459) [-1112.965] (-1113.145) -- 0:03:06 51500 -- (-1120.845) [-1117.336] (-1115.472) (-1123.415) * (-1122.622) (-1114.593) (-1118.764) [-1111.951] -- 0:03:04 52000 -- (-1113.698) (-1120.834) [-1113.117] (-1113.643) * [-1113.228] (-1109.859) (-1115.915) (-1112.999) -- 0:03:02 52500 -- (-1123.748) (-1123.809) [-1110.632] (-1109.959) * (-1115.435) (-1117.557) (-1117.397) [-1113.435] -- 0:03:00 53000 -- (-1122.351) (-1118.641) (-1115.237) [-1115.920] * (-1113.846) [-1108.701] (-1112.944) (-1122.501) -- 0:02:58 53500 -- (-1115.352) (-1116.498) (-1125.132) [-1112.537] * (-1110.128) [-1114.456] (-1109.685) (-1122.661) -- 0:02:56 54000 -- (-1117.698) (-1116.675) (-1120.959) [-1114.966] * [-1114.336] (-1113.197) (-1124.438) (-1122.188) -- 0:02:55 54500 -- (-1115.260) [-1111.238] (-1119.999) (-1111.962) * (-1112.732) (-1111.267) (-1122.547) [-1110.109] -- 0:02:53 55000 -- [-1111.441] (-1115.921) (-1119.110) (-1112.070) * (-1123.097) (-1107.784) (-1117.291) [-1110.088] -- 0:02:51 Average standard deviation of split frequencies: 0.016836 55500 -- [-1113.802] (-1118.217) (-1123.268) (-1114.200) * (-1115.660) (-1112.892) (-1116.988) [-1109.606] -- 0:03:07 56000 -- [-1114.068] (-1120.094) (-1117.873) (-1112.456) * [-1111.533] (-1110.287) (-1110.313) (-1109.488) -- 0:03:05 56500 -- [-1113.110] (-1113.593) (-1114.047) (-1110.346) * (-1116.516) (-1110.103) [-1108.868] (-1111.247) -- 0:03:03 57000 -- (-1113.478) (-1117.519) (-1112.952) [-1113.028] * (-1116.024) [-1113.221] (-1117.488) (-1110.870) -- 0:03:01 57500 -- [-1118.385] (-1115.772) (-1109.444) (-1112.947) * (-1117.332) (-1110.365) [-1110.515] (-1112.900) -- 0:03:00 58000 -- (-1118.156) [-1111.415] (-1111.268) (-1120.629) * (-1111.412) [-1114.897] (-1126.345) (-1117.789) -- 0:02:58 58500 -- (-1114.940) [-1114.528] (-1115.575) (-1110.339) * (-1118.277) (-1115.335) (-1115.061) [-1106.396] -- 0:02:57 59000 -- (-1112.923) (-1112.926) (-1116.519) [-1112.786] * [-1119.931] (-1113.246) (-1122.717) (-1112.001) -- 0:02:55 59500 -- [-1110.708] (-1119.335) (-1113.011) (-1118.974) * (-1112.431) (-1120.307) [-1115.202] (-1109.765) -- 0:02:53 60000 -- [-1113.486] (-1115.113) (-1115.976) (-1112.636) * [-1117.725] (-1113.592) (-1113.131) (-1113.299) -- 0:02:52 Average standard deviation of split frequencies: 0.015541 60500 -- (-1119.308) [-1112.979] (-1112.822) (-1114.204) * (-1109.423) (-1110.720) [-1116.900] (-1119.578) -- 0:03:06 61000 -- (-1117.283) (-1113.521) (-1119.476) [-1112.778] * (-1114.018) [-1111.965] (-1122.207) (-1109.994) -- 0:03:04 61500 -- (-1121.830) (-1119.808) [-1112.515] (-1114.302) * (-1116.260) [-1114.116] (-1123.506) (-1109.344) -- 0:03:03 62000 -- [-1120.156] (-1114.486) (-1119.520) (-1112.394) * (-1115.186) (-1113.165) (-1116.871) [-1111.979] -- 0:03:01 62500 -- [-1112.779] (-1123.181) (-1120.452) (-1119.650) * (-1122.778) (-1115.967) [-1116.836] (-1110.843) -- 0:03:00 63000 -- (-1119.656) (-1122.715) (-1115.276) [-1118.479] * (-1112.245) (-1117.657) [-1118.481] (-1111.061) -- 0:02:58 63500 -- (-1117.417) (-1109.203) (-1114.630) [-1115.874] * (-1118.708) [-1112.592] (-1121.581) (-1109.460) -- 0:02:56 64000 -- (-1115.837) (-1110.151) [-1112.846] (-1116.603) * (-1115.072) (-1123.071) (-1115.418) [-1116.199] -- 0:02:55 64500 -- [-1117.091] (-1112.774) (-1110.269) (-1115.797) * (-1118.409) (-1114.093) (-1115.804) [-1111.409] -- 0:02:54 65000 -- (-1116.750) (-1114.227) (-1110.974) [-1116.923] * (-1120.965) (-1113.859) (-1115.620) [-1114.593] -- 0:02:52 Average standard deviation of split frequencies: 0.019047 65500 -- [-1116.917] (-1116.217) (-1117.093) (-1118.695) * (-1118.860) (-1113.028) [-1118.933] (-1117.788) -- 0:02:51 66000 -- (-1117.642) (-1108.990) (-1110.025) [-1117.850] * (-1115.133) (-1117.279) [-1110.647] (-1116.708) -- 0:03:03 66500 -- [-1114.507] (-1118.051) (-1121.236) (-1121.257) * (-1121.836) [-1115.654] (-1115.553) (-1116.527) -- 0:03:02 67000 -- (-1116.116) (-1121.913) [-1117.965] (-1119.886) * (-1116.903) (-1118.980) (-1113.723) [-1109.491] -- 0:03:01 67500 -- [-1115.552] (-1113.760) (-1112.470) (-1117.158) * (-1119.149) (-1118.605) [-1119.194] (-1125.327) -- 0:02:59 68000 -- (-1115.711) (-1115.937) (-1113.528) [-1114.459] * [-1115.754] (-1117.740) (-1110.901) (-1114.462) -- 0:02:58 68500 -- [-1114.266] (-1115.222) (-1110.629) (-1115.758) * [-1113.419] (-1119.430) (-1111.022) (-1115.918) -- 0:02:56 69000 -- (-1119.349) [-1116.993] (-1112.885) (-1118.840) * (-1116.341) (-1113.270) (-1113.135) [-1119.194] -- 0:02:55 69500 -- (-1125.737) (-1109.341) (-1112.747) [-1115.258] * (-1118.387) [-1114.412] (-1118.304) (-1114.047) -- 0:02:54 70000 -- (-1116.057) [-1114.116] (-1117.658) (-1111.447) * (-1119.970) [-1112.840] (-1120.914) (-1110.246) -- 0:02:52 Average standard deviation of split frequencies: 0.020012 70500 -- (-1109.480) [-1115.649] (-1119.802) (-1114.361) * [-1114.005] (-1112.319) (-1118.998) (-1116.250) -- 0:02:51 71000 -- [-1114.768] (-1113.332) (-1120.332) (-1108.690) * (-1119.088) (-1118.154) [-1110.394] (-1109.656) -- 0:03:03 71500 -- (-1113.027) (-1117.779) [-1111.274] (-1113.869) * (-1115.060) (-1117.797) [-1108.308] (-1112.422) -- 0:03:01 72000 -- [-1117.442] (-1106.741) (-1113.832) (-1110.994) * (-1121.128) [-1113.847] (-1111.850) (-1113.862) -- 0:03:00 72500 -- (-1116.283) (-1116.562) [-1112.617] (-1123.140) * (-1119.880) (-1114.110) (-1118.320) [-1115.078] -- 0:02:59 73000 -- [-1112.652] (-1113.481) (-1118.742) (-1119.174) * (-1115.735) [-1112.866] (-1115.424) (-1113.542) -- 0:02:57 73500 -- (-1116.544) (-1115.455) (-1108.764) [-1117.546] * (-1116.663) (-1124.282) [-1118.667] (-1110.630) -- 0:02:56 74000 -- [-1112.210] (-1111.215) (-1111.643) (-1120.345) * (-1107.441) (-1128.950) [-1116.680] (-1115.025) -- 0:02:55 74500 -- (-1112.068) [-1110.271] (-1113.345) (-1116.858) * [-1109.726] (-1126.376) (-1118.135) (-1109.491) -- 0:02:53 75000 -- (-1111.918) (-1109.260) (-1115.636) [-1118.928] * (-1120.001) [-1120.334] (-1113.020) (-1112.867) -- 0:02:52 Average standard deviation of split frequencies: 0.016541 75500 -- (-1116.360) (-1110.562) [-1117.826] (-1123.224) * (-1116.853) [-1116.520] (-1119.577) (-1122.661) -- 0:02:51 76000 -- (-1117.391) (-1110.217) (-1119.237) [-1120.153] * (-1115.462) [-1112.150] (-1116.916) (-1120.936) -- 0:02:50 76500 -- (-1114.306) [-1119.112] (-1115.286) (-1117.559) * (-1114.644) (-1116.940) [-1112.547] (-1119.996) -- 0:03:01 77000 -- (-1118.113) [-1115.762] (-1111.818) (-1121.328) * (-1114.696) (-1121.120) (-1118.014) [-1114.677] -- 0:02:59 77500 -- (-1119.451) (-1119.665) [-1115.788] (-1116.924) * [-1111.584] (-1117.353) (-1117.779) (-1115.009) -- 0:02:58 78000 -- [-1109.647] (-1122.683) (-1117.037) (-1113.282) * [-1108.646] (-1118.368) (-1117.128) (-1115.308) -- 0:02:57 78500 -- (-1122.699) (-1115.436) [-1112.756] (-1123.678) * (-1112.501) (-1119.849) [-1112.328] (-1110.687) -- 0:02:56 79000 -- (-1118.930) (-1112.019) [-1114.462] (-1111.556) * [-1110.622] (-1112.871) (-1113.738) (-1108.985) -- 0:02:54 79500 -- (-1114.867) (-1112.362) (-1117.916) [-1109.379] * (-1118.249) (-1114.743) (-1112.446) [-1112.394] -- 0:02:53 80000 -- (-1112.499) [-1111.299] (-1111.683) (-1115.890) * (-1116.444) (-1114.500) [-1118.910] (-1118.902) -- 0:02:52 Average standard deviation of split frequencies: 0.015584 80500 -- (-1119.138) (-1117.671) (-1110.463) [-1111.445] * (-1112.242) (-1111.633) [-1112.392] (-1115.749) -- 0:02:51 81000 -- (-1124.072) (-1116.217) (-1115.669) [-1110.122] * [-1112.028] (-1108.853) (-1120.336) (-1120.759) -- 0:02:50 81500 -- (-1119.362) (-1114.408) (-1113.180) [-1117.540] * (-1117.974) (-1121.940) [-1115.853] (-1113.666) -- 0:03:00 82000 -- (-1118.611) (-1113.000) [-1113.735] (-1121.561) * (-1118.980) [-1118.672] (-1115.913) (-1114.011) -- 0:02:59 82500 -- (-1116.706) (-1113.615) [-1112.329] (-1127.176) * (-1113.585) [-1109.946] (-1117.067) (-1115.575) -- 0:02:57 83000 -- (-1120.259) (-1112.406) [-1114.140] (-1123.855) * (-1122.852) [-1114.233] (-1113.283) (-1114.252) -- 0:02:56 83500 -- (-1112.578) (-1112.703) [-1114.102] (-1111.651) * (-1121.511) [-1108.370] (-1114.376) (-1120.884) -- 0:02:55 84000 -- [-1108.100] (-1117.850) (-1114.446) (-1112.455) * (-1112.128) (-1112.210) [-1113.829] (-1107.222) -- 0:02:54 84500 -- (-1117.521) (-1114.768) [-1115.594] (-1114.620) * [-1110.327] (-1114.471) (-1119.707) (-1119.199) -- 0:02:53 85000 -- [-1113.861] (-1107.604) (-1118.166) (-1112.968) * (-1115.177) [-1112.416] (-1118.747) (-1112.985) -- 0:02:52 Average standard deviation of split frequencies: 0.014617 85500 -- (-1114.585) (-1113.536) (-1118.041) [-1108.729] * (-1110.805) (-1115.660) (-1115.808) [-1112.826] -- 0:02:51 86000 -- [-1110.968] (-1112.737) (-1111.842) (-1117.553) * [-1111.792] (-1118.203) (-1115.940) (-1118.950) -- 0:02:50 86500 -- (-1114.789) (-1113.833) (-1115.240) [-1111.888] * (-1111.127) [-1112.606] (-1129.382) (-1119.310) -- 0:02:59 87000 -- (-1113.544) (-1117.244) (-1121.765) [-1110.353] * [-1119.809] (-1109.876) (-1127.775) (-1128.969) -- 0:02:58 87500 -- (-1120.518) (-1120.041) (-1114.563) [-1117.038] * (-1115.727) (-1114.292) (-1128.499) [-1113.170] -- 0:02:57 88000 -- [-1120.278] (-1113.901) (-1114.049) (-1119.310) * (-1118.813) [-1113.283] (-1124.835) (-1118.979) -- 0:02:56 88500 -- (-1129.204) (-1115.665) (-1117.305) [-1111.783] * (-1118.818) [-1114.399] (-1121.697) (-1115.426) -- 0:02:55 89000 -- (-1128.706) (-1119.736) [-1111.737] (-1116.985) * (-1111.915) [-1113.167] (-1122.868) (-1109.631) -- 0:02:54 89500 -- (-1120.652) (-1116.087) [-1107.747] (-1119.164) * (-1113.626) [-1115.865] (-1120.431) (-1118.973) -- 0:02:52 90000 -- (-1115.103) [-1115.270] (-1114.751) (-1118.300) * (-1117.878) [-1113.359] (-1119.849) (-1116.457) -- 0:02:51 Average standard deviation of split frequencies: 0.015598 90500 -- (-1115.528) (-1113.754) [-1116.238] (-1115.114) * (-1120.135) [-1114.029] (-1115.029) (-1115.797) -- 0:02:50 91000 -- (-1114.309) (-1119.463) (-1122.061) [-1113.871] * (-1116.606) [-1113.227] (-1116.876) (-1110.905) -- 0:02:49 91500 -- [-1115.960] (-1117.016) (-1119.286) (-1112.107) * (-1120.914) (-1115.254) [-1110.630] (-1115.697) -- 0:02:48 92000 -- (-1124.634) (-1115.873) (-1113.670) [-1122.331] * (-1122.612) (-1117.080) (-1111.215) [-1110.076] -- 0:02:57 92500 -- [-1114.488] (-1113.613) (-1115.855) (-1117.642) * (-1124.478) (-1114.083) [-1111.368] (-1114.969) -- 0:02:56 93000 -- (-1115.113) [-1112.349] (-1121.657) (-1115.175) * (-1114.382) [-1118.432] (-1115.004) (-1114.659) -- 0:02:55 93500 -- (-1114.666) [-1110.943] (-1119.927) (-1116.110) * (-1118.388) (-1113.145) (-1113.828) [-1114.288] -- 0:02:54 94000 -- (-1116.708) (-1110.438) (-1118.932) [-1108.982] * [-1116.860] (-1114.576) (-1111.540) (-1111.874) -- 0:02:53 94500 -- (-1120.360) [-1116.291] (-1134.301) (-1109.135) * (-1116.886) [-1115.893] (-1119.031) (-1115.711) -- 0:02:52 95000 -- (-1120.212) (-1116.472) [-1117.728] (-1119.752) * (-1112.301) (-1121.750) (-1117.979) [-1110.677] -- 0:02:51 Average standard deviation of split frequencies: 0.014731 95500 -- [-1112.301] (-1109.931) (-1117.268) (-1119.722) * [-1113.018] (-1121.516) (-1113.901) (-1114.014) -- 0:02:50 96000 -- (-1113.524) (-1112.054) (-1118.139) [-1117.922] * (-1116.337) (-1115.002) (-1116.278) [-1113.931] -- 0:02:49 96500 -- (-1113.512) (-1108.352) (-1125.163) [-1118.124] * (-1109.689) (-1113.569) (-1114.055) [-1114.024] -- 0:02:48 97000 -- (-1115.098) [-1111.724] (-1124.150) (-1116.084) * (-1120.119) (-1128.261) [-1115.458] (-1118.955) -- 0:02:56 97500 -- (-1111.005) [-1110.424] (-1120.432) (-1116.917) * [-1118.626] (-1119.684) (-1117.951) (-1113.564) -- 0:02:55 98000 -- (-1116.541) (-1115.881) [-1117.018] (-1113.112) * (-1115.309) (-1120.531) [-1116.765] (-1115.581) -- 0:02:54 98500 -- (-1119.228) (-1119.577) [-1119.837] (-1114.447) * [-1109.396] (-1112.423) (-1114.176) (-1121.760) -- 0:02:53 99000 -- (-1112.851) [-1113.586] (-1125.306) (-1118.247) * [-1112.391] (-1113.461) (-1111.287) (-1121.842) -- 0:02:52 99500 -- (-1111.834) (-1112.152) [-1117.879] (-1117.101) * (-1113.518) (-1122.770) [-1107.787] (-1117.348) -- 0:02:51 100000 -- (-1111.289) [-1115.549] (-1122.549) (-1118.168) * (-1113.501) (-1110.639) (-1111.891) [-1114.319] -- 0:02:51 Average standard deviation of split frequencies: 0.014048 100500 -- (-1116.792) [-1116.028] (-1120.133) (-1115.908) * (-1121.558) (-1114.157) [-1113.566] (-1111.636) -- 0:02:50 101000 -- (-1116.747) (-1113.112) [-1118.153] (-1117.352) * (-1112.890) (-1113.792) [-1114.774] (-1112.087) -- 0:02:49 101500 -- (-1119.080) (-1119.984) (-1117.389) [-1112.585] * (-1119.314) [-1117.338] (-1109.564) (-1122.902) -- 0:02:48 102000 -- (-1116.830) (-1109.160) (-1118.109) [-1113.096] * (-1108.944) [-1113.879] (-1116.758) (-1108.943) -- 0:02:56 102500 -- [-1114.025] (-1117.107) (-1112.129) (-1114.812) * (-1112.801) (-1121.161) (-1113.960) [-1108.883] -- 0:02:55 103000 -- (-1114.335) (-1112.863) (-1115.951) [-1114.828] * (-1115.802) (-1118.038) (-1113.520) [-1110.385] -- 0:02:54 103500 -- [-1117.437] (-1119.854) (-1122.766) (-1112.366) * (-1115.170) (-1115.301) [-1116.017] (-1113.288) -- 0:02:53 104000 -- (-1116.115) [-1111.463] (-1117.935) (-1116.785) * (-1111.820) (-1116.356) (-1117.347) [-1107.531] -- 0:02:52 104500 -- (-1113.297) (-1116.202) (-1118.985) [-1114.909] * (-1113.950) (-1114.053) [-1112.195] (-1110.488) -- 0:02:51 105000 -- (-1114.576) (-1116.990) (-1111.672) [-1110.519] * (-1111.220) (-1121.024) [-1113.521] (-1119.662) -- 0:02:50 Average standard deviation of split frequencies: 0.014824 105500 -- (-1109.811) [-1114.042] (-1112.968) (-1122.646) * (-1116.601) (-1116.973) (-1113.782) [-1113.927] -- 0:02:49 106000 -- (-1118.579) (-1109.417) [-1117.783] (-1116.727) * (-1116.950) [-1107.949] (-1112.370) (-1119.921) -- 0:02:48 106500 -- (-1113.799) (-1120.706) (-1116.076) [-1117.387] * (-1119.060) [-1115.420] (-1114.308) (-1121.690) -- 0:02:47 107000 -- [-1116.199] (-1119.265) (-1118.101) (-1112.701) * (-1111.320) [-1112.767] (-1116.970) (-1120.415) -- 0:02:46 107500 -- (-1114.397) (-1115.033) (-1116.219) [-1113.199] * (-1117.094) [-1110.916] (-1112.582) (-1114.082) -- 0:02:54 108000 -- (-1115.198) [-1112.170] (-1112.859) (-1113.103) * (-1113.880) (-1118.523) [-1115.827] (-1118.515) -- 0:02:53 108500 -- (-1115.329) (-1115.529) [-1114.332] (-1116.796) * (-1121.976) (-1109.752) [-1112.582] (-1111.542) -- 0:02:52 109000 -- (-1117.113) (-1116.043) [-1113.822] (-1112.449) * (-1117.473) [-1110.849] (-1116.323) (-1111.575) -- 0:02:51 109500 -- (-1112.287) (-1117.033) [-1110.152] (-1112.532) * (-1128.166) [-1114.802] (-1113.832) (-1112.478) -- 0:02:50 110000 -- (-1115.440) (-1117.700) (-1112.032) [-1108.663] * (-1125.847) [-1110.927] (-1112.648) (-1117.107) -- 0:02:49 Average standard deviation of split frequencies: 0.012779 110500 -- (-1114.168) (-1110.593) [-1116.552] (-1118.563) * (-1125.406) (-1109.479) [-1111.768] (-1115.657) -- 0:02:49 111000 -- (-1113.269) [-1112.693] (-1116.231) (-1113.831) * (-1109.556) (-1112.562) [-1112.019] (-1111.846) -- 0:02:48 111500 -- (-1113.859) (-1116.966) (-1114.634) [-1113.899] * [-1111.623] (-1108.869) (-1117.998) (-1112.628) -- 0:02:47 112000 -- (-1117.726) (-1113.484) (-1119.831) [-1112.603] * (-1111.376) [-1109.412] (-1117.250) (-1112.770) -- 0:02:46 112500 -- (-1116.690) (-1116.967) (-1125.680) [-1111.044] * (-1114.357) [-1115.096] (-1113.179) (-1111.176) -- 0:02:53 113000 -- (-1117.526) (-1110.924) (-1120.873) [-1110.933] * [-1113.008] (-1113.833) (-1117.146) (-1116.524) -- 0:02:52 113500 -- (-1115.725) [-1115.108] (-1119.135) (-1112.737) * [-1112.687] (-1116.199) (-1122.006) (-1115.365) -- 0:02:51 114000 -- (-1116.606) (-1116.307) (-1116.847) [-1114.676] * (-1112.597) [-1110.406] (-1120.284) (-1115.632) -- 0:02:50 114500 -- [-1115.472] (-1111.580) (-1116.614) (-1112.465) * (-1112.685) (-1113.548) (-1115.578) [-1116.202] -- 0:02:50 115000 -- [-1112.674] (-1109.816) (-1119.416) (-1116.062) * (-1121.990) (-1112.752) (-1117.872) [-1113.399] -- 0:02:49 Average standard deviation of split frequencies: 0.013546 115500 -- (-1111.555) (-1116.972) (-1114.480) [-1116.115] * (-1109.601) (-1116.169) (-1116.625) [-1112.500] -- 0:02:48 116000 -- (-1111.841) (-1117.511) (-1124.631) [-1112.768] * (-1113.400) [-1108.142] (-1120.221) (-1114.269) -- 0:02:47 116500 -- [-1116.779] (-1121.913) (-1120.384) (-1121.605) * [-1112.902] (-1110.950) (-1122.010) (-1115.006) -- 0:02:46 117000 -- (-1122.503) (-1116.354) (-1117.834) [-1108.548] * (-1111.537) (-1110.893) (-1121.872) [-1119.462] -- 0:02:46 117500 -- (-1122.951) [-1116.034] (-1120.544) (-1114.283) * (-1114.721) [-1114.147] (-1116.443) (-1116.634) -- 0:02:52 118000 -- (-1119.754) [-1109.722] (-1123.376) (-1112.686) * (-1114.018) (-1115.435) [-1110.017] (-1115.265) -- 0:02:51 118500 -- [-1120.257] (-1116.943) (-1119.532) (-1112.649) * (-1115.254) (-1111.886) [-1110.075] (-1111.114) -- 0:02:51 119000 -- [-1113.069] (-1113.117) (-1118.929) (-1118.961) * (-1114.369) [-1111.004] (-1115.407) (-1108.071) -- 0:02:50 119500 -- (-1120.895) (-1113.872) [-1113.900] (-1120.157) * (-1116.891) [-1111.190] (-1108.709) (-1107.733) -- 0:02:49 120000 -- (-1117.850) (-1118.501) [-1117.943] (-1116.689) * (-1119.720) (-1118.974) [-1114.577] (-1114.420) -- 0:02:48 Average standard deviation of split frequencies: 0.013022 120500 -- [-1111.501] (-1114.145) (-1118.315) (-1115.238) * (-1114.072) (-1112.948) [-1109.469] (-1109.910) -- 0:02:47 121000 -- (-1115.228) [-1107.322] (-1118.263) (-1119.555) * (-1119.005) [-1114.463] (-1115.229) (-1116.098) -- 0:02:47 121500 -- (-1112.116) (-1110.787) [-1111.248] (-1122.205) * (-1113.250) (-1110.495) [-1117.190] (-1113.344) -- 0:02:46 122000 -- (-1118.701) (-1114.387) [-1117.635] (-1118.470) * (-1120.477) (-1119.534) (-1115.379) [-1108.423] -- 0:02:45 122500 -- [-1110.418] (-1114.188) (-1114.909) (-1116.097) * (-1108.548) (-1114.815) [-1108.177] (-1118.509) -- 0:02:44 123000 -- (-1119.897) [-1110.418] (-1115.417) (-1113.753) * (-1109.771) (-1116.491) (-1113.593) [-1111.083] -- 0:02:51 123500 -- (-1119.977) (-1109.691) (-1121.490) [-1113.617] * [-1111.833] (-1118.640) (-1108.828) (-1112.921) -- 0:02:50 124000 -- (-1112.534) [-1108.531] (-1111.149) (-1110.851) * (-1115.489) (-1118.322) (-1111.915) [-1118.705] -- 0:02:49 124500 -- [-1115.980] (-1114.001) (-1113.619) (-1118.821) * (-1113.920) [-1118.494] (-1112.198) (-1113.067) -- 0:02:48 125000 -- (-1120.951) (-1120.348) (-1112.798) [-1116.221] * [-1114.087] (-1111.719) (-1115.696) (-1113.862) -- 0:02:48 Average standard deviation of split frequencies: 0.012471 125500 -- (-1108.123) [-1110.848] (-1115.084) (-1113.230) * (-1111.925) (-1118.815) [-1114.084] (-1115.289) -- 0:02:47 126000 -- (-1113.485) (-1116.397) [-1111.623] (-1118.895) * (-1110.704) [-1116.528] (-1116.521) (-1120.299) -- 0:02:46 126500 -- [-1115.664] (-1117.685) (-1114.591) (-1120.676) * [-1109.058] (-1113.717) (-1113.767) (-1118.976) -- 0:02:45 127000 -- (-1123.024) (-1112.738) (-1113.346) [-1111.591] * (-1116.990) (-1117.591) (-1115.155) [-1113.202] -- 0:02:44 127500 -- (-1112.959) (-1115.806) (-1119.942) [-1115.772] * (-1110.463) [-1115.663] (-1118.691) (-1109.070) -- 0:02:44 128000 -- (-1109.749) [-1118.652] (-1113.318) (-1116.229) * (-1114.806) (-1111.441) [-1118.123] (-1109.041) -- 0:02:50 128500 -- [-1113.223] (-1112.356) (-1115.166) (-1119.371) * (-1112.645) (-1108.995) [-1112.738] (-1119.774) -- 0:02:49 129000 -- (-1112.625) [-1111.769] (-1117.476) (-1112.458) * (-1113.340) (-1112.571) (-1112.873) [-1117.550] -- 0:02:48 129500 -- (-1114.850) [-1119.898] (-1127.864) (-1115.654) * (-1115.732) [-1113.149] (-1125.536) (-1113.244) -- 0:02:48 130000 -- (-1110.130) [-1114.550] (-1116.361) (-1121.033) * (-1119.560) (-1119.800) [-1115.639] (-1112.207) -- 0:02:47 Average standard deviation of split frequencies: 0.012026 130500 -- (-1115.799) (-1118.433) [-1117.754] (-1117.102) * [-1114.013] (-1114.646) (-1116.199) (-1113.979) -- 0:02:46 131000 -- [-1114.888] (-1121.482) (-1113.996) (-1116.706) * (-1117.026) (-1111.874) [-1113.081] (-1117.637) -- 0:02:45 131500 -- (-1113.476) (-1111.537) (-1117.945) [-1122.294] * (-1116.891) (-1108.832) (-1125.732) [-1126.393] -- 0:02:45 132000 -- [-1109.202] (-1111.378) (-1116.193) (-1125.438) * (-1117.750) (-1116.931) [-1118.700] (-1115.008) -- 0:02:44 132500 -- [-1113.803] (-1115.072) (-1113.059) (-1113.180) * (-1111.381) (-1120.335) (-1119.979) [-1116.199] -- 0:02:43 133000 -- (-1113.342) (-1118.447) (-1116.114) [-1113.383] * (-1109.141) (-1118.641) [-1111.529] (-1111.654) -- 0:02:49 133500 -- (-1110.733) [-1119.689] (-1113.061) (-1116.676) * (-1113.814) (-1112.756) [-1113.776] (-1113.899) -- 0:02:48 134000 -- (-1113.558) [-1113.732] (-1115.323) (-1108.424) * (-1109.860) [-1111.862] (-1112.236) (-1117.441) -- 0:02:48 134500 -- (-1114.839) (-1115.019) [-1113.280] (-1115.193) * (-1114.725) (-1116.780) (-1109.031) [-1113.622] -- 0:02:47 135000 -- [-1111.213] (-1118.973) (-1123.716) (-1114.418) * (-1117.912) [-1110.674] (-1123.116) (-1116.007) -- 0:02:46 Average standard deviation of split frequencies: 0.013865 135500 -- (-1120.148) (-1116.892) (-1121.918) [-1116.476] * [-1115.511] (-1119.871) (-1116.479) (-1116.145) -- 0:02:45 136000 -- (-1118.401) [-1117.159] (-1117.812) (-1112.035) * (-1130.908) [-1117.952] (-1112.632) (-1112.314) -- 0:02:45 136500 -- [-1115.273] (-1113.716) (-1114.565) (-1115.418) * (-1116.444) (-1112.430) [-1118.711] (-1111.366) -- 0:02:44 137000 -- (-1117.855) (-1117.192) [-1116.851] (-1114.902) * (-1115.229) (-1117.025) (-1119.986) [-1109.201] -- 0:02:43 137500 -- [-1112.249] (-1113.206) (-1112.800) (-1129.027) * (-1112.150) (-1112.412) [-1115.155] (-1113.471) -- 0:02:43 138000 -- (-1118.364) [-1110.533] (-1115.166) (-1121.122) * [-1109.853] (-1114.160) (-1112.960) (-1116.631) -- 0:02:42 138500 -- (-1114.640) [-1111.566] (-1117.651) (-1114.689) * [-1113.589] (-1111.128) (-1116.307) (-1114.262) -- 0:02:47 139000 -- (-1113.528) (-1117.866) (-1112.904) [-1120.692] * [-1114.969] (-1114.136) (-1111.040) (-1113.150) -- 0:02:47 139500 -- (-1118.296) (-1112.245) (-1109.911) [-1120.309] * (-1119.578) (-1110.488) (-1112.642) [-1116.692] -- 0:02:46 140000 -- (-1115.877) (-1116.190) [-1108.806] (-1118.080) * (-1114.950) [-1113.330] (-1118.233) (-1120.112) -- 0:02:45 Average standard deviation of split frequencies: 0.011171 140500 -- (-1113.977) (-1114.828) [-1112.676] (-1117.630) * [-1116.138] (-1112.824) (-1118.529) (-1118.504) -- 0:02:45 141000 -- (-1124.114) [-1111.140] (-1108.069) (-1114.096) * (-1116.519) [-1116.033] (-1119.274) (-1122.679) -- 0:02:44 141500 -- (-1120.618) [-1111.988] (-1118.537) (-1114.845) * [-1113.840] (-1111.419) (-1124.237) (-1116.806) -- 0:02:43 142000 -- (-1117.325) [-1111.978] (-1116.042) (-1114.313) * (-1125.649) (-1114.280) (-1114.908) [-1126.874] -- 0:02:43 142500 -- (-1118.989) (-1123.493) (-1112.429) [-1113.014] * [-1121.086] (-1113.507) (-1112.617) (-1119.119) -- 0:02:42 143000 -- (-1116.616) (-1117.452) (-1114.357) [-1109.556] * [-1108.647] (-1112.465) (-1112.731) (-1119.932) -- 0:02:41 143500 -- [-1116.224] (-1113.590) (-1122.426) (-1116.649) * (-1118.218) (-1120.337) (-1112.812) [-1115.024] -- 0:02:47 144000 -- [-1115.922] (-1111.182) (-1125.329) (-1115.822) * (-1118.793) (-1112.272) [-1111.504] (-1116.920) -- 0:02:46 144500 -- [-1110.707] (-1114.080) (-1113.837) (-1116.319) * (-1127.356) (-1110.599) (-1116.768) [-1117.343] -- 0:02:45 145000 -- (-1115.223) (-1109.479) [-1129.729] (-1117.126) * (-1126.168) [-1113.384] (-1116.094) (-1109.538) -- 0:02:45 Average standard deviation of split frequencies: 0.009686 145500 -- (-1121.347) (-1114.074) [-1114.190] (-1113.063) * (-1120.247) [-1113.144] (-1123.863) (-1110.182) -- 0:02:44 146000 -- (-1115.312) [-1117.877] (-1115.715) (-1117.380) * (-1113.281) [-1111.188] (-1132.097) (-1113.755) -- 0:02:43 146500 -- [-1111.842] (-1121.689) (-1114.469) (-1113.438) * (-1120.911) (-1110.129) [-1116.166] (-1119.193) -- 0:02:43 147000 -- [-1110.578] (-1111.828) (-1115.277) (-1115.031) * [-1111.712] (-1112.569) (-1120.461) (-1118.845) -- 0:02:42 147500 -- [-1110.980] (-1111.883) (-1125.598) (-1108.072) * (-1109.266) (-1109.045) (-1118.290) [-1113.435] -- 0:02:41 148000 -- (-1111.111) (-1113.303) (-1113.922) [-1112.246] * (-1112.260) (-1111.830) (-1120.236) [-1108.598] -- 0:02:41 148500 -- (-1115.416) [-1118.269] (-1112.255) (-1114.451) * (-1109.708) (-1117.162) (-1107.980) [-1109.113] -- 0:02:46 149000 -- [-1115.417] (-1113.023) (-1114.843) (-1122.205) * (-1113.464) [-1115.616] (-1109.873) (-1118.711) -- 0:02:45 149500 -- [-1115.648] (-1113.039) (-1116.964) (-1122.012) * [-1117.313] (-1113.772) (-1115.720) (-1117.590) -- 0:02:44 150000 -- (-1112.089) (-1113.782) (-1110.541) [-1111.207] * (-1115.510) (-1116.453) (-1120.655) [-1113.838] -- 0:02:44 Average standard deviation of split frequencies: 0.008343 150500 -- (-1112.613) [-1111.772] (-1121.820) (-1110.988) * [-1115.004] (-1117.128) (-1113.091) (-1117.258) -- 0:02:43 151000 -- [-1114.054] (-1122.660) (-1120.872) (-1114.022) * (-1126.192) (-1116.321) (-1118.411) [-1115.911] -- 0:02:43 151500 -- (-1113.598) (-1116.025) [-1112.732] (-1118.547) * (-1114.588) (-1123.980) [-1116.214] (-1115.222) -- 0:02:42 152000 -- (-1112.230) (-1120.787) (-1116.230) [-1110.326] * [-1119.061] (-1125.031) (-1113.625) (-1114.525) -- 0:02:41 152500 -- (-1110.576) (-1119.018) (-1122.813) [-1112.207] * [-1121.839] (-1124.371) (-1117.897) (-1114.715) -- 0:02:41 153000 -- (-1116.768) (-1111.486) [-1112.371] (-1112.491) * [-1117.053] (-1115.174) (-1112.900) (-1115.510) -- 0:02:40 153500 -- [-1113.553] (-1110.760) (-1112.793) (-1117.178) * (-1111.378) (-1119.091) [-1117.652] (-1115.569) -- 0:02:39 154000 -- [-1113.134] (-1111.528) (-1110.854) (-1119.888) * (-1116.212) (-1120.883) [-1116.896] (-1121.057) -- 0:02:44 154500 -- (-1120.870) (-1115.138) (-1109.756) [-1112.560] * (-1117.566) (-1111.827) (-1115.428) [-1122.313] -- 0:02:44 155000 -- (-1110.006) [-1117.276] (-1119.014) (-1120.687) * (-1118.380) (-1116.653) (-1112.378) [-1113.296] -- 0:02:43 Average standard deviation of split frequencies: 0.007051 155500 -- (-1113.631) (-1120.800) [-1125.696] (-1118.031) * (-1120.295) (-1118.592) (-1119.146) [-1112.986] -- 0:02:42 156000 -- (-1111.842) [-1113.161] (-1120.204) (-1118.545) * (-1118.045) (-1114.188) (-1114.850) [-1108.208] -- 0:02:42 156500 -- [-1116.167] (-1118.508) (-1121.804) (-1124.380) * (-1114.547) [-1114.128] (-1123.068) (-1116.579) -- 0:02:41 157000 -- (-1113.428) [-1111.766] (-1116.811) (-1120.669) * (-1115.183) (-1116.089) [-1114.951] (-1119.386) -- 0:02:41 157500 -- (-1114.342) [-1111.316] (-1114.111) (-1117.420) * [-1114.952] (-1122.933) (-1110.297) (-1113.348) -- 0:02:40 158000 -- (-1113.018) [-1112.182] (-1120.841) (-1114.149) * (-1114.414) (-1122.938) (-1118.652) [-1112.509] -- 0:02:39 158500 -- (-1115.886) (-1115.061) (-1111.536) [-1110.821] * [-1116.090] (-1119.839) (-1111.727) (-1108.990) -- 0:02:39 159000 -- (-1114.629) (-1122.288) [-1116.305] (-1114.821) * (-1117.214) (-1116.035) (-1109.670) [-1113.535] -- 0:02:43 159500 -- (-1117.387) [-1110.693] (-1115.011) (-1117.810) * [-1111.860] (-1117.400) (-1108.708) (-1117.705) -- 0:02:43 160000 -- [-1114.917] (-1118.088) (-1118.078) (-1118.839) * (-1118.347) [-1111.030] (-1115.495) (-1116.218) -- 0:02:42 Average standard deviation of split frequencies: 0.006846 160500 -- [-1118.317] (-1126.300) (-1113.707) (-1123.482) * (-1117.047) [-1109.543] (-1112.298) (-1110.772) -- 0:02:42 161000 -- (-1111.982) (-1128.341) (-1115.337) [-1118.931] * (-1112.065) [-1112.286] (-1112.203) (-1110.261) -- 0:02:41 161500 -- [-1112.112] (-1115.873) (-1109.254) (-1113.601) * [-1115.983] (-1117.282) (-1115.716) (-1122.728) -- 0:02:40 162000 -- [-1113.211] (-1114.983) (-1113.258) (-1111.617) * (-1124.522) (-1114.579) [-1112.938] (-1128.199) -- 0:02:40 162500 -- (-1119.177) (-1118.240) [-1117.814] (-1118.510) * [-1114.841] (-1115.977) (-1110.468) (-1113.571) -- 0:02:39 163000 -- (-1111.953) (-1112.148) [-1106.123] (-1118.523) * (-1113.873) (-1109.443) [-1115.811] (-1121.392) -- 0:02:39 163500 -- [-1109.559] (-1117.794) (-1111.963) (-1111.384) * (-1121.783) [-1118.140] (-1116.911) (-1117.068) -- 0:02:38 164000 -- (-1110.390) (-1115.559) (-1114.032) [-1110.498] * (-1119.037) (-1111.990) [-1115.866] (-1110.404) -- 0:02:43 164500 -- [-1120.889] (-1113.715) (-1112.074) (-1115.284) * [-1113.294] (-1113.349) (-1116.822) (-1111.889) -- 0:02:42 165000 -- (-1119.205) (-1122.337) [-1109.434] (-1113.750) * (-1113.366) (-1115.213) [-1111.961] (-1107.249) -- 0:02:41 Average standard deviation of split frequencies: 0.010413 165500 -- (-1115.727) (-1129.811) (-1114.660) [-1112.998] * (-1117.262) (-1112.440) [-1112.130] (-1108.282) -- 0:02:41 166000 -- (-1112.284) [-1116.461] (-1116.752) (-1112.022) * (-1119.607) (-1117.324) (-1114.683) [-1112.537] -- 0:02:40 166500 -- (-1117.395) [-1123.368] (-1124.153) (-1109.181) * (-1112.954) (-1117.199) [-1116.137] (-1114.125) -- 0:02:40 167000 -- [-1118.653] (-1118.597) (-1114.473) (-1109.832) * (-1116.252) [-1122.015] (-1122.522) (-1112.599) -- 0:02:39 167500 -- (-1121.157) (-1119.774) [-1111.911] (-1111.063) * (-1117.830) (-1116.561) [-1112.744] (-1112.221) -- 0:02:39 168000 -- (-1110.722) (-1117.239) (-1112.522) [-1109.253] * (-1116.342) (-1114.902) (-1120.532) [-1110.744] -- 0:02:38 168500 -- [-1112.664] (-1115.547) (-1115.866) (-1120.172) * (-1111.173) (-1119.755) [-1109.988] (-1109.119) -- 0:02:37 169000 -- (-1115.314) [-1112.473] (-1113.530) (-1119.911) * (-1113.660) [-1115.095] (-1113.221) (-1117.918) -- 0:02:37 169500 -- (-1112.163) (-1113.970) (-1117.917) [-1114.300] * (-1119.118) (-1115.034) [-1111.242] (-1108.038) -- 0:02:41 170000 -- (-1115.648) (-1118.178) (-1117.303) [-1113.402] * (-1129.428) (-1110.631) [-1114.705] (-1124.661) -- 0:02:41 Average standard deviation of split frequencies: 0.008286 170500 -- (-1112.662) (-1116.384) (-1111.774) [-1112.029] * (-1115.307) [-1113.804] (-1117.146) (-1121.529) -- 0:02:40 171000 -- [-1113.672] (-1110.507) (-1118.278) (-1112.256) * [-1122.974] (-1118.925) (-1113.660) (-1116.900) -- 0:02:39 171500 -- (-1112.361) (-1111.734) [-1114.296] (-1118.529) * [-1108.206] (-1116.107) (-1117.402) (-1121.231) -- 0:02:39 172000 -- (-1109.731) (-1115.723) [-1110.256] (-1112.431) * [-1110.820] (-1116.102) (-1111.826) (-1117.302) -- 0:02:38 172500 -- (-1119.738) [-1116.586] (-1114.521) (-1115.799) * (-1113.041) [-1113.544] (-1112.792) (-1110.902) -- 0:02:38 173000 -- (-1115.276) (-1116.804) [-1113.493] (-1114.642) * (-1115.448) (-1116.121) (-1115.242) [-1107.320] -- 0:02:37 173500 -- (-1110.128) (-1116.173) [-1113.685] (-1110.546) * [-1115.298] (-1115.955) (-1113.909) (-1122.943) -- 0:02:37 174000 -- [-1113.632] (-1111.797) (-1116.669) (-1125.370) * (-1116.023) (-1129.813) [-1110.201] (-1115.087) -- 0:02:36 174500 -- (-1114.133) [-1116.904] (-1116.937) (-1115.906) * [-1112.546] (-1117.702) (-1118.987) (-1124.121) -- 0:02:40 175000 -- (-1116.739) (-1110.387) [-1108.475] (-1115.084) * (-1120.554) (-1118.108) (-1113.545) [-1120.002] -- 0:02:40 Average standard deviation of split frequencies: 0.007142 175500 -- (-1118.855) [-1110.311] (-1117.726) (-1118.954) * (-1113.521) (-1114.848) [-1114.693] (-1113.500) -- 0:02:39 176000 -- (-1113.702) (-1116.292) (-1115.381) [-1118.261] * (-1113.147) (-1116.655) [-1118.888] (-1119.214) -- 0:02:39 176500 -- (-1112.158) [-1113.205] (-1107.967) (-1129.579) * (-1114.623) [-1114.244] (-1118.079) (-1121.559) -- 0:02:38 177000 -- (-1115.401) (-1112.095) (-1120.566) [-1111.968] * (-1111.310) (-1117.231) [-1116.198] (-1118.632) -- 0:02:38 177500 -- (-1112.872) (-1114.536) [-1123.469] (-1116.585) * [-1109.080] (-1113.042) (-1119.659) (-1115.143) -- 0:02:37 178000 -- (-1116.483) (-1113.234) [-1114.611] (-1119.164) * (-1117.318) (-1117.700) [-1117.399] (-1113.384) -- 0:02:37 178500 -- (-1122.717) [-1122.455] (-1116.077) (-1122.171) * (-1115.677) [-1112.939] (-1117.087) (-1113.703) -- 0:02:36 179000 -- (-1115.079) (-1123.050) [-1115.373] (-1113.688) * (-1114.226) [-1115.602] (-1117.554) (-1119.256) -- 0:02:35 179500 -- (-1109.856) [-1121.035] (-1112.088) (-1118.830) * (-1112.820) (-1123.650) (-1119.590) [-1111.998] -- 0:02:39 180000 -- (-1114.475) [-1111.295] (-1123.082) (-1115.579) * (-1118.848) (-1110.996) [-1118.386] (-1116.930) -- 0:02:39 Average standard deviation of split frequencies: 0.006088 180500 -- (-1114.980) [-1114.762] (-1124.892) (-1114.134) * (-1110.518) [-1111.600] (-1119.698) (-1121.108) -- 0:02:38 181000 -- (-1115.821) [-1118.894] (-1113.551) (-1111.184) * (-1112.489) (-1117.546) [-1118.909] (-1116.692) -- 0:02:38 181500 -- (-1115.946) (-1123.763) [-1115.664] (-1116.108) * (-1116.561) (-1110.746) [-1109.064] (-1119.721) -- 0:02:37 182000 -- [-1118.017] (-1113.529) (-1117.792) (-1111.337) * [-1112.629] (-1113.418) (-1112.189) (-1116.432) -- 0:02:37 182500 -- (-1119.275) (-1124.455) (-1116.560) [-1112.438] * (-1121.799) [-1111.563] (-1115.492) (-1113.241) -- 0:02:36 183000 -- (-1123.660) (-1112.692) (-1122.291) [-1109.873] * (-1111.445) (-1112.886) [-1116.700] (-1116.138) -- 0:02:36 183500 -- (-1120.853) [-1110.340] (-1113.678) (-1112.495) * [-1108.131] (-1115.951) (-1127.227) (-1134.106) -- 0:02:35 184000 -- (-1117.157) (-1111.565) (-1112.590) [-1112.982] * (-1111.598) (-1109.024) [-1120.282] (-1121.483) -- 0:02:35 184500 -- (-1114.485) (-1118.593) (-1128.400) [-1112.518] * (-1112.677) [-1110.309] (-1120.053) (-1123.718) -- 0:02:34 185000 -- (-1117.912) (-1126.463) [-1119.905] (-1116.268) * [-1119.063] (-1110.856) (-1114.532) (-1129.234) -- 0:02:38 Average standard deviation of split frequencies: 0.005914 185500 -- (-1116.175) [-1122.250] (-1116.543) (-1122.649) * (-1118.870) (-1114.616) [-1116.351] (-1129.049) -- 0:02:38 186000 -- (-1115.435) (-1124.108) (-1119.775) [-1114.157] * [-1114.955] (-1118.133) (-1113.278) (-1122.374) -- 0:02:37 186500 -- (-1118.934) (-1117.819) [-1120.457] (-1122.114) * [-1114.411] (-1111.699) (-1118.075) (-1114.214) -- 0:02:37 187000 -- (-1123.386) [-1118.443] (-1119.642) (-1121.683) * (-1114.140) (-1110.633) (-1117.044) [-1111.285] -- 0:02:36 187500 -- (-1113.019) [-1114.708] (-1118.728) (-1113.600) * (-1114.043) (-1116.613) [-1118.632] (-1115.484) -- 0:02:36 188000 -- [-1121.026] (-1112.503) (-1117.575) (-1120.565) * [-1114.709] (-1111.059) (-1120.621) (-1118.246) -- 0:02:35 188500 -- (-1116.181) [-1111.195] (-1111.301) (-1117.724) * (-1122.376) (-1118.275) [-1116.765] (-1115.476) -- 0:02:34 189000 -- (-1124.316) (-1115.720) [-1116.442] (-1115.197) * (-1115.878) (-1113.160) (-1113.068) [-1116.489] -- 0:02:34 189500 -- (-1112.612) (-1113.952) [-1112.207] (-1123.264) * (-1119.218) (-1113.304) [-1111.447] (-1116.395) -- 0:02:33 190000 -- [-1118.269] (-1110.640) (-1120.991) (-1115.544) * [-1110.124] (-1120.951) (-1115.116) (-1108.021) -- 0:02:37 Average standard deviation of split frequencies: 0.007417 190500 -- (-1111.623) (-1112.138) [-1124.145] (-1121.520) * (-1117.687) (-1119.346) (-1111.160) [-1109.014] -- 0:02:37 191000 -- (-1124.571) (-1117.143) [-1113.481] (-1121.084) * (-1114.519) (-1113.143) (-1110.653) [-1111.384] -- 0:02:36 191500 -- (-1116.194) (-1111.746) [-1123.413] (-1131.348) * (-1114.414) (-1118.572) (-1111.087) [-1115.988] -- 0:02:36 192000 -- [-1110.918] (-1118.525) (-1111.542) (-1119.167) * [-1111.274] (-1118.482) (-1119.136) (-1109.886) -- 0:02:35 192500 -- (-1109.129) [-1117.237] (-1123.167) (-1122.138) * (-1113.013) [-1112.688] (-1113.774) (-1120.028) -- 0:02:35 193000 -- (-1110.819) (-1120.089) (-1113.353) [-1120.308] * (-1118.047) [-1108.660] (-1111.756) (-1114.150) -- 0:02:34 193500 -- (-1110.097) [-1113.930] (-1115.897) (-1114.886) * [-1112.370] (-1108.177) (-1111.051) (-1121.593) -- 0:02:34 194000 -- [-1112.235] (-1115.391) (-1113.276) (-1126.405) * (-1112.614) (-1117.621) (-1114.392) [-1113.456] -- 0:02:33 194500 -- [-1111.810] (-1109.813) (-1111.473) (-1114.554) * (-1110.632) (-1117.381) [-1114.521] (-1118.868) -- 0:02:33 195000 -- (-1111.938) [-1111.338] (-1115.428) (-1116.483) * (-1112.229) (-1108.671) [-1111.893] (-1120.190) -- 0:02:32 Average standard deviation of split frequencies: 0.006414 195500 -- (-1114.512) (-1112.757) [-1108.306] (-1111.267) * (-1121.954) [-1114.629] (-1120.616) (-1120.495) -- 0:02:36 196000 -- (-1116.509) (-1113.885) [-1116.576] (-1108.715) * (-1109.428) (-1116.924) (-1122.578) [-1113.847] -- 0:02:35 196500 -- (-1118.941) (-1112.188) [-1126.725] (-1114.001) * [-1111.373] (-1117.957) (-1118.911) (-1122.492) -- 0:02:35 197000 -- (-1121.210) (-1112.882) (-1118.878) [-1113.013] * (-1113.386) [-1113.674] (-1116.027) (-1122.512) -- 0:02:34 197500 -- [-1113.139] (-1114.398) (-1122.085) (-1116.248) * [-1114.646] (-1122.633) (-1110.383) (-1134.822) -- 0:02:34 198000 -- (-1114.730) (-1113.482) [-1120.301] (-1121.018) * (-1114.559) [-1113.793] (-1113.925) (-1126.447) -- 0:02:33 198500 -- [-1116.326] (-1112.177) (-1116.939) (-1115.263) * (-1112.803) [-1108.521] (-1114.868) (-1119.934) -- 0:02:33 199000 -- (-1119.392) (-1119.664) [-1118.512] (-1111.926) * (-1113.770) (-1112.362) (-1116.468) [-1111.690] -- 0:02:32 199500 -- [-1117.051] (-1113.923) (-1121.484) (-1116.785) * [-1117.880] (-1111.057) (-1114.206) (-1117.998) -- 0:02:32 200000 -- (-1121.229) (-1113.836) [-1113.936] (-1116.032) * [-1109.695] (-1114.061) (-1115.541) (-1117.124) -- 0:02:32 Average standard deviation of split frequencies: 0.006265 200500 -- (-1116.666) (-1111.836) [-1110.252] (-1113.780) * (-1111.534) (-1114.357) (-1116.355) [-1115.837] -- 0:02:31 201000 -- (-1111.750) (-1109.266) (-1119.638) [-1110.724] * (-1114.138) [-1110.742] (-1109.844) (-1115.240) -- 0:02:35 201500 -- (-1114.548) (-1113.774) (-1130.653) [-1115.478] * (-1111.517) (-1111.895) [-1112.972] (-1116.885) -- 0:02:34 202000 -- [-1115.873] (-1115.395) (-1117.740) (-1110.966) * (-1111.934) (-1116.154) (-1110.882) [-1113.905] -- 0:02:34 202500 -- (-1112.225) [-1114.792] (-1120.180) (-1113.808) * [-1113.499] (-1115.969) (-1118.222) (-1118.487) -- 0:02:33 203000 -- (-1111.139) [-1113.355] (-1112.558) (-1119.122) * (-1113.042) (-1110.274) (-1117.100) [-1111.284] -- 0:02:33 203500 -- (-1114.932) (-1122.562) [-1112.466] (-1110.987) * (-1113.072) [-1115.001] (-1112.606) (-1110.618) -- 0:02:32 204000 -- (-1112.209) [-1113.048] (-1116.184) (-1108.881) * [-1108.651] (-1113.556) (-1111.954) (-1111.633) -- 0:02:32 204500 -- (-1111.014) (-1121.282) (-1116.780) [-1114.084] * (-1110.855) (-1115.963) [-1115.498] (-1118.659) -- 0:02:31 205000 -- (-1114.201) (-1117.350) [-1113.170] (-1120.461) * [-1114.234] (-1113.529) (-1112.358) (-1115.697) -- 0:02:31 Average standard deviation of split frequencies: 0.006102 205500 -- (-1111.030) (-1112.246) (-1115.495) [-1117.988] * [-1108.337] (-1113.829) (-1114.581) (-1116.741) -- 0:02:30 206000 -- [-1115.226] (-1115.597) (-1113.979) (-1112.703) * (-1119.466) (-1116.131) [-1112.759] (-1121.510) -- 0:02:34 206500 -- (-1111.091) (-1116.478) (-1111.943) [-1114.590] * (-1114.214) (-1117.646) (-1108.928) [-1115.650] -- 0:02:33 207000 -- (-1118.728) (-1118.930) [-1118.623] (-1112.686) * (-1119.055) [-1114.975] (-1117.180) (-1115.252) -- 0:02:33 207500 -- (-1117.691) (-1107.224) [-1117.988] (-1117.919) * (-1115.871) (-1118.661) [-1114.901] (-1116.236) -- 0:02:32 208000 -- [-1112.674] (-1119.936) (-1118.957) (-1115.709) * (-1121.014) [-1110.162] (-1119.979) (-1112.450) -- 0:02:32 208500 -- (-1115.187) (-1118.954) (-1114.258) [-1108.026] * (-1123.178) (-1119.911) [-1115.316] (-1117.843) -- 0:02:31 209000 -- (-1114.644) (-1116.180) [-1115.915] (-1112.838) * (-1114.627) [-1111.157] (-1112.066) (-1113.133) -- 0:02:31 209500 -- [-1115.402] (-1111.542) (-1113.432) (-1113.715) * [-1110.948] (-1120.263) (-1115.585) (-1110.280) -- 0:02:30 210000 -- (-1114.210) (-1109.498) (-1115.190) [-1120.047] * (-1116.986) [-1114.803] (-1112.689) (-1114.750) -- 0:02:30 Average standard deviation of split frequencies: 0.003729 210500 -- (-1118.993) [-1112.525] (-1113.990) (-1120.453) * [-1114.288] (-1118.369) (-1115.843) (-1113.508) -- 0:02:30 211000 -- (-1120.333) (-1111.053) (-1116.379) [-1114.412] * [-1114.986] (-1112.302) (-1110.077) (-1117.709) -- 0:02:29 211500 -- (-1110.573) (-1116.611) (-1111.009) [-1112.603] * [-1114.133] (-1115.476) (-1116.212) (-1114.408) -- 0:02:32 212000 -- (-1117.609) (-1111.503) [-1114.446] (-1115.409) * (-1109.006) [-1108.911] (-1108.967) (-1112.235) -- 0:02:32 212500 -- [-1117.510] (-1131.361) (-1119.961) (-1121.870) * [-1113.219] (-1118.867) (-1116.209) (-1112.495) -- 0:02:31 213000 -- (-1119.971) (-1119.244) [-1111.123] (-1131.035) * (-1112.716) (-1114.058) (-1118.958) [-1115.981] -- 0:02:31 213500 -- (-1113.447) [-1119.507] (-1112.986) (-1125.324) * (-1113.811) (-1120.744) (-1113.353) [-1118.935] -- 0:02:31 214000 -- (-1122.733) (-1114.850) [-1111.040] (-1125.442) * (-1117.745) (-1114.199) (-1118.811) [-1116.932] -- 0:02:30 214500 -- (-1116.874) (-1116.952) [-1110.742] (-1116.510) * (-1119.304) [-1109.298] (-1109.778) (-1122.819) -- 0:02:30 215000 -- (-1121.009) [-1110.593] (-1115.638) (-1112.194) * [-1110.318] (-1112.981) (-1114.182) (-1112.974) -- 0:02:29 Average standard deviation of split frequencies: 0.003637 215500 -- (-1113.604) (-1114.483) (-1124.518) [-1114.322] * (-1113.683) (-1117.099) (-1120.327) [-1113.049] -- 0:02:29 216000 -- (-1116.407) (-1126.036) (-1114.068) [-1116.624] * [-1112.823] (-1119.069) (-1112.870) (-1114.901) -- 0:02:28 216500 -- [-1114.816] (-1114.820) (-1116.108) (-1115.356) * (-1111.028) (-1128.888) (-1113.275) [-1110.500] -- 0:02:28 217000 -- (-1110.538) (-1114.494) (-1114.494) [-1116.276] * (-1109.380) (-1111.641) (-1115.453) [-1110.631] -- 0:02:31 217500 -- (-1113.900) [-1118.259] (-1124.397) (-1116.428) * (-1126.435) (-1116.658) [-1111.459] (-1111.768) -- 0:02:31 218000 -- [-1111.725] (-1116.043) (-1115.856) (-1110.861) * (-1113.737) (-1111.606) [-1112.597] (-1120.181) -- 0:02:30 218500 -- (-1114.176) (-1116.830) (-1113.098) [-1110.563] * (-1120.946) (-1115.292) [-1112.974] (-1118.862) -- 0:02:30 219000 -- (-1121.944) (-1113.940) [-1109.177] (-1126.632) * (-1114.682) (-1119.648) [-1122.290] (-1111.231) -- 0:02:29 219500 -- (-1112.487) [-1113.287] (-1117.859) (-1114.150) * (-1125.911) [-1112.965] (-1118.098) (-1114.542) -- 0:02:29 220000 -- [-1114.616] (-1115.963) (-1113.496) (-1110.297) * (-1107.860) [-1115.805] (-1115.050) (-1115.350) -- 0:02:28 Average standard deviation of split frequencies: 0.004985 220500 -- [-1110.303] (-1117.245) (-1117.542) (-1123.423) * [-1117.471] (-1120.484) (-1112.883) (-1115.759) -- 0:02:28 221000 -- [-1112.848] (-1129.302) (-1117.237) (-1116.946) * [-1115.502] (-1117.765) (-1113.458) (-1119.967) -- 0:02:28 221500 -- (-1113.984) (-1112.514) (-1113.515) [-1110.116] * (-1114.962) (-1113.367) (-1113.396) [-1119.442] -- 0:02:27 222000 -- (-1118.302) (-1116.610) (-1111.900) [-1117.151] * (-1110.709) (-1115.461) [-1115.058] (-1127.065) -- 0:02:30 222500 -- (-1123.522) (-1114.435) [-1113.601] (-1121.505) * [-1115.346] (-1116.000) (-1111.146) (-1116.701) -- 0:02:30 223000 -- (-1116.341) (-1116.701) [-1116.311] (-1119.377) * (-1115.307) (-1108.810) [-1113.964] (-1120.444) -- 0:02:29 223500 -- [-1110.327] (-1118.037) (-1111.962) (-1120.352) * [-1118.008] (-1114.489) (-1111.823) (-1112.926) -- 0:02:29 224000 -- (-1117.968) [-1111.012] (-1111.564) (-1109.468) * (-1115.490) (-1109.649) (-1110.428) [-1112.819] -- 0:02:28 224500 -- (-1120.882) (-1115.509) [-1113.610] (-1112.885) * (-1113.878) (-1109.429) [-1110.814] (-1118.660) -- 0:02:28 225000 -- (-1114.210) [-1116.998] (-1117.811) (-1115.696) * (-1113.969) [-1114.680] (-1119.977) (-1119.821) -- 0:02:28 Average standard deviation of split frequencies: 0.004172 225500 -- (-1114.592) (-1117.273) (-1114.369) [-1112.271] * (-1117.959) [-1113.264] (-1117.079) (-1119.135) -- 0:02:27 226000 -- (-1116.572) (-1113.848) [-1112.018] (-1121.906) * (-1116.889) [-1115.567] (-1110.979) (-1115.591) -- 0:02:27 226500 -- (-1117.827) [-1110.910] (-1120.286) (-1118.200) * [-1119.574] (-1116.008) (-1120.245) (-1120.906) -- 0:02:26 227000 -- (-1124.990) (-1114.991) (-1113.587) [-1110.478] * (-1123.700) (-1112.798) (-1113.692) [-1113.078] -- 0:02:26 227500 -- (-1116.788) (-1117.004) [-1112.610] (-1115.134) * (-1120.601) (-1112.136) (-1118.732) [-1112.460] -- 0:02:29 228000 -- (-1115.263) (-1114.141) (-1115.006) [-1112.074] * (-1121.792) (-1116.862) (-1121.096) [-1112.318] -- 0:02:28 228500 -- (-1116.235) (-1109.113) [-1108.344] (-1126.127) * (-1112.800) (-1113.356) (-1112.679) [-1113.122] -- 0:02:28 229000 -- (-1127.506) [-1117.228] (-1116.162) (-1113.889) * (-1116.221) (-1117.940) (-1120.747) [-1113.707] -- 0:02:28 229500 -- (-1117.975) [-1109.796] (-1116.421) (-1118.650) * [-1110.805] (-1112.558) (-1119.602) (-1108.375) -- 0:02:27 230000 -- (-1114.060) [-1113.425] (-1119.594) (-1112.276) * (-1115.023) (-1110.332) (-1118.315) [-1111.311] -- 0:02:27 Average standard deviation of split frequencies: 0.002044 230500 -- (-1118.522) [-1112.026] (-1116.380) (-1111.522) * [-1117.333] (-1116.579) (-1113.703) (-1115.927) -- 0:02:26 231000 -- (-1112.060) (-1113.768) [-1111.173] (-1116.739) * (-1117.593) (-1117.093) (-1111.724) [-1120.254] -- 0:02:26 231500 -- (-1111.029) [-1115.049] (-1110.295) (-1111.911) * (-1116.342) (-1117.413) [-1110.856] (-1113.294) -- 0:02:26 232000 -- [-1109.012] (-1113.610) (-1114.176) (-1116.014) * (-1116.365) (-1115.745) [-1111.730] (-1114.223) -- 0:02:25 232500 -- (-1116.599) [-1111.579] (-1114.329) (-1121.552) * (-1114.692) (-1113.794) (-1111.705) [-1113.067] -- 0:02:28 233000 -- (-1113.550) [-1118.605] (-1113.529) (-1113.764) * (-1118.195) (-1112.213) [-1111.381] (-1113.843) -- 0:02:28 233500 -- (-1115.983) [-1109.486] (-1119.786) (-1115.675) * (-1116.312) (-1111.896) (-1115.002) [-1113.525] -- 0:02:27 234000 -- [-1113.402] (-1115.461) (-1116.086) (-1113.933) * (-1119.681) [-1114.896] (-1119.309) (-1119.044) -- 0:02:27 234500 -- [-1110.267] (-1117.564) (-1122.872) (-1114.686) * (-1108.635) [-1113.196] (-1114.173) (-1117.728) -- 0:02:26 235000 -- (-1118.867) (-1114.079) [-1118.079] (-1115.660) * (-1111.367) (-1108.487) (-1108.873) [-1114.517] -- 0:02:26 Average standard deviation of split frequencies: 0.002663 235500 -- [-1113.806] (-1109.855) (-1114.504) (-1109.938) * [-1116.625] (-1112.645) (-1118.323) (-1112.061) -- 0:02:26 236000 -- (-1122.663) (-1115.468) [-1116.340] (-1108.897) * (-1115.399) (-1120.508) [-1115.249] (-1110.726) -- 0:02:25 236500 -- (-1120.102) (-1117.409) (-1116.036) [-1115.948] * (-1122.512) [-1116.987] (-1117.915) (-1114.511) -- 0:02:25 237000 -- [-1122.442] (-1116.483) (-1112.383) (-1109.083) * (-1119.352) [-1112.686] (-1115.451) (-1116.939) -- 0:02:24 237500 -- (-1111.533) (-1116.587) [-1114.038] (-1114.784) * (-1119.011) [-1114.003] (-1117.852) (-1119.042) -- 0:02:24 238000 -- (-1117.417) [-1118.361] (-1116.916) (-1118.679) * (-1120.432) (-1120.511) (-1111.409) [-1109.381] -- 0:02:27 238500 -- [-1113.862] (-1124.340) (-1118.295) (-1129.946) * (-1121.586) (-1115.002) [-1113.498] (-1116.552) -- 0:02:26 239000 -- (-1118.271) [-1120.527] (-1111.099) (-1127.095) * [-1116.309] (-1119.307) (-1119.392) (-1115.166) -- 0:02:26 239500 -- (-1115.355) (-1120.184) [-1117.210] (-1118.989) * (-1114.697) [-1120.291] (-1121.354) (-1115.521) -- 0:02:26 240000 -- (-1115.977) [-1118.517] (-1112.139) (-1121.147) * (-1114.512) (-1112.621) (-1116.580) [-1114.266] -- 0:02:25 Average standard deviation of split frequencies: 0.003265 240500 -- (-1114.695) [-1119.831] (-1114.342) (-1117.696) * (-1113.058) (-1115.687) [-1110.349] (-1112.125) -- 0:02:25 241000 -- (-1110.872) (-1115.662) [-1118.056] (-1115.127) * (-1116.564) (-1113.087) (-1111.966) [-1114.429] -- 0:02:24 241500 -- (-1123.068) [-1113.160] (-1110.890) (-1114.189) * [-1117.499] (-1113.810) (-1109.511) (-1118.842) -- 0:02:24 242000 -- (-1116.620) (-1110.775) [-1116.172] (-1115.228) * (-1122.493) (-1109.995) (-1116.077) [-1114.726] -- 0:02:24 242500 -- (-1112.177) [-1113.873] (-1119.694) (-1116.506) * (-1117.794) [-1110.723] (-1110.572) (-1122.302) -- 0:02:23 243000 -- [-1113.802] (-1117.249) (-1111.761) (-1116.440) * (-1118.099) (-1119.450) [-1112.521] (-1114.420) -- 0:02:26 243500 -- (-1115.197) (-1113.539) [-1109.491] (-1118.142) * [-1110.753] (-1115.740) (-1112.968) (-1115.606) -- 0:02:26 244000 -- [-1109.590] (-1122.173) (-1115.115) (-1122.421) * (-1114.989) (-1127.912) (-1111.427) [-1113.708] -- 0:02:25 244500 -- (-1113.911) (-1119.128) [-1116.263] (-1115.274) * (-1114.431) (-1113.752) (-1118.627) [-1112.146] -- 0:02:25 245000 -- (-1122.949) (-1113.521) (-1118.478) [-1114.757] * [-1115.113] (-1115.760) (-1115.153) (-1113.103) -- 0:02:24 Average standard deviation of split frequencies: 0.003833 245500 -- (-1115.847) (-1110.100) [-1119.420] (-1119.111) * (-1125.366) (-1113.858) (-1117.740) [-1119.616] -- 0:02:24 246000 -- [-1115.086] (-1112.821) (-1112.277) (-1117.885) * (-1114.975) (-1114.159) (-1115.798) [-1108.963] -- 0:02:24 246500 -- (-1113.449) [-1112.138] (-1109.551) (-1121.801) * (-1123.817) (-1118.910) (-1114.544) [-1108.558] -- 0:02:23 247000 -- (-1118.892) (-1116.138) [-1113.433] (-1118.900) * (-1115.869) (-1115.967) [-1117.786] (-1114.173) -- 0:02:23 247500 -- [-1118.755] (-1116.121) (-1109.391) (-1120.950) * (-1119.388) (-1113.895) [-1113.753] (-1124.959) -- 0:02:22 248000 -- (-1116.765) (-1117.351) [-1117.339] (-1117.290) * (-1110.087) [-1113.030] (-1113.563) (-1112.864) -- 0:02:22 248500 -- (-1119.275) (-1122.105) [-1112.101] (-1113.139) * (-1110.630) [-1113.911] (-1121.822) (-1110.963) -- 0:02:25 249000 -- [-1115.149] (-1110.202) (-1110.742) (-1123.343) * (-1112.865) (-1126.273) [-1114.064] (-1113.300) -- 0:02:24 249500 -- [-1118.571] (-1110.780) (-1116.214) (-1117.237) * (-1117.771) [-1114.601] (-1114.862) (-1117.662) -- 0:02:24 250000 -- (-1118.050) [-1118.215] (-1110.114) (-1112.867) * (-1116.692) (-1115.192) (-1113.056) [-1114.277] -- 0:02:24 Average standard deviation of split frequencies: 0.002507 250500 -- (-1119.133) (-1115.867) [-1114.905] (-1109.658) * (-1113.208) (-1115.103) (-1117.477) [-1111.771] -- 0:02:23 251000 -- (-1113.365) [-1118.975] (-1114.957) (-1113.797) * [-1109.643] (-1110.158) (-1122.492) (-1116.112) -- 0:02:23 251500 -- (-1116.375) (-1114.519) [-1116.958] (-1111.577) * (-1108.585) (-1116.219) (-1111.051) [-1116.156] -- 0:02:22 252000 -- [-1115.035] (-1112.833) (-1123.054) (-1116.165) * (-1112.913) (-1114.527) (-1124.577) [-1111.932] -- 0:02:22 252500 -- (-1116.081) [-1110.090] (-1121.084) (-1110.551) * (-1117.396) [-1119.419] (-1114.868) (-1114.043) -- 0:02:22 253000 -- (-1118.116) [-1112.215] (-1124.187) (-1114.273) * [-1111.033] (-1125.973) (-1112.657) (-1116.544) -- 0:02:21 253500 -- (-1114.901) (-1113.955) [-1113.035] (-1123.828) * [-1117.035] (-1111.338) (-1108.927) (-1118.955) -- 0:02:21 254000 -- (-1118.052) [-1110.672] (-1111.039) (-1115.236) * (-1112.992) [-1109.853] (-1112.639) (-1128.658) -- 0:02:23 254500 -- [-1119.355] (-1112.987) (-1110.917) (-1114.732) * [-1110.743] (-1115.378) (-1121.479) (-1120.688) -- 0:02:23 255000 -- (-1113.316) (-1111.817) [-1113.040] (-1115.217) * [-1114.124] (-1115.874) (-1115.659) (-1111.818) -- 0:02:23 Average standard deviation of split frequencies: 0.003069 255500 -- (-1113.085) (-1109.389) [-1117.115] (-1109.720) * [-1115.074] (-1123.768) (-1111.485) (-1115.470) -- 0:02:22 256000 -- (-1115.993) (-1114.860) (-1116.183) [-1114.185] * [-1113.444] (-1114.507) (-1113.256) (-1125.881) -- 0:02:22 256500 -- (-1114.204) (-1121.302) (-1112.084) [-1116.369] * (-1110.981) (-1121.271) [-1112.114] (-1114.200) -- 0:02:22 257000 -- (-1112.515) (-1112.928) (-1112.520) [-1112.877] * [-1115.932] (-1117.042) (-1118.876) (-1116.587) -- 0:02:21 257500 -- [-1114.105] (-1118.173) (-1110.746) (-1112.042) * (-1117.799) (-1115.208) (-1116.592) [-1116.995] -- 0:02:21 258000 -- (-1115.093) (-1119.254) [-1115.011] (-1113.705) * (-1124.083) (-1111.634) (-1115.046) [-1115.101] -- 0:02:20 258500 -- (-1120.129) (-1115.223) (-1115.074) [-1110.735] * (-1113.572) (-1115.458) (-1114.171) [-1118.403] -- 0:02:20 259000 -- (-1120.757) (-1111.983) (-1114.002) [-1111.414] * (-1116.321) [-1112.586] (-1113.579) (-1114.884) -- 0:02:23 259500 -- (-1117.630) [-1115.380] (-1113.458) (-1114.898) * (-1126.099) (-1113.075) [-1107.582] (-1118.039) -- 0:02:22 260000 -- [-1117.253] (-1113.341) (-1114.077) (-1119.992) * (-1116.111) [-1116.899] (-1114.008) (-1121.622) -- 0:02:22 Average standard deviation of split frequencies: 0.003014 260500 -- (-1116.158) (-1114.872) [-1115.142] (-1114.057) * (-1119.938) (-1114.285) [-1113.880] (-1114.857) -- 0:02:21 261000 -- (-1117.306) [-1120.379] (-1117.849) (-1113.138) * (-1118.127) (-1111.509) [-1113.836] (-1119.837) -- 0:02:21 261500 -- (-1120.239) [-1114.817] (-1114.170) (-1116.582) * (-1107.029) [-1112.515] (-1111.508) (-1114.010) -- 0:02:21 262000 -- (-1120.805) [-1115.954] (-1118.672) (-1115.576) * [-1108.706] (-1121.993) (-1113.543) (-1117.380) -- 0:02:20 262500 -- (-1115.234) (-1115.457) (-1117.582) [-1110.181] * (-1120.083) (-1118.616) (-1117.314) [-1117.782] -- 0:02:20 263000 -- (-1115.038) [-1113.246] (-1113.500) (-1122.870) * (-1115.404) [-1115.454] (-1132.403) (-1120.281) -- 0:02:20 263500 -- (-1114.636) [-1115.140] (-1119.841) (-1116.684) * (-1109.867) [-1111.905] (-1118.374) (-1119.045) -- 0:02:19 264000 -- (-1117.738) (-1119.754) (-1118.134) [-1116.025] * (-1111.764) [-1112.524] (-1109.419) (-1118.976) -- 0:02:19 264500 -- (-1111.094) (-1116.990) (-1122.220) [-1113.453] * (-1119.593) [-1114.740] (-1119.447) (-1123.559) -- 0:02:21 265000 -- [-1114.919] (-1124.054) (-1115.258) (-1114.081) * (-1111.643) (-1112.894) (-1127.623) [-1122.442] -- 0:02:21 Average standard deviation of split frequencies: 0.002954 265500 -- (-1111.707) (-1120.571) [-1119.910] (-1109.483) * (-1112.701) (-1113.255) [-1109.949] (-1119.076) -- 0:02:21 266000 -- (-1113.942) (-1114.443) (-1117.646) [-1108.111] * [-1117.868] (-1119.122) (-1113.310) (-1119.459) -- 0:02:20 266500 -- (-1114.963) [-1111.018] (-1109.938) (-1109.502) * (-1116.319) (-1108.430) [-1114.397] (-1116.854) -- 0:02:20 267000 -- (-1118.750) (-1115.332) (-1111.678) [-1112.324] * [-1112.750] (-1112.254) (-1118.734) (-1113.958) -- 0:02:20 267500 -- (-1119.534) (-1120.506) (-1111.369) [-1110.514] * (-1117.725) [-1114.242] (-1123.502) (-1110.616) -- 0:02:19 268000 -- (-1115.085) [-1109.167] (-1118.731) (-1115.064) * (-1115.647) (-1117.419) [-1111.960] (-1111.397) -- 0:02:19 268500 -- [-1113.561] (-1119.901) (-1108.890) (-1109.608) * (-1115.784) (-1112.455) [-1113.062] (-1122.181) -- 0:02:18 269000 -- (-1113.688) (-1116.704) [-1117.757] (-1114.211) * (-1108.792) (-1123.220) [-1116.458] (-1116.179) -- 0:02:18 269500 -- [-1112.521] (-1120.446) (-1121.334) (-1112.165) * (-1122.501) (-1118.728) [-1115.975] (-1122.239) -- 0:02:20 270000 -- (-1122.580) (-1112.219) (-1115.110) [-1118.792] * [-1112.600] (-1117.598) (-1110.959) (-1125.736) -- 0:02:20 Average standard deviation of split frequencies: 0.004644 270500 -- [-1114.056] (-1119.988) (-1117.103) (-1114.201) * [-1111.061] (-1123.582) (-1115.023) (-1116.155) -- 0:02:20 271000 -- (-1120.455) [-1111.042] (-1115.629) (-1120.104) * (-1115.380) (-1115.165) [-1112.538] (-1114.582) -- 0:02:19 271500 -- (-1123.523) (-1111.943) (-1118.682) [-1112.956] * (-1120.001) (-1117.347) [-1111.995] (-1117.316) -- 0:02:19 272000 -- [-1120.802] (-1110.838) (-1112.763) (-1112.802) * (-1111.524) (-1122.129) [-1116.882] (-1118.536) -- 0:02:19 272500 -- (-1114.097) (-1118.765) (-1110.813) [-1113.429] * [-1114.048] (-1115.463) (-1114.898) (-1121.419) -- 0:02:18 273000 -- (-1117.190) (-1115.629) (-1113.738) [-1116.450] * (-1110.763) (-1111.912) (-1115.826) [-1112.891] -- 0:02:18 273500 -- (-1114.767) (-1113.524) [-1112.100] (-1115.837) * (-1123.410) [-1114.610] (-1112.033) (-1109.856) -- 0:02:18 274000 -- (-1115.756) (-1114.445) (-1115.241) [-1121.027] * (-1117.981) (-1113.253) [-1111.341] (-1112.393) -- 0:02:17 274500 -- (-1119.129) (-1111.445) [-1108.199] (-1118.602) * (-1116.027) (-1113.895) [-1113.439] (-1108.228) -- 0:02:17 275000 -- (-1115.388) (-1121.481) [-1115.470] (-1122.096) * (-1115.966) [-1109.272] (-1107.719) (-1113.136) -- 0:02:19 Average standard deviation of split frequencies: 0.003985 275500 -- [-1113.295] (-1118.346) (-1120.590) (-1110.719) * (-1113.030) (-1116.184) (-1114.627) [-1112.990] -- 0:02:19 276000 -- (-1112.986) (-1117.261) (-1119.110) [-1109.225] * (-1121.388) (-1122.641) (-1120.109) [-1112.557] -- 0:02:19 276500 -- [-1115.901] (-1123.007) (-1122.644) (-1113.689) * [-1116.695] (-1126.238) (-1116.870) (-1112.878) -- 0:02:18 277000 -- (-1116.817) (-1111.914) (-1125.491) [-1111.208] * (-1117.336) (-1111.504) (-1114.381) [-1114.226] -- 0:02:18 277500 -- (-1117.720) (-1124.907) (-1112.572) [-1114.403] * (-1114.108) (-1113.088) [-1108.667] (-1115.236) -- 0:02:17 278000 -- (-1111.193) (-1120.312) (-1118.728) [-1114.492] * (-1109.224) (-1110.148) [-1110.553] (-1117.535) -- 0:02:17 278500 -- (-1113.841) (-1114.569) (-1118.989) [-1114.650] * (-1116.507) (-1114.503) (-1116.713) [-1115.736] -- 0:02:17 279000 -- (-1122.049) (-1119.684) [-1116.891] (-1121.871) * (-1111.786) (-1119.168) [-1108.106] (-1119.802) -- 0:02:16 279500 -- (-1114.926) [-1118.505] (-1122.556) (-1125.102) * [-1111.579] (-1118.199) (-1120.361) (-1114.391) -- 0:02:16 280000 -- (-1119.511) (-1113.980) [-1114.578] (-1119.510) * (-1109.444) (-1117.062) (-1120.212) [-1112.774] -- 0:02:18 Average standard deviation of split frequencies: 0.003919 280500 -- (-1117.926) (-1121.132) (-1116.755) [-1114.066] * [-1113.470] (-1107.541) (-1114.903) (-1115.153) -- 0:02:18 281000 -- (-1123.236) (-1109.257) [-1114.537] (-1124.216) * (-1111.188) (-1120.048) (-1113.317) [-1114.237] -- 0:02:18 281500 -- (-1111.636) (-1116.161) [-1112.840] (-1120.805) * (-1110.202) (-1109.985) (-1114.232) [-1108.779] -- 0:02:17 282000 -- [-1107.899] (-1111.713) (-1115.102) (-1115.605) * (-1125.428) (-1113.778) [-1110.151] (-1116.066) -- 0:02:17 282500 -- (-1110.213) [-1112.452] (-1111.402) (-1111.835) * (-1109.767) (-1114.968) (-1115.421) [-1111.776] -- 0:02:17 283000 -- (-1112.539) (-1125.572) [-1121.866] (-1112.141) * [-1116.472] (-1111.079) (-1114.973) (-1118.006) -- 0:02:16 283500 -- (-1113.734) (-1113.795) [-1111.223] (-1111.260) * (-1116.045) [-1114.551] (-1125.195) (-1114.228) -- 0:02:16 284000 -- [-1116.615] (-1112.038) (-1119.502) (-1117.279) * [-1124.218] (-1112.156) (-1115.259) (-1117.751) -- 0:02:16 284500 -- (-1115.348) (-1113.472) (-1117.888) [-1110.201] * (-1121.763) (-1121.525) (-1115.525) [-1110.152] -- 0:02:15 285000 -- (-1119.763) (-1112.705) (-1115.458) [-1115.368] * (-1119.867) (-1122.237) [-1115.799] (-1115.172) -- 0:02:15 Average standard deviation of split frequencies: 0.004945 285500 -- (-1118.167) [-1113.594] (-1114.756) (-1122.788) * (-1113.016) [-1115.046] (-1118.565) (-1116.735) -- 0:02:17 286000 -- (-1115.445) [-1115.057] (-1110.710) (-1121.139) * (-1116.726) [-1113.545] (-1111.280) (-1121.408) -- 0:02:17 286500 -- (-1126.046) [-1115.344] (-1110.187) (-1129.185) * (-1120.637) (-1116.878) [-1113.020] (-1126.544) -- 0:02:16 287000 -- (-1126.333) [-1108.306] (-1118.706) (-1124.830) * (-1116.187) (-1114.097) [-1111.491] (-1110.998) -- 0:02:16 287500 -- (-1116.183) [-1110.095] (-1110.635) (-1122.492) * (-1117.951) [-1109.935] (-1113.886) (-1114.258) -- 0:02:16 288000 -- [-1115.845] (-1114.580) (-1113.241) (-1120.426) * (-1121.567) (-1115.168) (-1112.632) [-1121.573] -- 0:02:15 288500 -- (-1116.259) (-1110.934) [-1114.040] (-1110.709) * (-1119.143) (-1112.388) [-1112.877] (-1118.914) -- 0:02:15 289000 -- (-1123.855) (-1113.288) (-1108.220) [-1111.483] * (-1116.583) [-1110.650] (-1114.373) (-1113.252) -- 0:02:15 289500 -- (-1120.152) (-1113.971) [-1118.866] (-1122.457) * (-1118.947) [-1112.687] (-1115.398) (-1116.822) -- 0:02:14 290000 -- (-1112.986) [-1114.498] (-1120.728) (-1107.234) * (-1122.202) (-1111.776) [-1112.541] (-1115.559) -- 0:02:14 Average standard deviation of split frequencies: 0.004865 290500 -- (-1112.999) [-1114.456] (-1118.864) (-1112.897) * (-1127.983) [-1119.916] (-1115.644) (-1116.144) -- 0:02:16 291000 -- (-1110.635) [-1111.617] (-1113.500) (-1107.496) * (-1129.401) (-1112.289) [-1112.651] (-1111.748) -- 0:02:16 291500 -- (-1111.109) (-1115.514) [-1121.256] (-1117.712) * (-1107.713) (-1115.496) [-1111.542] (-1122.744) -- 0:02:16 292000 -- [-1115.009] (-1116.193) (-1129.683) (-1109.320) * (-1116.434) (-1114.694) (-1115.993) [-1110.206] -- 0:02:15 292500 -- [-1114.678] (-1113.034) (-1117.279) (-1111.195) * (-1111.311) (-1115.115) [-1110.571] (-1114.639) -- 0:02:15 293000 -- (-1110.804) [-1111.025] (-1121.249) (-1113.456) * (-1114.006) (-1115.264) (-1112.230) [-1110.602] -- 0:02:15 293500 -- (-1111.275) (-1115.344) (-1122.855) [-1111.997] * [-1113.520] (-1120.066) (-1116.751) (-1118.103) -- 0:02:14 294000 -- (-1111.779) [-1111.823] (-1122.965) (-1113.157) * [-1113.597] (-1122.919) (-1117.229) (-1113.856) -- 0:02:14 294500 -- [-1111.616] (-1114.725) (-1119.960) (-1111.888) * (-1114.102) (-1110.768) (-1116.259) [-1113.852] -- 0:02:14 295000 -- (-1113.209) (-1117.219) [-1116.680] (-1111.786) * (-1119.104) (-1111.986) (-1118.362) [-1114.195] -- 0:02:13 Average standard deviation of split frequencies: 0.005839 295500 -- (-1123.501) (-1118.695) (-1113.677) [-1114.432] * (-1114.516) (-1114.748) [-1121.697] (-1119.699) -- 0:02:13 296000 -- (-1117.080) (-1115.721) [-1118.203] (-1119.562) * (-1113.591) [-1113.110] (-1111.568) (-1116.811) -- 0:02:15 296500 -- (-1110.924) (-1113.951) [-1115.526] (-1114.934) * (-1118.695) (-1113.494) (-1112.111) [-1109.536] -- 0:02:15 297000 -- (-1114.231) [-1118.018] (-1117.990) (-1113.534) * (-1118.661) [-1113.897] (-1116.311) (-1111.831) -- 0:02:14 297500 -- [-1117.322] (-1111.165) (-1121.937) (-1117.429) * (-1118.447) (-1114.132) (-1114.066) [-1112.278] -- 0:02:14 298000 -- [-1114.610] (-1112.128) (-1116.665) (-1120.454) * (-1112.609) (-1113.236) [-1117.376] (-1113.247) -- 0:02:14 298500 -- (-1114.980) (-1114.539) (-1117.947) [-1115.259] * (-1121.274) (-1109.903) [-1115.432] (-1114.567) -- 0:02:13 299000 -- [-1114.716] (-1115.284) (-1115.413) (-1117.276) * (-1120.128) (-1115.440) [-1111.277] (-1117.399) -- 0:02:13 299500 -- [-1109.950] (-1114.401) (-1112.168) (-1113.987) * (-1122.975) (-1121.237) [-1105.409] (-1116.182) -- 0:02:13 300000 -- (-1118.204) (-1109.364) (-1116.296) [-1118.871] * (-1123.374) (-1114.689) (-1115.063) [-1123.240] -- 0:02:13 Average standard deviation of split frequencies: 0.005749 300500 -- [-1111.445] (-1114.037) (-1117.652) (-1119.870) * [-1123.192] (-1114.672) (-1111.429) (-1115.599) -- 0:02:12 301000 -- (-1119.624) (-1115.342) [-1116.532] (-1117.305) * (-1113.229) [-1112.172] (-1109.321) (-1122.563) -- 0:02:12 301500 -- [-1111.365] (-1113.756) (-1109.653) (-1114.130) * (-1118.205) [-1112.935] (-1109.915) (-1114.953) -- 0:02:14 302000 -- (-1112.112) (-1113.251) [-1113.730] (-1116.251) * (-1116.342) (-1122.108) [-1116.918] (-1114.858) -- 0:02:14 302500 -- (-1111.437) [-1110.341] (-1111.465) (-1115.626) * (-1112.283) (-1114.026) (-1119.526) [-1110.310] -- 0:02:13 303000 -- (-1112.350) [-1118.146] (-1117.005) (-1110.418) * [-1111.474] (-1113.343) (-1120.557) (-1117.136) -- 0:02:13 303500 -- (-1118.167) [-1112.772] (-1116.475) (-1110.428) * [-1112.338] (-1114.946) (-1119.247) (-1123.412) -- 0:02:13 304000 -- (-1118.082) (-1111.261) [-1119.690] (-1113.209) * (-1110.142) [-1110.537] (-1112.722) (-1120.641) -- 0:02:12 304500 -- [-1111.331] (-1111.587) (-1114.821) (-1118.545) * (-1112.233) [-1114.595] (-1113.180) (-1119.163) -- 0:02:12 305000 -- (-1118.570) (-1121.465) [-1122.020] (-1112.391) * (-1120.543) (-1115.294) (-1116.200) [-1114.923] -- 0:02:12 Average standard deviation of split frequencies: 0.004108 305500 -- (-1119.824) (-1118.306) (-1117.121) [-1106.692] * (-1113.764) (-1112.233) (-1121.934) [-1114.521] -- 0:02:11 306000 -- (-1124.401) (-1115.710) (-1119.843) [-1113.930] * (-1118.009) [-1113.080] (-1116.022) (-1124.175) -- 0:02:11 306500 -- [-1119.617] (-1114.240) (-1117.257) (-1123.570) * [-1115.922] (-1111.300) (-1117.535) (-1117.362) -- 0:02:13 307000 -- (-1124.535) [-1109.186] (-1117.746) (-1125.827) * (-1120.760) [-1110.018] (-1115.426) (-1109.384) -- 0:02:13 307500 -- (-1119.723) [-1114.281] (-1117.347) (-1115.724) * (-1123.643) [-1118.974] (-1118.638) (-1115.606) -- 0:02:12 308000 -- (-1122.729) (-1116.843) [-1117.436] (-1107.039) * [-1122.408] (-1119.057) (-1112.478) (-1111.597) -- 0:02:12 308500 -- (-1120.600) [-1117.830] (-1115.660) (-1118.287) * (-1118.616) (-1119.668) (-1118.413) [-1107.321] -- 0:02:12 309000 -- (-1114.753) [-1107.718] (-1115.361) (-1116.393) * [-1113.936] (-1114.786) (-1130.433) (-1116.866) -- 0:02:11 309500 -- (-1117.834) (-1120.322) (-1107.862) [-1114.802] * [-1115.426] (-1115.962) (-1119.414) (-1114.581) -- 0:02:11 310000 -- (-1115.885) (-1117.868) [-1114.286] (-1119.367) * (-1114.686) (-1119.470) (-1121.494) [-1115.791] -- 0:02:11 Average standard deviation of split frequencies: 0.004046 310500 -- [-1110.888] (-1112.118) (-1115.548) (-1118.822) * (-1116.113) [-1110.918] (-1114.468) (-1111.475) -- 0:02:11 311000 -- [-1116.037] (-1116.536) (-1120.847) (-1112.259) * (-1113.334) (-1112.218) [-1118.668] (-1111.718) -- 0:02:10 311500 -- (-1121.795) (-1115.179) (-1119.811) [-1119.287] * (-1115.027) (-1118.808) [-1117.002] (-1121.178) -- 0:02:10 312000 -- (-1115.664) (-1116.603) (-1111.784) [-1114.387] * (-1113.346) [-1113.625] (-1122.419) (-1115.921) -- 0:02:12 312500 -- (-1113.526) (-1110.295) [-1115.086] (-1116.810) * [-1121.382] (-1114.042) (-1110.689) (-1116.092) -- 0:02:12 313000 -- (-1113.458) [-1112.986] (-1113.417) (-1116.994) * (-1117.755) (-1117.961) (-1113.496) [-1114.449] -- 0:02:11 313500 -- (-1112.018) (-1110.408) [-1115.205] (-1114.203) * (-1110.033) (-1111.500) (-1116.349) [-1117.062] -- 0:02:11 314000 -- (-1110.743) (-1120.219) (-1116.629) [-1115.964] * (-1114.048) [-1110.308] (-1116.057) (-1117.361) -- 0:02:11 314500 -- (-1113.940) (-1113.813) (-1110.321) [-1112.191] * (-1112.540) (-1106.809) [-1115.859] (-1113.538) -- 0:02:10 315000 -- (-1113.726) (-1120.036) [-1112.345] (-1113.834) * (-1116.337) (-1119.038) (-1126.737) [-1116.127] -- 0:02:10 Average standard deviation of split frequencies: 0.002984 315500 -- [-1113.673] (-1119.358) (-1113.632) (-1111.906) * (-1114.738) [-1111.359] (-1115.290) (-1111.839) -- 0:02:10 316000 -- [-1115.381] (-1115.518) (-1111.301) (-1119.534) * (-1113.420) (-1116.173) (-1119.111) [-1116.038] -- 0:02:09 316500 -- (-1118.051) [-1115.144] (-1111.880) (-1113.087) * (-1117.214) (-1122.032) [-1109.933] (-1110.939) -- 0:02:09 317000 -- (-1115.805) (-1119.055) [-1111.643] (-1111.102) * (-1115.370) (-1118.712) [-1113.656] (-1114.757) -- 0:02:11 317500 -- (-1115.228) [-1120.385] (-1117.045) (-1123.189) * (-1113.103) (-1112.241) (-1110.405) [-1110.369] -- 0:02:11 318000 -- (-1119.958) [-1114.807] (-1113.873) (-1113.881) * (-1114.166) [-1111.957] (-1111.106) (-1113.942) -- 0:02:10 318500 -- (-1115.552) (-1126.881) (-1117.406) [-1112.468] * (-1108.858) [-1109.975] (-1121.951) (-1116.040) -- 0:02:10 319000 -- (-1118.241) (-1123.939) [-1112.419] (-1113.575) * (-1116.732) (-1117.705) (-1113.030) [-1109.419] -- 0:02:10 319500 -- (-1117.951) (-1120.471) [-1110.392] (-1129.004) * (-1113.590) (-1126.678) (-1116.602) [-1110.468] -- 0:02:09 320000 -- (-1115.509) (-1125.992) (-1109.988) [-1116.473] * [-1115.939] (-1115.763) (-1113.493) (-1113.196) -- 0:02:09 Average standard deviation of split frequencies: 0.002940 320500 -- (-1112.107) (-1126.766) (-1113.626) [-1108.493] * [-1117.365] (-1119.669) (-1117.255) (-1119.582) -- 0:02:09 321000 -- (-1121.054) (-1123.092) (-1115.439) [-1109.547] * (-1115.274) [-1120.162] (-1115.326) (-1121.631) -- 0:02:09 321500 -- (-1111.199) (-1120.727) (-1113.716) [-1111.951] * (-1114.999) [-1124.154] (-1112.634) (-1114.524) -- 0:02:08 322000 -- (-1109.699) [-1113.985] (-1113.216) (-1121.355) * [-1112.495] (-1116.761) (-1114.107) (-1113.234) -- 0:02:08 322500 -- (-1115.344) (-1119.406) [-1109.685] (-1113.293) * (-1109.755) [-1114.416] (-1112.721) (-1116.087) -- 0:02:10 323000 -- [-1111.780] (-1120.918) (-1116.808) (-1114.179) * [-1111.607] (-1119.165) (-1115.298) (-1121.600) -- 0:02:09 323500 -- (-1114.073) [-1113.328] (-1111.377) (-1113.832) * [-1110.731] (-1121.586) (-1119.323) (-1109.448) -- 0:02:09 324000 -- [-1117.133] (-1117.060) (-1113.636) (-1110.413) * (-1115.678) (-1112.532) (-1115.949) [-1111.227] -- 0:02:09 324500 -- (-1109.729) (-1113.752) (-1110.510) [-1110.483] * (-1118.691) (-1128.041) (-1109.935) [-1114.666] -- 0:02:09 325000 -- (-1112.086) (-1113.557) [-1117.557] (-1118.241) * (-1114.693) (-1121.202) (-1111.980) [-1111.937] -- 0:02:08 Average standard deviation of split frequencies: 0.001928 325500 -- (-1116.264) (-1108.269) [-1112.994] (-1111.771) * (-1107.960) (-1116.199) (-1108.384) [-1112.956] -- 0:02:08 326000 -- (-1117.241) (-1114.992) (-1109.904) [-1114.306] * (-1112.769) (-1110.558) (-1107.477) [-1113.069] -- 0:02:08 326500 -- (-1117.805) [-1109.780] (-1114.974) (-1114.149) * (-1113.122) [-1113.466] (-1113.704) (-1123.519) -- 0:02:07 327000 -- (-1116.454) [-1113.424] (-1112.456) (-1107.721) * [-1109.626] (-1119.969) (-1113.737) (-1121.184) -- 0:02:07 327500 -- (-1112.650) (-1115.937) [-1114.482] (-1109.617) * (-1109.690) (-1119.543) (-1115.807) [-1112.903] -- 0:02:09 328000 -- (-1114.210) [-1115.279] (-1114.685) (-1114.885) * (-1111.940) [-1116.305] (-1119.601) (-1113.249) -- 0:02:09 328500 -- [-1114.229] (-1121.301) (-1119.862) (-1111.124) * (-1117.633) (-1120.004) (-1115.878) [-1114.068] -- 0:02:08 329000 -- [-1114.366] (-1115.353) (-1116.508) (-1115.594) * (-1116.707) [-1121.218] (-1112.602) (-1121.372) -- 0:02:08 329500 -- (-1118.799) (-1117.261) (-1115.317) [-1114.292] * [-1113.804] (-1112.875) (-1113.272) (-1117.187) -- 0:02:08 330000 -- (-1114.641) (-1126.186) (-1114.895) [-1115.459] * [-1116.077] (-1114.194) (-1114.859) (-1118.575) -- 0:02:07 Average standard deviation of split frequencies: 0.002851 330500 -- (-1118.605) (-1116.710) [-1110.609] (-1116.339) * (-1109.073) [-1114.946] (-1114.022) (-1112.608) -- 0:02:07 331000 -- (-1112.216) (-1116.375) (-1115.800) [-1113.822] * [-1120.616] (-1119.513) (-1121.249) (-1112.835) -- 0:02:07 331500 -- (-1122.776) (-1120.014) (-1123.081) [-1112.333] * (-1114.747) (-1118.981) (-1116.769) [-1117.091] -- 0:02:07 332000 -- (-1115.882) (-1127.360) (-1114.254) [-1111.352] * (-1116.580) [-1118.256] (-1113.213) (-1109.767) -- 0:02:06 332500 -- (-1125.844) (-1115.860) [-1118.361] (-1121.823) * (-1119.193) [-1113.577] (-1115.331) (-1117.454) -- 0:02:06 333000 -- (-1114.398) [-1111.316] (-1112.239) (-1114.808) * (-1111.412) [-1121.461] (-1111.270) (-1114.430) -- 0:02:08 333500 -- [-1117.586] (-1107.376) (-1116.671) (-1121.365) * (-1112.087) (-1117.861) (-1111.108) [-1110.656] -- 0:02:07 334000 -- [-1124.249] (-1113.694) (-1120.334) (-1117.687) * (-1116.135) [-1114.205] (-1113.549) (-1110.845) -- 0:02:07 334500 -- (-1121.771) (-1122.362) [-1118.030] (-1111.477) * (-1113.304) [-1119.198] (-1109.875) (-1119.791) -- 0:02:07 335000 -- (-1121.787) (-1117.735) (-1124.539) [-1106.848] * (-1125.820) [-1112.487] (-1114.123) (-1113.581) -- 0:02:07 Average standard deviation of split frequencies: 0.003741 335500 -- (-1118.078) (-1110.815) [-1113.648] (-1114.009) * (-1114.496) (-1111.452) [-1112.463] (-1113.354) -- 0:02:06 336000 -- (-1121.987) [-1127.129] (-1115.516) (-1116.486) * (-1111.418) (-1106.640) (-1115.872) [-1109.414] -- 0:02:06 336500 -- (-1121.826) [-1115.006] (-1118.693) (-1112.614) * [-1111.299] (-1117.434) (-1119.042) (-1118.931) -- 0:02:06 337000 -- (-1122.686) (-1120.898) [-1116.221] (-1110.192) * (-1117.982) (-1122.837) [-1113.815] (-1111.210) -- 0:02:05 337500 -- (-1117.225) (-1112.649) (-1117.737) [-1118.372] * (-1119.291) [-1114.537] (-1115.294) (-1116.874) -- 0:02:05 338000 -- (-1116.082) [-1114.759] (-1116.009) (-1113.947) * (-1113.218) (-1113.497) [-1117.200] (-1113.338) -- 0:02:05 338500 -- (-1113.660) (-1109.053) (-1111.562) [-1116.003] * (-1114.181) (-1113.522) (-1115.520) [-1113.705] -- 0:02:07 339000 -- [-1114.071] (-1123.360) (-1118.356) (-1112.396) * [-1109.635] (-1117.436) (-1117.338) (-1116.072) -- 0:02:06 339500 -- (-1113.485) (-1123.114) [-1119.682] (-1122.719) * (-1112.935) (-1119.947) [-1114.808] (-1113.263) -- 0:02:06 340000 -- [-1114.255] (-1114.090) (-1129.712) (-1115.560) * (-1115.608) (-1120.300) [-1113.299] (-1117.759) -- 0:02:06 Average standard deviation of split frequencies: 0.005074 340500 -- (-1111.209) (-1116.309) (-1125.028) [-1113.919] * [-1110.675] (-1125.535) (-1115.057) (-1118.235) -- 0:02:05 341000 -- [-1118.497] (-1115.973) (-1121.877) (-1111.262) * (-1111.759) (-1113.491) [-1112.590] (-1127.715) -- 0:02:05 341500 -- (-1115.737) [-1111.495] (-1124.500) (-1116.909) * (-1119.429) [-1113.134] (-1109.431) (-1125.600) -- 0:02:05 342000 -- (-1116.919) (-1113.641) (-1124.298) [-1115.935] * (-1115.394) (-1113.178) [-1111.657] (-1126.622) -- 0:02:05 342500 -- (-1114.125) [-1111.021] (-1116.707) (-1117.566) * [-1111.367] (-1115.558) (-1112.273) (-1125.282) -- 0:02:04 343000 -- (-1114.193) [-1114.975] (-1112.783) (-1122.443) * (-1119.450) (-1119.977) (-1112.797) [-1121.763] -- 0:02:04 343500 -- (-1115.897) (-1117.689) (-1118.477) [-1112.206] * [-1114.107] (-1120.786) (-1117.528) (-1115.762) -- 0:02:06 344000 -- (-1113.773) (-1121.294) [-1107.818] (-1113.239) * (-1122.599) [-1112.049] (-1118.496) (-1119.013) -- 0:02:05 344500 -- [-1113.745] (-1116.682) (-1110.670) (-1117.799) * (-1116.337) [-1113.793] (-1112.224) (-1114.381) -- 0:02:05 345000 -- (-1125.574) (-1115.761) [-1116.139] (-1115.471) * [-1113.674] (-1109.277) (-1116.662) (-1112.408) -- 0:02:05 Average standard deviation of split frequencies: 0.004996 345500 -- [-1113.228] (-1117.559) (-1118.234) (-1125.637) * (-1120.468) (-1113.253) [-1121.173] (-1118.451) -- 0:02:05 346000 -- (-1117.039) [-1118.809] (-1116.424) (-1114.961) * (-1115.556) [-1113.882] (-1117.617) (-1130.407) -- 0:02:04 346500 -- [-1111.203] (-1117.657) (-1116.371) (-1111.178) * (-1116.519) [-1115.714] (-1122.292) (-1120.529) -- 0:02:04 347000 -- (-1110.522) [-1110.962] (-1116.603) (-1121.400) * [-1116.885] (-1115.349) (-1125.142) (-1122.177) -- 0:02:04 347500 -- (-1111.814) [-1111.237] (-1122.526) (-1118.226) * [-1114.461] (-1118.438) (-1115.706) (-1114.032) -- 0:02:03 348000 -- (-1119.851) (-1114.014) (-1109.693) [-1115.100] * (-1112.519) (-1111.548) [-1115.656] (-1116.686) -- 0:02:03 348500 -- [-1117.207] (-1117.601) (-1113.793) (-1119.979) * [-1116.487] (-1111.927) (-1115.823) (-1113.043) -- 0:02:05 349000 -- (-1122.344) (-1117.773) [-1118.591] (-1117.103) * (-1108.147) [-1108.576] (-1114.028) (-1114.902) -- 0:02:04 349500 -- (-1118.972) [-1112.528] (-1117.689) (-1112.046) * (-1110.733) [-1117.764] (-1129.133) (-1115.165) -- 0:02:04 350000 -- (-1118.806) (-1111.313) (-1121.771) [-1117.519] * [-1121.803] (-1111.984) (-1115.956) (-1115.905) -- 0:02:04 Average standard deviation of split frequencies: 0.003585 350500 -- (-1114.771) (-1119.961) (-1116.704) [-1115.259] * (-1119.007) [-1112.720] (-1124.918) (-1115.260) -- 0:02:04 351000 -- (-1121.726) (-1117.233) (-1113.366) [-1113.034] * (-1114.800) (-1113.513) [-1113.170] (-1123.277) -- 0:02:03 351500 -- (-1113.213) (-1124.558) (-1110.530) [-1116.148] * (-1113.573) (-1114.742) [-1113.572] (-1114.085) -- 0:02:03 352000 -- [-1115.779] (-1126.821) (-1111.080) (-1113.612) * [-1111.849] (-1113.988) (-1116.121) (-1121.109) -- 0:02:03 352500 -- [-1111.383] (-1115.781) (-1119.943) (-1124.325) * (-1118.075) [-1115.815] (-1113.313) (-1121.826) -- 0:02:03 353000 -- (-1111.685) (-1116.539) (-1110.127) [-1111.756] * (-1111.754) (-1114.976) (-1113.370) [-1115.083] -- 0:02:02 353500 -- (-1109.566) (-1115.883) [-1111.127] (-1122.246) * (-1119.263) (-1112.092) [-1113.535] (-1112.183) -- 0:02:04 354000 -- (-1114.324) [-1111.709] (-1112.501) (-1115.046) * [-1109.057] (-1123.034) (-1115.595) (-1114.519) -- 0:02:04 354500 -- (-1124.131) (-1113.012) [-1113.937] (-1111.041) * [-1113.080] (-1113.613) (-1117.642) (-1119.205) -- 0:02:03 355000 -- (-1120.121) (-1125.743) (-1125.428) [-1114.613] * (-1119.978) [-1113.199] (-1123.355) (-1113.498) -- 0:02:03 Average standard deviation of split frequencies: 0.004855 355500 -- (-1122.283) (-1116.622) [-1110.404] (-1110.170) * (-1116.986) (-1120.687) (-1115.026) [-1111.106] -- 0:02:03 356000 -- (-1117.746) [-1112.661] (-1112.895) (-1119.323) * (-1118.573) (-1113.914) [-1115.322] (-1123.451) -- 0:02:03 356500 -- (-1110.160) (-1120.756) (-1115.150) [-1114.283] * (-1112.678) [-1113.102] (-1119.013) (-1119.218) -- 0:02:02 357000 -- (-1110.215) (-1115.793) (-1116.165) [-1111.209] * (-1121.062) (-1114.724) (-1119.081) [-1114.879] -- 0:02:02 357500 -- [-1110.519] (-1112.667) (-1110.990) (-1110.081) * [-1123.904] (-1116.207) (-1116.522) (-1113.135) -- 0:02:02 358000 -- (-1115.504) (-1111.411) (-1110.974) [-1112.457] * (-1113.875) (-1118.785) (-1116.355) [-1107.713] -- 0:02:01 358500 -- (-1112.166) (-1118.555) [-1112.013] (-1114.034) * (-1117.403) (-1111.827) (-1118.250) [-1114.566] -- 0:02:01 359000 -- (-1119.046) [-1115.007] (-1116.794) (-1117.795) * [-1121.107] (-1122.842) (-1116.866) (-1116.151) -- 0:02:03 359500 -- (-1118.230) [-1115.275] (-1115.315) (-1121.202) * (-1116.684) [-1112.967] (-1114.888) (-1117.815) -- 0:02:02 360000 -- (-1114.078) [-1115.539] (-1115.005) (-1117.491) * (-1113.294) (-1116.181) [-1112.990] (-1121.614) -- 0:02:02 Average standard deviation of split frequencies: 0.004792 360500 -- (-1124.468) [-1110.562] (-1114.520) (-1120.913) * (-1120.537) (-1107.953) [-1112.765] (-1121.279) -- 0:02:02 361000 -- (-1126.236) [-1114.986] (-1124.959) (-1118.425) * (-1113.580) [-1120.812] (-1118.017) (-1125.930) -- 0:02:02 361500 -- (-1125.601) [-1113.491] (-1116.008) (-1111.507) * (-1122.687) [-1113.441] (-1116.897) (-1119.961) -- 0:02:01 362000 -- (-1121.643) (-1115.693) (-1118.956) [-1112.202] * [-1114.326] (-1108.937) (-1117.459) (-1122.227) -- 0:02:01 362500 -- (-1122.029) [-1117.805] (-1114.562) (-1113.494) * (-1116.116) [-1114.630] (-1108.419) (-1120.375) -- 0:02:01 363000 -- (-1117.605) [-1108.897] (-1112.617) (-1114.072) * (-1122.779) (-1117.683) (-1115.718) [-1114.557] -- 0:02:01 363500 -- (-1125.405) (-1116.974) [-1116.550] (-1118.776) * [-1116.768] (-1107.915) (-1116.607) (-1112.051) -- 0:02:00 364000 -- (-1117.536) (-1112.361) [-1111.970] (-1114.869) * (-1118.899) (-1115.384) (-1117.417) [-1109.228] -- 0:02:02 364500 -- (-1116.666) [-1111.437] (-1113.037) (-1114.125) * (-1118.008) [-1112.902] (-1116.162) (-1113.561) -- 0:02:02 365000 -- (-1120.861) (-1113.375) (-1120.959) [-1114.447] * (-1115.004) [-1112.259] (-1115.345) (-1115.534) -- 0:02:01 Average standard deviation of split frequencies: 0.003435 365500 -- [-1107.768] (-1111.523) (-1111.243) (-1114.161) * (-1119.559) (-1110.035) [-1113.394] (-1113.864) -- 0:02:01 366000 -- [-1111.648] (-1111.914) (-1110.850) (-1110.277) * (-1116.819) (-1112.650) (-1118.966) [-1112.403] -- 0:02:01 366500 -- (-1115.041) [-1113.923] (-1109.527) (-1114.809) * (-1115.104) (-1112.498) [-1113.452] (-1116.099) -- 0:02:00 367000 -- (-1123.084) (-1115.438) [-1111.137] (-1110.091) * (-1117.773) (-1109.078) (-1110.103) [-1115.845] -- 0:02:00 367500 -- (-1111.156) (-1111.785) [-1114.705] (-1109.977) * (-1108.806) [-1114.023] (-1114.979) (-1115.853) -- 0:02:00 368000 -- (-1114.278) (-1119.787) [-1114.448] (-1111.309) * (-1112.215) [-1119.514] (-1119.918) (-1115.380) -- 0:02:00 368500 -- (-1115.928) (-1115.778) (-1111.538) [-1117.078] * [-1114.529] (-1119.769) (-1109.488) (-1115.958) -- 0:01:59 369000 -- (-1116.098) (-1114.747) [-1109.776] (-1110.536) * (-1111.654) (-1112.712) (-1113.882) [-1111.087] -- 0:01:59 369500 -- (-1112.567) [-1112.900] (-1111.728) (-1115.528) * [-1115.219] (-1123.289) (-1110.357) (-1114.154) -- 0:02:01 370000 -- (-1113.241) [-1111.274] (-1117.729) (-1115.154) * (-1114.014) (-1114.515) [-1116.856] (-1110.315) -- 0:02:00 Average standard deviation of split frequencies: 0.003391 370500 -- (-1112.123) [-1114.621] (-1115.203) (-1122.259) * [-1111.463] (-1116.955) (-1113.746) (-1111.612) -- 0:02:00 371000 -- (-1112.596) (-1118.427) (-1114.765) [-1112.169] * (-1129.365) (-1114.395) [-1110.785] (-1114.033) -- 0:02:00 371500 -- (-1113.828) [-1108.743] (-1121.819) (-1110.755) * (-1110.026) (-1118.564) (-1111.916) [-1116.032] -- 0:02:00 372000 -- (-1115.619) (-1107.604) [-1115.758] (-1119.050) * (-1116.549) [-1115.233] (-1121.885) (-1115.919) -- 0:01:59 372500 -- [-1113.248] (-1113.950) (-1116.989) (-1120.450) * [-1115.509] (-1115.745) (-1123.726) (-1109.884) -- 0:01:59 373000 -- (-1117.709) (-1114.693) [-1119.192] (-1111.659) * [-1108.622] (-1117.831) (-1119.544) (-1110.120) -- 0:01:59 373500 -- (-1116.600) (-1114.348) (-1113.936) [-1111.589] * (-1113.409) [-1113.609] (-1112.075) (-1116.698) -- 0:01:59 374000 -- [-1113.482] (-1116.431) (-1112.630) (-1117.351) * (-1116.294) (-1112.174) [-1109.305] (-1120.751) -- 0:01:58 374500 -- (-1114.397) (-1112.613) (-1117.914) [-1115.632] * [-1112.322] (-1122.601) (-1112.970) (-1116.179) -- 0:01:58 375000 -- (-1117.855) (-1110.839) [-1113.014] (-1115.583) * (-1119.455) (-1120.105) [-1110.621] (-1115.290) -- 0:02:00 Average standard deviation of split frequencies: 0.003343 375500 -- (-1118.860) [-1112.913] (-1114.228) (-1113.599) * (-1119.101) (-1119.529) (-1113.350) [-1113.139] -- 0:01:59 376000 -- (-1111.608) (-1118.405) (-1117.679) [-1114.668] * (-1119.577) (-1113.484) (-1117.741) [-1111.654] -- 0:01:59 376500 -- (-1118.366) (-1117.322) [-1113.201] (-1117.739) * (-1109.263) (-1113.455) (-1114.837) [-1113.888] -- 0:01:59 377000 -- (-1116.107) (-1115.874) [-1113.115] (-1120.429) * (-1117.862) [-1119.716] (-1109.404) (-1118.650) -- 0:01:58 377500 -- (-1113.222) (-1118.705) [-1111.568] (-1123.764) * [-1113.261] (-1116.307) (-1108.381) (-1116.976) -- 0:01:58 378000 -- [-1118.761] (-1121.823) (-1109.538) (-1120.162) * (-1120.322) (-1124.361) [-1118.987] (-1113.356) -- 0:01:58 378500 -- (-1114.853) [-1114.111] (-1114.334) (-1127.953) * (-1116.248) [-1109.240] (-1109.812) (-1115.880) -- 0:01:58 379000 -- (-1126.832) [-1120.075] (-1107.198) (-1114.675) * [-1107.974] (-1111.709) (-1119.082) (-1114.948) -- 0:01:57 379500 -- [-1119.422] (-1114.864) (-1114.005) (-1115.130) * (-1111.960) [-1119.938] (-1112.797) (-1125.314) -- 0:01:57 380000 -- (-1122.064) (-1108.638) (-1111.706) [-1115.288] * (-1112.467) (-1116.547) [-1113.379] (-1116.759) -- 0:01:59 Average standard deviation of split frequencies: 0.004953 380500 -- (-1115.897) (-1110.785) [-1115.741] (-1118.685) * (-1116.593) (-1117.652) [-1113.344] (-1115.070) -- 0:01:58 381000 -- (-1121.185) [-1115.329] (-1123.112) (-1116.766) * [-1122.243] (-1117.569) (-1115.758) (-1113.771) -- 0:01:58 381500 -- (-1117.468) (-1113.963) [-1122.500] (-1116.417) * [-1121.291] (-1122.214) (-1112.002) (-1109.522) -- 0:01:58 382000 -- (-1117.512) [-1113.590] (-1114.414) (-1120.216) * (-1115.748) (-1121.965) (-1118.529) [-1111.009] -- 0:01:58 382500 -- (-1120.081) (-1124.364) (-1111.941) [-1115.686] * [-1119.361] (-1128.605) (-1114.725) (-1116.900) -- 0:01:57 383000 -- [-1118.032] (-1110.834) (-1110.833) (-1111.194) * [-1112.235] (-1109.433) (-1111.466) (-1110.444) -- 0:01:57 383500 -- (-1114.640) (-1112.835) [-1121.167] (-1114.378) * (-1110.126) [-1110.164] (-1120.821) (-1116.815) -- 0:01:57 384000 -- [-1115.046] (-1112.012) (-1118.493) (-1116.525) * (-1112.767) (-1122.562) (-1115.499) [-1115.188] -- 0:01:57 384500 -- (-1119.651) (-1112.596) (-1117.196) [-1113.352] * [-1113.803] (-1114.362) (-1119.429) (-1117.597) -- 0:01:56 385000 -- [-1118.782] (-1110.111) (-1114.444) (-1112.941) * (-1108.913) (-1117.833) (-1118.739) [-1116.788] -- 0:01:56 Average standard deviation of split frequencies: 0.007328 385500 -- (-1115.026) [-1111.586] (-1113.430) (-1124.522) * (-1117.539) (-1113.791) (-1110.277) [-1113.367] -- 0:01:57 386000 -- (-1119.378) (-1117.597) [-1121.656] (-1122.083) * [-1115.506] (-1116.925) (-1112.706) (-1112.133) -- 0:01:57 386500 -- [-1111.952] (-1111.908) (-1120.417) (-1119.508) * (-1115.760) [-1115.972] (-1109.961) (-1111.791) -- 0:01:57 387000 -- (-1117.841) (-1117.424) [-1110.755] (-1112.200) * (-1115.373) (-1125.326) (-1114.483) [-1113.152] -- 0:01:57 387500 -- (-1116.478) (-1120.810) [-1114.732] (-1117.603) * [-1111.775] (-1124.804) (-1116.919) (-1111.319) -- 0:01:56 388000 -- (-1118.608) [-1114.497] (-1117.938) (-1123.294) * (-1123.111) (-1115.834) [-1110.268] (-1108.825) -- 0:01:56 388500 -- (-1117.429) (-1120.701) [-1117.916] (-1120.236) * [-1110.934] (-1127.152) (-1115.115) (-1111.580) -- 0:01:56 389000 -- (-1116.777) (-1115.466) [-1113.526] (-1112.143) * (-1114.247) (-1121.562) [-1119.283] (-1118.434) -- 0:01:56 389500 -- [-1115.658] (-1118.082) (-1121.275) (-1120.582) * [-1115.962] (-1119.740) (-1120.693) (-1116.097) -- 0:01:55 390000 -- (-1109.820) [-1123.016] (-1116.335) (-1118.206) * [-1109.093] (-1114.987) (-1122.168) (-1113.584) -- 0:01:55 Average standard deviation of split frequencies: 0.008044 390500 -- [-1113.136] (-1123.250) (-1117.046) (-1112.127) * (-1116.764) [-1118.135] (-1114.170) (-1119.160) -- 0:01:57 391000 -- (-1116.983) [-1119.937] (-1117.742) (-1118.967) * (-1117.336) [-1112.498] (-1123.388) (-1121.640) -- 0:01:56 391500 -- (-1116.028) (-1117.140) [-1113.905] (-1111.863) * [-1112.496] (-1119.496) (-1110.830) (-1115.394) -- 0:01:56 392000 -- (-1112.277) (-1117.465) (-1111.370) [-1106.967] * (-1118.877) [-1113.915] (-1113.765) (-1119.012) -- 0:01:56 392500 -- (-1113.819) [-1108.162] (-1116.359) (-1112.670) * (-1117.489) (-1113.228) [-1115.646] (-1122.975) -- 0:01:56 393000 -- [-1114.804] (-1113.481) (-1121.059) (-1114.923) * [-1112.546] (-1119.450) (-1114.395) (-1117.545) -- 0:01:55 393500 -- (-1110.709) [-1110.915] (-1115.773) (-1118.138) * (-1112.590) (-1118.785) [-1115.149] (-1122.889) -- 0:01:55 394000 -- (-1115.093) (-1115.483) [-1113.597] (-1115.138) * [-1115.794] (-1119.890) (-1123.963) (-1120.111) -- 0:01:55 394500 -- (-1117.893) (-1118.515) [-1112.415] (-1115.470) * (-1115.456) [-1113.916] (-1116.150) (-1114.901) -- 0:01:55 395000 -- (-1114.302) (-1114.715) [-1111.465] (-1116.716) * (-1122.375) (-1115.089) [-1111.869] (-1118.493) -- 0:01:54 Average standard deviation of split frequencies: 0.007936 395500 -- (-1117.835) (-1109.045) (-1111.516) [-1112.352] * (-1125.159) (-1110.475) [-1109.868] (-1114.623) -- 0:01:54 396000 -- (-1115.537) (-1111.278) (-1119.175) [-1113.114] * (-1122.605) (-1115.692) [-1110.039] (-1114.531) -- 0:01:55 396500 -- (-1122.742) (-1114.540) [-1110.853] (-1112.054) * (-1117.537) (-1112.656) [-1113.236] (-1118.996) -- 0:01:55 397000 -- (-1116.868) (-1111.201) [-1115.713] (-1109.091) * (-1116.947) (-1114.619) [-1110.980] (-1115.006) -- 0:01:55 397500 -- (-1114.446) (-1117.434) [-1116.327] (-1120.081) * [-1117.832] (-1112.992) (-1116.561) (-1113.796) -- 0:01:55 398000 -- [-1110.887] (-1110.836) (-1112.853) (-1129.064) * (-1115.956) [-1113.864] (-1124.052) (-1111.568) -- 0:01:54 398500 -- [-1110.576] (-1112.202) (-1119.169) (-1109.470) * (-1111.719) [-1113.162] (-1116.485) (-1118.878) -- 0:01:54 399000 -- (-1116.055) (-1106.867) [-1116.523] (-1114.605) * [-1110.821] (-1116.575) (-1118.192) (-1111.098) -- 0:01:54 399500 -- (-1120.927) (-1108.623) [-1119.499] (-1110.309) * (-1113.695) (-1110.208) [-1112.820] (-1123.009) -- 0:01:54 400000 -- (-1118.311) (-1116.665) (-1113.071) [-1115.102] * [-1114.561] (-1109.357) (-1118.995) (-1119.553) -- 0:01:54 Average standard deviation of split frequencies: 0.007451 400500 -- [-1118.596] (-1126.703) (-1112.888) (-1112.052) * (-1111.489) (-1111.493) [-1112.671] (-1126.435) -- 0:01:53 401000 -- [-1111.216] (-1117.031) (-1113.097) (-1117.554) * (-1118.213) (-1115.117) (-1119.737) [-1112.895] -- 0:01:53 401500 -- [-1115.348] (-1112.000) (-1119.300) (-1113.872) * (-1114.001) [-1110.014] (-1117.677) (-1115.126) -- 0:01:54 402000 -- (-1116.371) [-1110.217] (-1113.586) (-1125.489) * (-1112.491) [-1110.841] (-1111.084) (-1119.485) -- 0:01:54 402500 -- (-1110.289) (-1111.401) (-1112.754) [-1119.570] * (-1118.850) (-1110.772) (-1119.263) [-1120.924] -- 0:01:54 403000 -- (-1114.866) (-1112.794) (-1116.502) [-1115.471] * (-1114.353) (-1109.833) [-1115.692] (-1112.430) -- 0:01:54 403500 -- [-1115.712] (-1119.024) (-1120.638) (-1113.618) * (-1110.080) (-1109.868) (-1113.623) [-1115.086] -- 0:01:53 404000 -- [-1110.710] (-1112.826) (-1125.891) (-1112.825) * (-1114.405) (-1115.751) [-1113.014] (-1119.855) -- 0:01:53 404500 -- (-1117.601) [-1114.322] (-1128.285) (-1113.953) * [-1115.604] (-1118.434) (-1117.818) (-1117.563) -- 0:01:53 405000 -- [-1110.666] (-1130.719) (-1114.385) (-1115.387) * (-1117.355) (-1112.757) [-1112.455] (-1119.686) -- 0:01:53 Average standard deviation of split frequencies: 0.006967 405500 -- (-1113.421) (-1119.441) (-1115.595) [-1114.774] * (-1115.037) (-1113.206) (-1119.040) [-1115.889] -- 0:01:52 406000 -- (-1118.727) [-1121.083] (-1117.158) (-1115.563) * (-1122.723) (-1116.255) (-1127.862) [-1116.773] -- 0:01:52 406500 -- (-1113.720) (-1113.834) (-1117.765) [-1110.193] * (-1129.110) (-1112.671) [-1111.903] (-1113.455) -- 0:01:53 407000 -- [-1110.222] (-1109.730) (-1121.283) (-1117.442) * (-1120.277) (-1114.290) (-1109.195) [-1112.079] -- 0:01:53 407500 -- (-1112.571) [-1109.887] (-1110.958) (-1109.595) * (-1116.605) (-1111.788) [-1110.585] (-1110.171) -- 0:01:53 408000 -- (-1125.705) (-1111.870) [-1114.956] (-1112.082) * (-1121.329) (-1113.518) (-1123.611) [-1115.928] -- 0:01:53 408500 -- (-1121.519) (-1114.192) [-1116.279] (-1121.349) * (-1123.260) (-1111.353) [-1115.024] (-1115.126) -- 0:01:52 409000 -- (-1122.084) (-1111.681) [-1111.641] (-1112.081) * (-1119.467) (-1109.833) (-1117.861) [-1116.614] -- 0:01:52 409500 -- [-1121.009] (-1112.675) (-1111.771) (-1114.666) * (-1118.552) (-1120.917) [-1115.485] (-1120.619) -- 0:01:52 410000 -- (-1116.566) (-1122.497) [-1112.433] (-1118.954) * (-1116.586) [-1111.299] (-1112.841) (-1115.236) -- 0:01:52 Average standard deviation of split frequencies: 0.006887 410500 -- (-1112.677) [-1112.950] (-1114.837) (-1113.299) * (-1115.295) [-1112.997] (-1122.783) (-1116.990) -- 0:01:52 411000 -- (-1112.507) (-1120.080) (-1120.343) [-1115.505] * [-1115.299] (-1118.224) (-1117.900) (-1115.144) -- 0:01:51 411500 -- (-1108.770) [-1111.995] (-1121.887) (-1113.139) * (-1114.703) (-1117.855) (-1110.491) [-1110.079] -- 0:01:51 412000 -- [-1108.994] (-1114.610) (-1109.121) (-1119.856) * [-1110.237] (-1116.509) (-1110.396) (-1108.500) -- 0:01:52 412500 -- (-1119.793) [-1114.067] (-1115.555) (-1114.774) * [-1108.974] (-1112.816) (-1120.003) (-1117.039) -- 0:01:52 413000 -- (-1116.601) (-1114.772) (-1110.998) [-1119.216] * (-1111.834) (-1118.430) [-1111.737] (-1112.574) -- 0:01:52 413500 -- (-1117.131) (-1117.511) (-1113.547) [-1108.977] * [-1108.665] (-1108.334) (-1112.626) (-1113.594) -- 0:01:52 414000 -- [-1113.014] (-1122.933) (-1114.032) (-1113.137) * (-1115.567) (-1109.921) [-1116.732] (-1113.096) -- 0:01:51 414500 -- (-1114.879) (-1114.205) (-1118.688) [-1120.341] * (-1116.150) [-1110.655] (-1115.484) (-1114.875) -- 0:01:51 415000 -- (-1120.125) [-1112.821] (-1121.343) (-1109.174) * [-1109.699] (-1115.966) (-1116.524) (-1107.405) -- 0:01:51 Average standard deviation of split frequencies: 0.006799 415500 -- (-1116.626) (-1114.211) (-1115.849) [-1108.512] * (-1112.982) (-1114.729) (-1113.022) [-1109.925] -- 0:01:51 416000 -- (-1113.967) [-1113.334] (-1114.062) (-1116.258) * [-1115.750] (-1113.778) (-1115.769) (-1108.269) -- 0:01:50 416500 -- (-1116.541) (-1113.231) (-1110.787) [-1112.227] * [-1110.546] (-1117.973) (-1114.065) (-1116.650) -- 0:01:50 417000 -- (-1117.763) (-1117.706) (-1110.746) [-1110.951] * (-1114.218) [-1114.368] (-1116.290) (-1115.917) -- 0:01:51 417500 -- (-1124.059) [-1124.399] (-1117.329) (-1113.483) * (-1119.215) (-1117.909) (-1115.464) [-1113.816] -- 0:01:51 418000 -- (-1111.439) [-1115.232] (-1118.162) (-1115.396) * (-1126.642) (-1117.244) (-1115.118) [-1113.536] -- 0:01:51 418500 -- [-1117.476] (-1110.100) (-1126.263) (-1114.942) * (-1120.904) (-1121.299) [-1112.602] (-1114.189) -- 0:01:51 419000 -- (-1110.827) [-1116.599] (-1115.822) (-1112.029) * (-1118.749) (-1122.065) (-1114.846) [-1109.458] -- 0:01:50 419500 -- (-1108.217) (-1110.486) [-1113.160] (-1115.837) * (-1114.639) (-1114.458) (-1112.260) [-1112.379] -- 0:01:50 420000 -- (-1113.403) (-1113.337) [-1115.150] (-1116.111) * (-1110.963) (-1112.893) (-1111.979) [-1123.061] -- 0:01:50 Average standard deviation of split frequencies: 0.007097 420500 -- (-1111.939) [-1108.365] (-1120.593) (-1121.769) * (-1116.328) [-1113.373] (-1110.755) (-1115.195) -- 0:01:50 421000 -- (-1118.710) [-1112.169] (-1114.843) (-1110.839) * (-1114.425) (-1116.454) [-1114.625] (-1114.421) -- 0:01:50 421500 -- (-1116.530) (-1108.196) (-1115.231) [-1114.546] * (-1115.323) (-1116.053) (-1111.143) [-1115.288] -- 0:01:51 422000 -- [-1112.273] (-1115.135) (-1117.401) (-1114.450) * (-1117.453) [-1111.268] (-1119.296) (-1118.468) -- 0:01:50 422500 -- (-1115.348) (-1112.001) [-1113.510] (-1121.212) * (-1118.440) [-1115.099] (-1116.577) (-1122.454) -- 0:01:50 423000 -- (-1112.317) [-1111.837] (-1116.889) (-1120.449) * (-1114.930) [-1117.908] (-1115.635) (-1114.610) -- 0:01:50 423500 -- (-1113.081) [-1120.464] (-1114.682) (-1121.185) * (-1118.642) [-1114.575] (-1116.362) (-1110.222) -- 0:01:50 424000 -- [-1108.677] (-1122.425) (-1115.341) (-1126.789) * (-1118.045) (-1117.610) (-1113.516) [-1114.299] -- 0:01:50 424500 -- [-1110.241] (-1118.276) (-1113.954) (-1120.045) * [-1113.346] (-1116.837) (-1108.732) (-1118.369) -- 0:01:49 425000 -- (-1111.089) (-1111.451) (-1119.006) [-1119.145] * (-1111.962) [-1112.756] (-1116.567) (-1116.509) -- 0:01:49 Average standard deviation of split frequencies: 0.006640 425500 -- [-1117.570] (-1117.098) (-1121.209) (-1118.348) * (-1109.954) (-1113.892) [-1109.845] (-1115.448) -- 0:01:49 426000 -- (-1112.585) [-1111.949] (-1112.285) (-1122.263) * (-1123.521) (-1128.678) (-1109.456) [-1109.627] -- 0:01:50 426500 -- (-1112.911) [-1120.701] (-1116.593) (-1116.707) * (-1111.011) (-1124.509) (-1120.511) [-1112.088] -- 0:01:50 427000 -- [-1109.220] (-1111.477) (-1119.396) (-1119.073) * (-1118.904) (-1116.885) (-1112.678) [-1115.391] -- 0:01:50 427500 -- (-1113.080) [-1119.062] (-1116.084) (-1121.780) * (-1113.959) (-1115.044) (-1115.975) [-1120.778] -- 0:01:49 428000 -- (-1121.202) (-1115.896) (-1115.189) [-1115.816] * (-1122.715) (-1111.173) (-1119.361) [-1114.392] -- 0:01:49 428500 -- [-1110.973] (-1119.926) (-1116.709) (-1121.151) * (-1113.920) [-1109.942] (-1117.412) (-1111.980) -- 0:01:49 429000 -- (-1114.828) (-1108.415) (-1120.720) [-1124.880] * [-1114.260] (-1111.542) (-1120.190) (-1115.945) -- 0:01:49 429500 -- [-1119.419] (-1115.338) (-1113.864) (-1119.281) * (-1117.240) (-1116.245) (-1115.395) [-1109.446] -- 0:01:48 430000 -- (-1110.967) (-1115.409) [-1129.217] (-1112.389) * (-1112.318) (-1125.074) (-1112.946) [-1116.658] -- 0:01:48 Average standard deviation of split frequencies: 0.006568 430500 -- [-1114.495] (-1117.678) (-1116.544) (-1113.266) * (-1115.126) [-1113.148] (-1114.141) (-1110.008) -- 0:01:48 431000 -- (-1123.107) (-1120.801) (-1115.450) [-1112.742] * (-1119.972) [-1113.720] (-1117.143) (-1115.122) -- 0:01:48 431500 -- (-1116.241) (-1114.892) [-1118.231] (-1121.417) * (-1112.332) [-1112.453] (-1111.449) (-1116.022) -- 0:01:49 432000 -- (-1113.862) (-1114.816) (-1119.872) [-1116.326] * (-1116.506) (-1114.596) [-1118.157] (-1115.442) -- 0:01:49 432500 -- (-1115.618) [-1109.371] (-1113.568) (-1112.965) * (-1114.234) (-1112.535) [-1115.184] (-1111.275) -- 0:01:48 433000 -- (-1115.642) (-1111.691) [-1115.789] (-1118.522) * (-1125.199) [-1112.323] (-1116.510) (-1115.841) -- 0:01:48 433500 -- (-1121.158) (-1113.062) (-1110.122) [-1116.492] * (-1118.748) (-1113.195) [-1115.561] (-1116.331) -- 0:01:48 434000 -- (-1109.302) (-1117.620) (-1114.877) [-1115.018] * (-1121.423) (-1110.816) [-1112.736] (-1128.066) -- 0:01:48 434500 -- (-1111.226) (-1114.315) [-1110.554] (-1119.938) * (-1123.078) [-1110.232] (-1114.800) (-1118.395) -- 0:01:48 435000 -- [-1109.643] (-1106.478) (-1116.628) (-1112.118) * (-1116.484) (-1113.633) (-1113.170) [-1114.610] -- 0:01:47 Average standard deviation of split frequencies: 0.006848 435500 -- (-1109.503) (-1112.556) [-1114.625] (-1122.499) * (-1119.524) (-1110.608) (-1114.539) [-1116.897] -- 0:01:47 436000 -- [-1111.586] (-1117.609) (-1113.707) (-1124.169) * (-1117.435) [-1115.632] (-1114.708) (-1113.438) -- 0:01:47 436500 -- [-1112.202] (-1119.873) (-1109.480) (-1120.737) * (-1122.944) (-1111.496) [-1116.219] (-1119.349) -- 0:01:48 437000 -- (-1120.993) (-1113.694) [-1111.713] (-1124.793) * [-1114.246] (-1113.816) (-1115.750) (-1112.199) -- 0:01:48 437500 -- [-1114.500] (-1112.502) (-1107.628) (-1126.459) * (-1113.731) (-1112.232) (-1114.735) [-1119.041] -- 0:01:48 438000 -- (-1114.315) [-1112.745] (-1116.813) (-1117.932) * (-1122.614) (-1121.005) [-1112.256] (-1119.053) -- 0:01:47 438500 -- (-1122.943) (-1116.665) [-1122.678] (-1116.004) * (-1123.068) [-1114.101] (-1121.570) (-1116.776) -- 0:01:47 439000 -- (-1118.272) (-1113.545) [-1111.015] (-1115.867) * (-1118.475) [-1112.056] (-1107.904) (-1123.630) -- 0:01:47 439500 -- (-1120.437) (-1116.537) [-1113.887] (-1117.731) * (-1120.865) (-1113.445) [-1115.101] (-1119.050) -- 0:01:47 440000 -- (-1114.244) (-1124.527) [-1118.632] (-1118.445) * (-1115.729) (-1112.305) [-1110.687] (-1125.665) -- 0:01:46 Average standard deviation of split frequencies: 0.006419 440500 -- (-1121.462) (-1112.796) [-1119.766] (-1124.256) * [-1115.350] (-1112.720) (-1115.447) (-1119.168) -- 0:01:46 441000 -- (-1122.775) (-1112.929) (-1114.181) [-1116.796] * [-1112.596] (-1110.674) (-1122.484) (-1113.675) -- 0:01:46 441500 -- (-1114.496) [-1115.109] (-1118.820) (-1121.868) * (-1123.853) [-1115.040] (-1126.050) (-1115.456) -- 0:01:46 442000 -- (-1110.765) (-1123.651) [-1115.317] (-1112.521) * (-1111.884) (-1111.963) (-1118.441) [-1112.595] -- 0:01:47 442500 -- (-1116.914) (-1112.502) (-1112.533) [-1112.343] * [-1110.574] (-1110.881) (-1123.182) (-1114.916) -- 0:01:47 443000 -- (-1116.436) (-1113.311) (-1111.868) [-1114.464] * (-1117.211) [-1110.415] (-1108.532) (-1117.084) -- 0:01:46 443500 -- (-1109.727) (-1119.762) [-1109.117] (-1118.374) * (-1116.385) (-1110.830) (-1113.088) [-1116.321] -- 0:01:46 444000 -- (-1115.324) (-1112.721) (-1108.866) [-1113.236] * (-1119.562) (-1112.320) (-1114.940) [-1117.501] -- 0:01:46 444500 -- (-1119.419) (-1114.618) (-1116.395) [-1117.760] * (-1111.898) [-1115.214] (-1112.407) (-1120.474) -- 0:01:46 445000 -- (-1117.905) (-1112.894) [-1109.446] (-1125.481) * (-1108.287) [-1112.602] (-1114.081) (-1115.001) -- 0:01:46 Average standard deviation of split frequencies: 0.006342 445500 -- (-1117.389) (-1109.314) (-1125.451) [-1112.494] * (-1114.997) (-1117.296) [-1113.282] (-1114.211) -- 0:01:45 446000 -- (-1110.932) (-1115.082) (-1118.381) [-1117.618] * [-1111.181] (-1111.882) (-1116.671) (-1116.148) -- 0:01:45 446500 -- (-1111.863) [-1108.665] (-1115.591) (-1111.841) * (-1118.297) (-1115.262) [-1114.326] (-1121.874) -- 0:01:45 447000 -- [-1109.848] (-1118.048) (-1121.141) (-1108.750) * (-1120.153) [-1110.098] (-1118.713) (-1117.865) -- 0:01:46 447500 -- [-1116.607] (-1115.039) (-1111.773) (-1118.287) * (-1113.819) (-1115.539) [-1120.264] (-1111.775) -- 0:01:46 448000 -- (-1112.754) (-1113.803) [-1120.069] (-1116.977) * (-1113.966) [-1114.601] (-1113.464) (-1116.219) -- 0:01:45 448500 -- (-1114.308) [-1106.981] (-1115.527) (-1114.995) * (-1118.221) [-1116.449] (-1119.296) (-1116.378) -- 0:01:45 449000 -- (-1113.079) (-1118.087) (-1115.162) [-1111.797] * (-1125.109) (-1124.972) (-1112.372) [-1113.167] -- 0:01:45 449500 -- (-1119.968) [-1116.762] (-1118.210) (-1114.237) * (-1123.788) (-1118.877) (-1116.227) [-1112.676] -- 0:01:45 450000 -- (-1116.456) [-1118.262] (-1116.443) (-1110.955) * (-1128.003) (-1117.042) (-1114.932) [-1111.643] -- 0:01:45 Average standard deviation of split frequencies: 0.005927 450500 -- (-1119.213) (-1117.281) (-1113.982) [-1112.868] * (-1122.499) [-1114.486] (-1113.482) (-1116.016) -- 0:01:44 451000 -- (-1111.655) (-1118.135) (-1113.806) [-1111.733] * (-1121.174) (-1112.227) (-1120.030) [-1115.027] -- 0:01:44 451500 -- [-1119.581] (-1108.397) (-1111.374) (-1111.959) * [-1119.707] (-1115.324) (-1119.168) (-1113.936) -- 0:01:44 452000 -- (-1118.630) (-1107.866) (-1118.483) [-1113.460] * [-1115.976] (-1116.624) (-1117.687) (-1122.006) -- 0:01:44 452500 -- (-1116.330) [-1111.959] (-1115.550) (-1125.583) * [-1113.872] (-1113.191) (-1114.665) (-1123.157) -- 0:01:45 453000 -- (-1115.778) [-1117.602] (-1116.831) (-1119.287) * (-1111.785) (-1112.227) [-1116.628] (-1114.050) -- 0:01:45 453500 -- (-1119.671) (-1115.323) (-1118.971) [-1113.917] * (-1117.181) (-1113.221) [-1115.924] (-1113.822) -- 0:01:44 454000 -- (-1114.107) (-1119.435) (-1113.093) [-1117.949] * (-1110.437) (-1117.222) (-1113.563) [-1114.523] -- 0:01:44 454500 -- [-1116.020] (-1114.594) (-1111.372) (-1125.233) * (-1118.224) [-1112.831] (-1112.836) (-1119.843) -- 0:01:44 455000 -- (-1119.156) (-1112.904) [-1114.060] (-1117.533) * (-1121.207) [-1114.692] (-1123.750) (-1120.309) -- 0:01:44 Average standard deviation of split frequencies: 0.005858 455500 -- [-1118.265] (-1117.082) (-1117.010) (-1111.180) * [-1109.047] (-1112.559) (-1122.422) (-1116.179) -- 0:01:43 456000 -- (-1120.097) [-1119.528] (-1118.362) (-1114.939) * [-1118.180] (-1115.783) (-1118.381) (-1113.531) -- 0:01:43 456500 -- (-1114.681) (-1126.755) (-1120.425) [-1122.302] * (-1111.654) (-1116.554) [-1119.134] (-1115.607) -- 0:01:43 457000 -- [-1111.709] (-1116.131) (-1120.344) (-1112.465) * (-1113.091) (-1114.535) [-1112.203] (-1119.015) -- 0:01:43 457500 -- (-1114.047) (-1117.706) [-1110.208] (-1109.511) * [-1118.649] (-1123.876) (-1116.308) (-1113.855) -- 0:01:44 458000 -- [-1110.677] (-1113.983) (-1115.645) (-1112.349) * (-1112.389) (-1111.097) [-1111.302] (-1115.716) -- 0:01:44 458500 -- (-1116.268) (-1118.888) (-1120.185) [-1115.240] * [-1117.794] (-1128.671) (-1115.505) (-1113.543) -- 0:01:43 459000 -- (-1111.033) [-1110.865] (-1118.958) (-1125.910) * [-1110.698] (-1113.847) (-1109.746) (-1112.007) -- 0:01:43 459500 -- (-1111.810) (-1110.845) [-1110.490] (-1110.882) * (-1112.472) (-1111.164) [-1114.366] (-1117.717) -- 0:01:43 460000 -- [-1115.579] (-1114.919) (-1115.302) (-1110.390) * [-1111.802] (-1110.572) (-1124.519) (-1111.705) -- 0:01:43 Average standard deviation of split frequencies: 0.006481 460500 -- (-1113.043) (-1114.920) [-1116.596] (-1112.748) * (-1113.550) [-1114.361] (-1118.896) (-1116.397) -- 0:01:43 461000 -- (-1116.565) [-1114.841] (-1111.846) (-1119.368) * [-1113.485] (-1113.334) (-1119.652) (-1118.760) -- 0:01:42 461500 -- (-1113.843) [-1112.605] (-1115.029) (-1118.128) * [-1116.858] (-1111.108) (-1115.813) (-1113.577) -- 0:01:42 462000 -- (-1120.658) (-1113.635) [-1114.664] (-1113.924) * (-1112.523) [-1113.231] (-1127.123) (-1118.428) -- 0:01:42 462500 -- (-1123.961) [-1109.219] (-1115.161) (-1118.970) * [-1114.541] (-1114.291) (-1124.212) (-1113.515) -- 0:01:42 463000 -- (-1125.504) [-1110.591] (-1121.529) (-1122.332) * [-1116.832] (-1112.481) (-1121.565) (-1114.908) -- 0:01:43 463500 -- (-1121.702) [-1110.222] (-1112.007) (-1113.970) * (-1114.643) (-1116.788) (-1109.607) [-1118.467] -- 0:01:43 464000 -- (-1119.865) [-1112.068] (-1113.897) (-1113.579) * (-1123.424) (-1110.837) [-1109.173] (-1123.289) -- 0:01:42 464500 -- [-1108.190] (-1111.311) (-1114.791) (-1112.973) * (-1121.161) [-1113.677] (-1119.467) (-1113.781) -- 0:01:42 465000 -- (-1117.835) [-1110.955] (-1116.472) (-1116.708) * (-1112.803) (-1116.862) (-1129.779) [-1114.258] -- 0:01:42 Average standard deviation of split frequencies: 0.006407 465500 -- (-1118.985) (-1114.443) [-1113.869] (-1118.470) * (-1116.103) (-1116.435) (-1114.969) [-1111.239] -- 0:01:42 466000 -- (-1121.279) (-1112.975) [-1116.068] (-1127.057) * (-1117.479) [-1118.275] (-1120.681) (-1111.486) -- 0:01:41 466500 -- (-1119.426) [-1108.339] (-1117.390) (-1113.443) * (-1114.769) (-1113.345) (-1115.431) [-1118.108] -- 0:01:41 467000 -- (-1119.758) [-1117.154] (-1120.872) (-1120.473) * (-1121.385) (-1117.896) [-1110.203] (-1115.260) -- 0:01:41 467500 -- (-1115.529) [-1110.829] (-1117.656) (-1120.925) * [-1115.216] (-1112.609) (-1111.096) (-1112.479) -- 0:01:41 468000 -- (-1112.774) (-1110.620) [-1117.276] (-1116.285) * (-1116.118) (-1115.212) (-1116.228) [-1121.942] -- 0:01:42 468500 -- [-1109.293] (-1111.563) (-1114.172) (-1117.274) * (-1112.635) [-1115.087] (-1121.814) (-1109.204) -- 0:01:42 469000 -- (-1108.734) (-1120.818) (-1112.517) [-1117.853] * (-1124.555) [-1112.488] (-1121.050) (-1113.982) -- 0:01:41 469500 -- [-1119.262] (-1115.825) (-1111.262) (-1115.426) * [-1115.991] (-1113.968) (-1113.871) (-1112.625) -- 0:01:41 470000 -- (-1115.173) [-1111.482] (-1118.496) (-1112.906) * [-1109.609] (-1111.087) (-1116.490) (-1119.176) -- 0:01:41 Average standard deviation of split frequencies: 0.006343 470500 -- [-1112.700] (-1114.387) (-1120.880) (-1110.850) * (-1117.505) (-1118.481) (-1110.929) [-1112.612] -- 0:01:41 471000 -- (-1111.874) (-1116.498) (-1117.217) [-1110.986] * [-1111.343] (-1116.801) (-1119.373) (-1113.762) -- 0:01:41 471500 -- [-1119.547] (-1112.287) (-1113.648) (-1111.704) * (-1111.921) [-1116.244] (-1118.064) (-1122.710) -- 0:01:40 472000 -- (-1119.624) (-1119.575) (-1112.027) [-1110.346] * (-1115.564) [-1110.774] (-1114.504) (-1113.164) -- 0:01:40 472500 -- (-1116.463) (-1120.888) (-1120.066) [-1116.943] * (-1119.550) [-1111.029] (-1123.159) (-1110.202) -- 0:01:40 473000 -- (-1115.935) (-1113.224) [-1127.871] (-1110.198) * (-1119.326) (-1113.199) (-1115.189) [-1109.469] -- 0:01:40 473500 -- (-1119.746) (-1117.571) (-1114.641) [-1113.733] * (-1115.403) (-1109.772) [-1117.012] (-1119.072) -- 0:01:41 474000 -- [-1116.417] (-1121.025) (-1120.441) (-1118.530) * [-1120.253] (-1117.228) (-1117.262) (-1114.078) -- 0:01:40 474500 -- [-1124.298] (-1115.551) (-1113.652) (-1114.995) * (-1113.918) [-1115.397] (-1116.685) (-1116.429) -- 0:01:40 475000 -- (-1125.823) (-1118.269) (-1121.785) [-1117.784] * (-1111.758) (-1111.212) [-1112.908] (-1115.921) -- 0:01:40 Average standard deviation of split frequencies: 0.006602 475500 -- (-1118.134) [-1120.348] (-1114.030) (-1112.502) * [-1111.558] (-1119.056) (-1110.192) (-1114.762) -- 0:01:40 476000 -- (-1120.058) (-1120.177) [-1110.547] (-1113.231) * [-1111.631] (-1113.383) (-1123.038) (-1115.996) -- 0:01:40 476500 -- [-1122.566] (-1116.552) (-1115.203) (-1112.659) * (-1110.825) (-1114.585) [-1112.650] (-1115.631) -- 0:01:39 477000 -- (-1114.147) [-1113.205] (-1113.041) (-1112.625) * (-1115.750) (-1112.555) [-1111.660] (-1118.485) -- 0:01:39 477500 -- (-1113.857) (-1119.963) [-1108.979] (-1119.998) * [-1110.835] (-1115.426) (-1114.311) (-1115.130) -- 0:01:39 478000 -- (-1121.028) [-1114.206] (-1114.629) (-1113.416) * [-1109.781] (-1114.433) (-1113.385) (-1114.983) -- 0:01:39 478500 -- (-1113.975) (-1116.942) [-1112.756] (-1109.674) * (-1120.066) (-1114.965) [-1110.725] (-1117.593) -- 0:01:40 479000 -- (-1114.716) (-1116.472) (-1113.796) [-1108.566] * (-1119.415) (-1107.092) (-1112.810) [-1111.248] -- 0:01:40 479500 -- (-1124.490) [-1110.837] (-1118.513) (-1122.914) * (-1118.289) [-1110.153] (-1110.403) (-1115.030) -- 0:01:39 480000 -- (-1126.391) (-1114.569) [-1114.373] (-1108.908) * (-1118.565) (-1108.745) (-1111.940) [-1117.638] -- 0:01:39 Average standard deviation of split frequencies: 0.006538 480500 -- (-1115.996) (-1118.905) (-1122.572) [-1112.482] * (-1119.660) [-1117.519] (-1116.887) (-1116.447) -- 0:01:39 481000 -- [-1115.950] (-1111.429) (-1123.148) (-1121.019) * (-1118.898) (-1114.354) (-1112.846) [-1120.469] -- 0:01:39 481500 -- (-1116.188) (-1112.768) [-1116.067] (-1117.978) * (-1115.681) (-1116.813) (-1114.617) [-1112.997] -- 0:01:39 482000 -- (-1114.353) (-1116.615) [-1112.262] (-1109.588) * [-1111.858] (-1114.321) (-1114.274) (-1115.723) -- 0:01:38 482500 -- (-1115.722) (-1115.582) (-1116.993) [-1113.489] * (-1115.113) (-1116.920) (-1108.907) [-1114.969] -- 0:01:38 483000 -- (-1112.266) [-1116.889] (-1116.565) (-1115.167) * (-1119.623) [-1121.400] (-1118.619) (-1115.432) -- 0:01:38 483500 -- (-1109.224) (-1114.429) (-1116.793) [-1110.224] * (-1116.540) (-1121.494) [-1107.337] (-1114.377) -- 0:01:38 484000 -- (-1116.803) (-1116.656) [-1114.836] (-1110.978) * (-1107.160) (-1118.147) (-1122.148) [-1112.624] -- 0:01:39 484500 -- (-1113.567) (-1120.600) [-1119.001] (-1113.406) * [-1113.291] (-1113.755) (-1113.300) (-1122.360) -- 0:01:38 485000 -- (-1110.173) (-1128.432) (-1116.356) [-1123.585] * (-1111.309) [-1115.135] (-1114.932) (-1123.415) -- 0:01:38 Average standard deviation of split frequencies: 0.005820 485500 -- (-1111.099) (-1126.428) (-1113.139) [-1113.861] * (-1111.581) [-1114.203] (-1109.440) (-1126.229) -- 0:01:38 486000 -- (-1110.974) (-1120.529) (-1114.495) [-1110.003] * (-1119.051) [-1119.584] (-1121.157) (-1113.916) -- 0:01:38 486500 -- (-1113.581) (-1115.866) (-1112.168) [-1115.959] * (-1112.929) (-1116.410) [-1106.842] (-1113.712) -- 0:01:38 487000 -- (-1116.480) [-1113.456] (-1111.511) (-1120.430) * (-1115.965) (-1119.702) [-1114.312] (-1114.316) -- 0:01:37 487500 -- (-1121.092) (-1121.901) (-1121.054) [-1110.055] * (-1116.522) (-1116.143) (-1107.895) [-1119.215] -- 0:01:37 488000 -- (-1115.132) [-1112.361] (-1119.964) (-1113.108) * [-1121.168] (-1113.102) (-1113.816) (-1110.584) -- 0:01:37 488500 -- (-1115.283) (-1111.864) (-1117.068) [-1108.865] * [-1112.047] (-1110.081) (-1113.643) (-1113.253) -- 0:01:37 489000 -- (-1115.558) (-1112.064) [-1116.733] (-1113.362) * (-1115.638) (-1116.580) (-1117.190) [-1110.450] -- 0:01:38 489500 -- (-1122.367) (-1113.218) [-1111.004] (-1114.954) * (-1116.299) [-1109.276] (-1119.496) (-1115.062) -- 0:01:38 490000 -- (-1116.222) (-1113.209) [-1114.013] (-1117.795) * (-1113.006) (-1113.439) (-1118.542) [-1112.393] -- 0:01:37 Average standard deviation of split frequencies: 0.005764 490500 -- (-1117.557) (-1115.672) [-1111.482] (-1117.377) * (-1112.029) [-1115.263] (-1118.118) (-1113.584) -- 0:01:37 4