--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 11 18:46:16 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/2/Abd-B-PC/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2613.98 -2629.19 2 -2613.84 -2629.62 -------------------------------------- TOTAL -2613.91 -2629.43 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.722907 0.005789 0.572287 0.862370 0.719673 1331.12 1335.64 1.000 r(A<->C){all} 0.081119 0.000339 0.047377 0.117844 0.079887 867.86 873.55 1.000 r(A<->G){all} 0.198885 0.001149 0.134344 0.265523 0.196746 747.58 771.34 1.000 r(A<->T){all} 0.097152 0.001028 0.034606 0.157303 0.094691 728.63 790.69 1.004 r(C<->G){all} 0.072612 0.000247 0.042920 0.103686 0.071764 954.95 1034.68 1.000 r(C<->T){all} 0.474700 0.002301 0.382864 0.568550 0.474701 829.04 883.05 1.000 r(G<->T){all} 0.075532 0.000647 0.031406 0.128180 0.073263 687.88 861.57 1.001 pi(A){all} 0.243914 0.000191 0.215922 0.268917 0.243914 1081.24 1089.89 1.000 pi(C){all} 0.346969 0.000226 0.318347 0.377792 0.347028 1159.49 1220.89 1.000 pi(G){all} 0.264963 0.000191 0.239193 0.293374 0.264957 1170.36 1241.69 1.000 pi(T){all} 0.144154 0.000120 0.122731 0.164842 0.143690 931.92 1027.83 1.000 alpha{1,2} 0.145833 0.001290 0.077876 0.216657 0.143155 1070.44 1130.56 1.000 alpha{3} 1.941445 0.482982 0.884721 3.425454 1.817368 1305.07 1331.93 1.000 pinvar{all} 0.199859 0.007647 0.020301 0.351955 0.202562 1059.92 1091.67 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2245.48206 Model 2: PositiveSelection -2245.482071 Model 0: one-ratio -2269.725989 Model 3: discrete -2242.082462 Model 7: beta -2243.22651 Model 8: beta&w>1 -2242.248818 Model 0 vs 1 48.487858000000415 Model 2 vs 1 2.2000000171829015E-5 Model 8 vs 7 1.9553839999998672
>C1 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYY DRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAA ARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCT PNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARN LQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHH SGHHLNLSLNMGHHAAKMHQooooooo >C2 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYY DRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAA ARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCT PNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARN LQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHH SGHHLNLSLNMGHHAAKMHQooooooo >C3 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYY DRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAA ARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCT PNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARN LQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHH SGHHLNLSLNMGHHAAKMHQooooooo >C4 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYY DRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAA ARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCT PNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARN LQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHH SGHHLNLSLNMGHHAAKMHQooooooo >C5 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYY DRKHMFAYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAA ARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCT PNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARN LQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQANQQHH SGHHLNLSLNMGHHAAKMHQooooooo >C6 MSIQLAPLHIPAMRPGFEPDTSAAVKRHPAHWTYNDDAFNQYPGYAKGHY DRNHMFPYPYPDTSQFPVVSGPRYRADQGSSASTAAAAVAYMNEQDRHVS AAARQSVEGTSTSSYEPPTYSSPGGLRGYPGENYSSSGASGGLSVGAVGP CTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELA RNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHSQATQQ HHSSHHLNLSLNMGHHAAKMHQooooo >C7 MSIQLAPLHIPAIRPGPGFETDTSAAVKRHQAAHWGYADEGFHQIPNYAS TGCYDRKHIFPYPYPDPQYSVSQLCWPNYRTDQNAAAAAYMNDAERHVSA AARQSVEGTSTSSYEPPTYASPGGLRGYSSENYPSSGASGGLSVGAVGPC TPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELAR NLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHSQPTQQH HSGHHLNLGLNMGHHAAKMHQoooooo >C8 MSIQLAPLHIPAIRPGPGFETDASAAVKRHTAPWPYNDDGFNQYHASASQ YYMEQRDRKHAATMFPYYPDTQFQVSQYWPPNYRADQTTSAAAVAYMNDA ERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSV GAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQK RWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHS QATQQHHSSHHLSLGLNMGHHATKMHQ >C9 MSIQLAPLHIPAIRPGPGFDTDASAAVKRHTAPWPYNDEFNQYHASASQY YDRKHMFSYYPDTQFQVSQYWPPNYRTDQTTSAAAVAYMNDAERHVSAAA RQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTP NPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNL QLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHSQATQQHHS SHHLSLGLNMGHHATKMHQoooooooo >C10 MSIQLAPLHIPAIRPGPGFETDTSAAVKRHPAHWTYNDDGFNQYHASASG YYDRKHMFPYPYPDTQFPVSQYWTQGYRADQTTSAAAAVAYMNDAERHVS AAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGP CTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELA RNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNNNSSGNHNHSQATQQ HHSSHHLNLSLNMGHHAAKMHQooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=99, Nseq=10, Len=294 C1 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS C2 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS C3 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS C4 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS C5 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS C6 MSIQLAPLHIPAMR--PGFEPDTSAAVKRH-PAHWTYNDDAFNQYPGYAK C7 MSIQLAPLHIPAIRPGPGFETDTSAAVKRHQAAHWGYADEGFHQIPNYAS C8 MSIQLAPLHIPAIRPGPGFETDASAAVKRH-TAPWPYNDDGFNQY--HAS C9 MSIQLAPLHIPAIRPGPGFDTDASAAVKRH-TAPWPYN-DEFNQY--HAS C10 MSIQLAPLHIPAIRPGPGFETDTSAAVKRH-PAHWTYNDDGFNQY--HAS ************:* ***:.*:******* .* * * : *:* :.. C1 G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A C2 G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A C3 G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A C4 G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A C5 G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A C6 G--HY----DRNH---MFPYPYPDTSQFPVVS--GPRYRADQGSSASTAA C7 TGC-Y----DRKH---IFPYPYPDP-QYSVSQLCWPNYRTD---QN---A C8 ASQYYMEQRDRKHAATMFPY-YPDT-QFQVSQYWPPNYRADQTTS----A C9 ASQYY----DRKH---MFSY-YPDT-QFQVSQYWPPNYRTDQTTS----A C10 ASGYY----DRKH---MFPYPYPDT-QFPVSQYWTQGYRADQTTSA---A * **:* :*.* **:. *: * . **.* . * C1 AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS C2 AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS C3 AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS C4 AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS C5 AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS C6 AAVAYMNEQDRHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPGENYSS C7 AAAAYMNDAERHVSAAARQSVEGTSTSSYEPPTYASPGGLRGYSSENYPS C8 AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS C9 AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS C10 AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS **.****: :************************:********..***.* C1 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C2 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C3 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C4 SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C5 SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C6 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C7 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C8 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C9 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL C10 SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL *************.************************************ C1 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C2 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C3 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C4 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C5 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C6 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C7 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C8 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C9 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN C10 FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN ************************************************** C1 NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- C2 NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- C3 NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- C4 NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- C5 NSSSNHNHAQANQQHHSGHHLNLSLNMGHHAAKMHQooooooo- C6 NSSSNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- C7 NSSSNHNHSQPTQQHHSGHHLNLGLNMGHHAAKMHQoooooo-- C8 NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ-------- C9 NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQoooooooo C10 NSSGNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- ***.****:*..*****.***.*.*******:**** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 277 type PROTEIN Struct Unchecked Input File /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 277 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [30540] Library Relaxation: Multi_proc [72] Relaxation Summary: [30540]--->[29699] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/2/Abd-B-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.571 Mb, Max= 31.360 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C2 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C3 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C4 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C5 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQANQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C6 MSIQLAPLHIPAMR--PGFEPDTSAAVKRH-PAHWTYNDDAFNQYPGYAK G--HY----DRNH---MFPYPYPDTSQFPVVS--GPRYRADQGSSASTAA AAVAYMNEQDRHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPGENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- >C7 MSIQLAPLHIPAIRPGPGFETDTSAAVKRHQAAHWGYADEGFHQIPNYAS TGC-Y----DRKH---IFPYPYPDP-QYSVSQLCWPNYRTD---QN---A AAAAYMNDAERHVSAAARQSVEGTSTSSYEPPTYASPGGLRGYSSENYPS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQPTQQHHSGHHLNLGLNMGHHAAKMHQoooooo-- >C8 MSIQLAPLHIPAIRPGPGFETDASAAVKRH-TAPWPYNDDGFNQY--HAS ASQYYMEQRDRKHAATMFPY-YPDT-QFQVSQYWPPNYRADQTTS----A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ-------- >C9 MSIQLAPLHIPAIRPGPGFDTDASAAVKRH-TAPWPYN-DEFNQY--HAS ASQYY----DRKH---MFSY-YPDT-QFQVSQYWPPNYRTDQTTS----A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQoooooooo >C10 MSIQLAPLHIPAIRPGPGFETDTSAAVKRH-PAHWTYNDDGFNQY--HAS ASGYY----DRKH---MFPYPYPDT-QFPVSQYWTQGYRADQTTSA---A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSGNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- FORMAT of file /tmp/tmp5841663037836779541aln Not Supported[FATAL:T-COFFEE] >C1 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C2 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C3 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C4 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C5 MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQANQQHHSGHHLNLSLNMGHHAAKMHQooooooo- >C6 MSIQLAPLHIPAMR--PGFEPDTSAAVKRH-PAHWTYNDDAFNQYPGYAK G--HY----DRNH---MFPYPYPDTSQFPVVS--GPRYRADQGSSASTAA AAVAYMNEQDRHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPGENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- >C7 MSIQLAPLHIPAIRPGPGFETDTSAAVKRHQAAHWGYADEGFHQIPNYAS TGC-Y----DRKH---IFPYPYPDP-QYSVSQLCWPNYRTD---QN---A AAAAYMNDAERHVSAAARQSVEGTSTSSYEPPTYASPGGLRGYSSENYPS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQPTQQHHSGHHLNLGLNMGHHAAKMHQoooooo-- >C8 MSIQLAPLHIPAIRPGPGFETDASAAVKRH-TAPWPYNDDGFNQY--HAS ASQYYMEQRDRKHAATMFPY-YPDT-QFQVSQYWPPNYRADQTTS----A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ-------- >C9 MSIQLAPLHIPAIRPGPGFDTDASAAVKRH-TAPWPYN-DEFNQY--HAS ASQYY----DRKH---MFSY-YPDT-QFQVSQYWPPNYRTDQTTS----A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQoooooooo >C10 MSIQLAPLHIPAIRPGPGFETDTSAAVKRH-PAHWTYNDDGFNQY--HAS ASGYY----DRKH---MFPYPYPDT-QFPVSQYWTQGYRADQTTSA---A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSGNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:294 S:96 BS:294 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 99.64 C1 C4 99.64 TOP 3 0 99.64 C4 C1 99.64 BOT 0 4 99.28 C1 C5 99.28 TOP 4 0 99.28 C5 C1 99.28 BOT 0 5 91.11 C1 C6 91.11 TOP 5 0 91.11 C6 C1 91.11 BOT 0 6 89.38 C1 C7 89.38 TOP 6 0 89.38 C7 C1 89.38 BOT 0 7 91.42 C1 C8 91.42 TOP 7 0 91.42 C8 C1 91.42 BOT 0 8 90.88 C1 C9 90.88 TOP 8 0 90.88 C9 C1 90.88 BOT 0 9 92.36 C1 C10 92.36 TOP 9 0 92.36 C10 C1 92.36 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 99.64 C2 C4 99.64 TOP 3 1 99.64 C4 C2 99.64 BOT 1 4 99.28 C2 C5 99.28 TOP 4 1 99.28 C5 C2 99.28 BOT 1 5 91.11 C2 C6 91.11 TOP 5 1 91.11 C6 C2 91.11 BOT 1 6 89.38 C2 C7 89.38 TOP 6 1 89.38 C7 C2 89.38 BOT 1 7 91.42 C2 C8 91.42 TOP 7 1 91.42 C8 C2 91.42 BOT 1 8 90.88 C2 C9 90.88 TOP 8 1 90.88 C9 C2 90.88 BOT 1 9 92.36 C2 C10 92.36 TOP 9 1 92.36 C10 C2 92.36 BOT 2 3 99.64 C3 C4 99.64 TOP 3 2 99.64 C4 C3 99.64 BOT 2 4 99.28 C3 C5 99.28 TOP 4 2 99.28 C5 C3 99.28 BOT 2 5 91.11 C3 C6 91.11 TOP 5 2 91.11 C6 C3 91.11 BOT 2 6 89.38 C3 C7 89.38 TOP 6 2 89.38 C7 C3 89.38 BOT 2 7 91.42 C3 C8 91.42 TOP 7 2 91.42 C8 C3 91.42 BOT 2 8 90.88 C3 C9 90.88 TOP 8 2 90.88 C9 C3 90.88 BOT 2 9 92.36 C3 C10 92.36 TOP 9 2 92.36 C10 C3 92.36 BOT 3 4 99.64 C4 C5 99.64 TOP 4 3 99.64 C5 C4 99.64 BOT 3 5 90.74 C4 C6 90.74 TOP 5 3 90.74 C6 C4 90.74 BOT 3 6 89.01 C4 C7 89.01 TOP 6 3 89.01 C7 C4 89.01 BOT 3 7 91.04 C4 C8 91.04 TOP 7 3 91.04 C8 C4 91.04 BOT 3 8 90.51 C4 C9 90.51 TOP 8 3 90.51 C9 C4 90.51 BOT 3 9 92.00 C4 C10 92.00 TOP 9 3 92.00 C10 C4 92.00 BOT 4 5 90.37 C5 C6 90.37 TOP 5 4 90.37 C6 C5 90.37 BOT 4 6 88.64 C5 C7 88.64 TOP 6 4 88.64 C7 C5 88.64 BOT 4 7 90.67 C5 C8 90.67 TOP 7 4 90.67 C8 C5 90.67 BOT 4 8 90.15 C5 C9 90.15 TOP 8 4 90.15 C9 C5 90.15 BOT 4 9 91.64 C5 C10 91.64 TOP 9 4 91.64 C10 C5 91.64 BOT 5 6 86.99 C6 C7 86.99 TOP 6 5 86.99 C7 C6 86.99 BOT 5 7 90.15 C6 C8 90.15 TOP 7 5 90.15 C8 C6 90.15 BOT 5 8 89.18 C6 C9 89.18 TOP 8 5 89.18 C9 C6 89.18 BOT 5 9 92.62 C6 C10 92.62 TOP 9 5 92.62 C10 C6 92.62 BOT 6 7 89.10 C7 C8 89.10 TOP 7 6 89.10 C8 C7 89.10 BOT 6 8 88.56 C7 C9 88.56 TOP 8 6 88.56 C9 C7 88.56 BOT 6 9 89.01 C7 C10 89.01 TOP 9 6 89.01 C10 C7 89.01 BOT 7 8 98.51 C8 C9 98.51 TOP 8 7 98.51 C9 C8 98.51 BOT 7 9 95.19 C8 C10 95.19 TOP 9 7 95.19 C10 C8 95.19 BOT 8 9 93.80 C9 C10 93.80 TOP 9 8 93.80 C10 C9 93.80 AVG 0 C1 * 94.90 AVG 1 C2 * 94.90 AVG 2 C3 * 94.90 AVG 3 C4 * 94.65 AVG 4 C5 * 94.33 AVG 5 C6 * 90.38 AVG 6 C7 * 88.83 AVG 7 C8 * 92.10 AVG 8 C9 * 91.48 AVG 9 C10 * 92.37 TOT TOT * 92.88 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCCATACAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC C2 ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC C3 ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCTGGTCC C4 ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC C5 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGGCCGGTCC C6 ATGTCCATCCAATTAGCGCCCCTGCACATACCCGCCATGCGG------CC C7 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCAGGCCCGGTCC C8 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGCCCGGTCC C9 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGCCGGGTCC C10 ATGTCCATCCAATTAGCGCCACTGCACATACCAGCCATCCGGCCAGGCCC ********.***********.***** *****.***** .** ** C1 GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC C2 GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC C3 GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC C4 GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC C5 GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC C6 GGGATTCGAGCCGGACACCTCGGCGGCGGTCAAGCGGCAC---CCGGCAC C7 GGGTTTCGAGACGGACACCTCGGCCGCGGTCAAGCGTCATCAAGCAGCGC C8 GGGATTCGAGACGGACGCCTCGGCGGCGGTGAAGCGGCAC---ACGGCCC C9 GGGATTCGATACGGACGCCTCGGCGGCGGTCAAGCGGCAC---ACGGCCC C10 GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---CCGGCAC ***:***** .*****.******* ***** ***** ** *.** * C1 ACTGGGCCTACAACGACGAGGGATTCAATCAGCAT------TACGGCTCC C2 ACTGGGCCTACAACGACGAGGGATTCAACCAGCAT------TACGGCTCC C3 ACTGGGCCTACAACGACGAGGGATTCAACCAGCAT------TACGGCTCC C4 ACTGGGCCTACAACGACGAGGGATTCAACCAGCAC------TACGGTTCC C5 ACTGGGCCTACAACGACGAGGGATTCAACCAGCAC------TACGGTTCC C6 ACTGGACCTACAACGATGACGCATTCAACCAGTATCCCGGCTACGCGAAA C7 ACTGGGGCTACGCCGATGAGGGATTCCACCAAATTCCAAACTACGCCTCT C8 CCTGGCCCTACAACGACGACGGGTTCAACCAGTAC------CACGCCTCC C9 CCTGGCCCTACAAC---GATGAGTTCAACCAGTAC------CACGCCTCT C10 ACTGGACCTACAACGATGACGGCTTCAACCAGTAC------CACGCCTCC .**** ****..* ** * ***.* **. : *** :. C1 GGG---TAC---TAC------------GACCGCAAGCAC---------AT C2 GGG---TAC---TAC------------GACCGCAAGCAC---------AT C3 GGG---TAC---TAC------------GACCGCAAGCAC---------AT C4 GGG---TAC---TAC------------GACCGCAAGCAC---------AT C5 GGG---TAC---TAC------------GACCGCAAGCAC---------AT C6 GGG------CACTAC------------GACCGCAACCAC---------AT C7 ACAGGGTGC---TAT------------GACCGCAAGCAC---------AT C8 GCGTCACAGTACTACATGGAGCAGCGCGACCGCAAGCACGCCGCCACCAT C9 GCGTCACAGTACTAC------------GATCGCAAGCAC---------AT C10 GCGTCGGGGTACTAC------------GACCGCAAGCAC---------AT . . ** ** ***** *** ** C1 GTTCGCCTATCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT C2 GTTCGCCTACCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT C3 GTTCGCCTACCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT C4 GTTCGCCTACCCCTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT C5 GTTCGCCTACCCCTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT C6 GTTCCCCTACCCCTATCCAGACACCAGCCAGTTTCCGGTTGTAAGT---- C7 TTTTCCCTACCCCTATCCAGACCCC---CAGTATTCGGTAAGTCAGTTGT C8 GTTCCCCTAC---TATCCAGACACC---CAGTTTCAGGTGAGTCAGTACT C9 GTTCTCCTAC---TACCCAGACACC---CAGTTTCAGGTGAGTCAGTACT C10 GTTCCCCTACCCCTATCCAGACACC---CAGTTTCCGGTAAGTCAGTACT ** **** ** *****..* ****:* .*** . :.. C1 GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCA C2 GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCG C3 GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCG C4 GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCC C5 GGGGCCCCAACTACCGCCCCGACCAGACCACCTCTGCC---------GCG C6 --GGCCCCAGATACCGCGCCGATCAGGGCAGCTCCGCCAGCACCGCTGCG C7 GCTGGCCCAACTACCGCACTGAT---------CAGAAT---------GCG C8 GGCCCCCCAACTACCGCGCCGACCAAACCACCTCC------------GCC C9 GGCCGCCCAACTACCGCACCGACCAGACGACCTCC------------GCG C10 GGACCCAAGGCTACCGCGCCGATCAGACCACCTCCGCC---------GCG *.....****** * ** . ** C1 GCGGCGGCGGCCTACATGAACGAAGCGGAGCGCCACGTGAGCGCCGCCGC C2 GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCTGC C3 GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC C4 GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC C5 GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC C6 GCGGCAGTGGCCTATATGAACGAACAGGATCGCCACGTGAGCGCAGCCGC C7 GCGGCGGCGGCCTACATGAACGATGCCGAGCGCCATGTGAGCGCCGCTGC C8 GCCGCGGTGGCCTACATGAACGACGCGGAGCGCCACGTGAGCGCCGCTGC C9 GCGGCGGTGGCCTACATGAACGATGCGGAGCGCCACGTGAGCGCCGCCGC C10 GCGGCAGTGGCCTACATGAACGATGCCGAGCGCCACGTCAGCGCCGCGGC ** **.* ****** ******** . ** ***** ** *****.** ** C1 CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTATGAGCCGCCCACCT C2 TCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTATGAGCCGCCCACCT C3 CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT C4 CCGCCAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT C5 CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT C6 CCGACAGTCCGTCGAGGGCACTTCGACGTCCAGCTACGAGCCGCCCACCT C7 CCGACAGTCCGTCGAGGGCACATCGACGTCCAGTTATGAGCCGCCCACCT C8 CCGCCAGTCCGTCGAGGGCACGTCGACGTCCAGCTACGAGCCGCCCACCT C9 CCGCCAGTCCGTCGAGGGCACCTCGACGTCCAGCTACGAGCCGCCCACCT C10 CCGCCAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCACCTACTT **.***************** *********** ** *****.** ** * C1 ACTCCTCGCCAGGCGGCCTGCGCGGCTATCCCAGCGAGAACTACTCCAGC C2 ACTCCTCGCCAGGCGGCCTGCGCGGCTATCCCAGCGAGAACTACTCCAGC C3 ACTCCTCGCCAGGCGGCCTGCGCGGTTATCCCAGCGAGAACTACTCCAGC C4 ACTCCTCGCCGGGCGGACTGCGTGGCTATCCCAGCGAGAACTACTCCAGC C5 ACTCCTCGCCGGGCGGACTGCGGGGCTATCCCAGCGAGAACTACTCCAGC C6 ACTCCTCTCCAGGCGGACTGCGCGGCTATCCCGGCGAGAACTACTCCAGC C7 ATGCTTCGCCGGGCGGACTGCGCGGCTATTCCAGCGAGAACTACCCCAGC C8 ACTCCTCGCCCGGCGGCCTGCGCGGCTACCCCAGCGAGAACTACTCCAGC C9 ACTCCTCGCCGGGCGGACTGCGCGGCTATCCCAGCGAGAACTACTCCAGC C10 ACTCCTCGCCGGGCGGACTCCGCGGCTATCCCAGCGAGAACTACTCCAGC * * ** ** *****.** ** ** ** **.*********** ***** C1 TCAGGAGCCTCTGGTGGATTATCCGTGGGAGCAGTGGGTCCTTGCACGCC C2 TCAGGAGCCTCTGGTGGATTGTCCGTGGGAGCGGTGGGTCCTTGCACGCC C3 TCAGGAGCCTCTGGTGGATTGTCCGTAGGAGCGGTGGGTCCTTGCACGCC C4 TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCGGTGGGCTCTTGCACGCC C5 TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCGGTGGGTTCTTGCACGCC C6 TCAGGAGCCTCCGGTGGATTGTCGGTGGGTGCAGTGGGTCCTTGCACGCC C7 TCAGGAGCCTCTGGCGGCTTGTCTGTGGGTGCAGTGGGTCCTTGCACACC C8 TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCAGTGGGTCCTTGCACGCC C9 TCAGGAGCTTCCGGTGGATTGTCGGTGGGTGCAGTGGGTCCTTGCACGCC C10 TCAGGAGCCTCCGGTGGTTTGTCCGTGGGAGCGGTGGGTCCTTGCACGCC ******** ** ** ** **.** **.**:**.***** *******.** C1 CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC C2 CAATCCCGGATTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC C3 CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC C4 CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC C5 CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC C6 CAATCCCGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC C7 CAATCCTGGACTGCACGAGTGGACCGGTCAGGTGTCTGTAAGGAAAAAGC C8 AAATCCTGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC C9 CAACCCAGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC C10 CAATCCCGGACTGCACGAGTGGACCGGCCAAGTGTCCGTCCGGAAAAAGC .** ** *** **************** **.***** **..********* C1 GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTTCTT C2 GCAAGCCATACTCGAAGTTCCAAACCCTGGAGCTGGAGAAGGAGTTCCTT C3 GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT C4 GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT C5 GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT C6 GAAAGCCGTACTCCAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT C7 GGAAGCCCTACTCCAAGTTTCAGACCCTGGAGCTGGAGAAGGAGTTCCTC C8 GGAAGCCGTACTCCAAGTTCCAGACTCTGGAGCTGGAGAAGGAGTTCCTC C9 GGAAGCCGTACTCCAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTC C10 GGAAGCCGTACTCCAAGTTCCAGACTTTGGAGCTGGAGAAGGAGTTCCTT * ***** ***** ***** **.** ******************* ** C1 TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT C2 TTCAATGCGTATGTTTCTAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT C3 TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT C4 TTCAATGCGTATGTCTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT C5 TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT C6 TTCAATGCATACGTGTCCAAGCAGAAGCGCTGGGAGCTGGCCAGGAACTT C7 TTCAATGCGTATGTCTCCAAGCAGAAACGCTGGGAACTGGCCAGGAACTT C8 TTCAATGCGTATGTTTCTAAGCAGAAACGCTGGGAATTGGCCAGGAATTT C9 TTCAATGCGTATGTGTCCAAGCAGAAGCGCTGGGAGTTGGCCAGGAATTT C10 TTCAATGCATATGTGTCCAAGCAGAAGCGCTGGGAGCTGGCCAGGAATTT ********.** ** ** *****.**.********. *******.** ** C1 GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA C2 GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA C3 GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA C4 GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA C5 GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA C6 ACAGTTGACCGAGCGACAGGTCAAGATATGGTTCCAGAACCGGCGCATGA C7 GCAGCTGACAGAGAGACAGGTCAAAATATGGTTCCAGAATCGACGCATGA C8 GCAGCTGACTGAGAGACAGGTCAAGATATGGTTCCAGAATCGCCGCATGA C9 GCAGTTGACCGAGCGACAGGTCAAAATATGGTTCCAGAATCGGCGCATGA C10 GCAGTTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA .*** **** ***.**********.************** ** ******* C1 AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAC C2 AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAAAACAACAACAAC C3 AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAC C4 AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAT C5 AGAACAAGAAGAACTCCCAGCGCCAGGCCAATCAGCAGAACAACAACAAC C6 AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAATAACAAC C7 AGAACAAAAAGAACTCACAGCGCCAGGCCAATCAGCAGAATAACAACAAC C8 AGAACAAGAAGAACTCGCAGCGGCAGGCCAATCAGCAGAACAACAACAAC C9 AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAACAACAAC C10 AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAACAACAAC *******.******** ***** **************.** ** ***** C1 AATTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG C2 AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG C3 AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG C4 AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG C5 AACTCGAGCAGCAACCACAACCACGCGCAGGCGAACCAGCAGCACCACAG C6 AACTCGAGCAGCAATCACAACCACTCGCAGGCGACCCAGCAGCACCACAG C7 AACTCGAGCAGCAACCACAACCACTCGCAGCCGACACAGCAGCATCATAG C8 AACTCGAGCAGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG C9 AACTCGAGCAGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG C10 AACTCGAGCGGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG ** ******.**** ********* ***** ***..******** ** ** C1 CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA C2 CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA C3 CGGCCACCACCTGAATCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA C4 CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA C5 CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA C6 CAGCCACCACCTGAACCTTAGCCTAAACATGGGTCACCATGCCGCCAAGA C7 CGGCCACCACCTGAATCTTGGCCTGAACATGGGACATCATGCCGCCAAGA C8 CAGCCACCACTTGAGCCTCGGCCTGAACATGGGTCACCATGCCACCAAGA C9 CAGCCACCACCTGAGCCTCGGCCTGAACATGGGTCATCATGCCACCAAGA C10 CAGCCACCACCTGAACCTTAGCCTAAACATGGGTCACCATGCCGCCAAGA *.******** ***. ** .****.********:** ******.****** C1 TGCACCAG------------------------ C2 TGCACCAG------------------------ C3 TGCACCAG------------------------ C4 TGCACCAG------------------------ C5 TGCACCAG------------------------ C6 TGCACCAG------------------------ C7 TGCACCAG------------------------ C8 TGCACCAG------------------------ C9 TGCACCAG------------------------ C10 TGCACCAG------------------------ ******** >C1 ATGTCCATACAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAATCAGCAT------TACGGCTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTATCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCA GCGGCGGCGGCCTACATGAACGAAGCGGAGCGCCACGTGAGCGCCGCCGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTATGAGCCGCCCACCT ACTCCTCGCCAGGCGGCCTGCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTATCCGTGGGAGCAGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTTCTT TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAC AATTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >C2 ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAT------TACGGCTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCG GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCTGC TCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTATGAGCCGCCCACCT ACTCCTCGCCAGGCGGCCTGCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCCGTGGGAGCGGTGGGTCCTTGCACGCC CAATCCCGGATTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCATACTCGAAGTTCCAAACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTTTCTAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAAAACAACAACAAC AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >C3 ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCTGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAT------TACGGCTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCG GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCAGGCGGCCTGCGCGGTTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCCGTAGGAGCGGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAATCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >C4 ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAC------TACGGTTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCCTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCC GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC CCGCCAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCGGGCGGACTGCGTGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCGGTGGGCTCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTCTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAT AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >C5 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAC------TACGGTTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCCTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGACCAGACCACCTCTGCC---------GCG GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCGGGCGGACTGCGGGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCGGTGGGTTCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCCCAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACGCGCAGGCGAACCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >C6 ATGTCCATCCAATTAGCGCCCCTGCACATACCCGCCATGCGG------CC GGGATTCGAGCCGGACACCTCGGCGGCGGTCAAGCGGCAC---CCGGCAC ACTGGACCTACAACGATGACGCATTCAACCAGTATCCCGGCTACGCGAAA GGG------CACTAC------------GACCGCAACCAC---------AT GTTCCCCTACCCCTATCCAGACACCAGCCAGTTTCCGGTTGTAAGT---- --GGCCCCAGATACCGCGCCGATCAGGGCAGCTCCGCCAGCACCGCTGCG GCGGCAGTGGCCTATATGAACGAACAGGATCGCCACGTGAGCGCAGCCGC CCGACAGTCCGTCGAGGGCACTTCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCTCCAGGCGGACTGCGCGGCTATCCCGGCGAGAACTACTCCAGC TCAGGAGCCTCCGGTGGATTGTCGGTGGGTGCAGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC GAAAGCCGTACTCCAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCATACGTGTCCAAGCAGAAGCGCTGGGAGCTGGCCAGGAACTT ACAGTTGACCGAGCGACAGGTCAAGATATGGTTCCAGAACCGGCGCATGA AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAATAACAAC AACTCGAGCAGCAATCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACCTGAACCTTAGCCTAAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >C7 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCAGGCCCGGTCC GGGTTTCGAGACGGACACCTCGGCCGCGGTCAAGCGTCATCAAGCAGCGC ACTGGGGCTACGCCGATGAGGGATTCCACCAAATTCCAAACTACGCCTCT ACAGGGTGC---TAT------------GACCGCAAGCAC---------AT TTTTCCCTACCCCTATCCAGACCCC---CAGTATTCGGTAAGTCAGTTGT GCTGGCCCAACTACCGCACTGAT---------CAGAAT---------GCG GCGGCGGCGGCCTACATGAACGATGCCGAGCGCCATGTGAGCGCCGCTGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGTTATGAGCCGCCCACCT ATGCTTCGCCGGGCGGACTGCGCGGCTATTCCAGCGAGAACTACCCCAGC TCAGGAGCCTCTGGCGGCTTGTCTGTGGGTGCAGTGGGTCCTTGCACACC CAATCCTGGACTGCACGAGTGGACCGGTCAGGTGTCTGTAAGGAAAAAGC GGAAGCCCTACTCCAAGTTTCAGACCCTGGAGCTGGAGAAGGAGTTCCTC TTCAATGCGTATGTCTCCAAGCAGAAACGCTGGGAACTGGCCAGGAACTT GCAGCTGACAGAGAGACAGGTCAAAATATGGTTCCAGAATCGACGCATGA AGAACAAAAAGAACTCACAGCGCCAGGCCAATCAGCAGAATAACAACAAC AACTCGAGCAGCAACCACAACCACTCGCAGCCGACACAGCAGCATCATAG CGGCCACCACCTGAATCTTGGCCTGAACATGGGACATCATGCCGCCAAGA TGCACCAG------------------------ >C8 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGCCCGGTCC GGGATTCGAGACGGACGCCTCGGCGGCGGTGAAGCGGCAC---ACGGCCC CCTGGCCCTACAACGACGACGGGTTCAACCAGTAC------CACGCCTCC GCGTCACAGTACTACATGGAGCAGCGCGACCGCAAGCACGCCGCCACCAT GTTCCCCTAC---TATCCAGACACC---CAGTTTCAGGTGAGTCAGTACT GGCCCCCCAACTACCGCGCCGACCAAACCACCTCC------------GCC GCCGCGGTGGCCTACATGAACGACGCGGAGCGCCACGTGAGCGCCGCTGC CCGCCAGTCCGTCGAGGGCACGTCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCCGGCGGCCTGCGCGGCTACCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCAGTGGGTCCTTGCACGCC AAATCCTGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC GGAAGCCGTACTCCAAGTTCCAGACTCTGGAGCTGGAGAAGGAGTTCCTC TTCAATGCGTATGTTTCTAAGCAGAAACGCTGGGAATTGGCCAGGAATTT GCAGCTGACTGAGAGACAGGTCAAGATATGGTTCCAGAATCGCCGCATGA AGAACAAGAAGAACTCGCAGCGGCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACTTGAGCCTCGGCCTGAACATGGGTCACCATGCCACCAAGA TGCACCAG------------------------ >C9 ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGCCGGGTCC GGGATTCGATACGGACGCCTCGGCGGCGGTCAAGCGGCAC---ACGGCCC CCTGGCCCTACAAC---GATGAGTTCAACCAGTAC------CACGCCTCT GCGTCACAGTACTAC------------GATCGCAAGCAC---------AT GTTCTCCTAC---TACCCAGACACC---CAGTTTCAGGTGAGTCAGTACT GGCCGCCCAACTACCGCACCGACCAGACGACCTCC------------GCG GCGGCGGTGGCCTACATGAACGATGCGGAGCGCCACGTGAGCGCCGCCGC CCGCCAGTCCGTCGAGGGCACCTCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCGGGCGGACTGCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCTTCCGGTGGATTGTCGGTGGGTGCAGTGGGTCCTTGCACGCC CAACCCAGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC GGAAGCCGTACTCCAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTC TTCAATGCGTATGTGTCCAAGCAGAAGCGCTGGGAGTTGGCCAGGAATTT GCAGTTGACCGAGCGACAGGTCAAAATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACCTGAGCCTCGGCCTGAACATGGGTCATCATGCCACCAAGA TGCACCAG------------------------ >C10 ATGTCCATCCAATTAGCGCCACTGCACATACCAGCCATCCGGCCAGGCCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---CCGGCAC ACTGGACCTACAACGATGACGGCTTCAACCAGTAC------CACGCCTCC GCGTCGGGGTACTAC------------GACCGCAAGCAC---------AT GTTCCCCTACCCCTATCCAGACACC---CAGTTTCCGGTAAGTCAGTACT GGACCCAAGGCTACCGCGCCGATCAGACCACCTCCGCC---------GCG GCGGCAGTGGCCTACATGAACGATGCCGAGCGCCACGTCAGCGCCGCGGC CCGCCAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCACCTACTT ACTCCTCGCCGGGCGGACTCCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCCGGTGGTTTGTCCGTGGGAGCGGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGCCAAGTGTCCGTCCGGAAAAAGC GGAAGCCGTACTCCAAGTTCCAGACTTTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCATATGTGTCCAAGCAGAAGCGCTGGGAGCTGGCCAGGAATTT GCAGTTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCGGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACCTGAACCTTAGCCTAAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >C1 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHoTAHWAYNDEGFNQHooYGS GoYoYooooDRKHoooMFAYPYPEToQFPVGQYWGPNYRPDQTTSAoooA AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >C2 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHoTAHWAYNDEGFNQHooYGS GoYoYooooDRKHoooMFAYPYPEToQFPVGQYWGPNYRPDQTTSAoooA AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >C3 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHoTAHWAYNDEGFNQHooYGS GoYoYooooDRKHoooMFAYPYPEToQFPVGQYWGPNYRPDQTTSAoooA AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >C4 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHoTAHWAYNDEGFNQHooYGS GoYoYooooDRKHoooMFAYPYPEToQFPVGQYWGPNYRPDQTTSAoooA AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >C5 MSIQLAPLHIPAIRAGPGFETDTSAAVKRHoTAHWAYNDEGFNQHooYGS GoYoYooooDRKHoooMFAYPYPEToQFPVGQYWGPNYRPDQTTSAoooA AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQANQQHHSGHHLNLSLNMGHHAAKMHQ >C6 MSIQLAPLHIPAMRooPGFEPDTSAAVKRHoPAHWTYNDDAFNQYPGYAK GooHYooooDRNHoooMFPYPYPDTSQFPVVSooGPRYRADQGSSASTAA AAVAYMNEQDRHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPGENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQ >C7 MSIQLAPLHIPAIRPGPGFETDTSAAVKRHQAAHWGYADEGFHQIPNYAS TGCoYooooDRKHoooIFPYPYPDPoQYSVSQLCWPNYRTDoooQNoooA AAAAYMNDAERHVSAAARQSVEGTSTSSYEPPTYASPGGLRGYSSENYPS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQPTQQHHSGHHLNLGLNMGHHAAKMHQ >C8 MSIQLAPLHIPAIRPGPGFETDASAAVKRHoTAPWPYNDDGFNQYooHAS ASQYYMEQRDRKHAATMFPYoYPDToQFQVSQYWPPNYRADQTTSooooA AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ >C9 MSIQLAPLHIPAIRPGPGFDTDASAAVKRHoTAPWPYNoDEFNQYooHAS ASQYYooooDRKHoooMFSYoYPDToQFQVSQYWPPNYRTDQTTSooooA AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ >C10 MSIQLAPLHIPAIRPGPGFETDTSAAVKRHoPAHWTYNDDGFNQYooHAS ASGYYooooDRKHoooMFPYPYPDToQFPVSQYWTQGYRADQTTSAoooA AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSGNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQ MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 10 taxa and 882 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1478889048 Setting output file names to "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 231064795 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3269566890 Seed = 1442381160 Swapseed = 1478889048 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 59 unique site patterns Division 2 has 44 unique site patterns Division 3 has 111 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3596.378644 -- -24.412588 Chain 2 -- -3715.383602 -- -24.412588 Chain 3 -- -3718.779171 -- -24.412588 Chain 4 -- -3689.847964 -- -24.412588 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3652.134095 -- -24.412588 Chain 2 -- -3609.106209 -- -24.412588 Chain 3 -- -3772.663010 -- -24.412588 Chain 4 -- -3648.656734 -- -24.412588 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3596.379] (-3715.384) (-3718.779) (-3689.848) * [-3652.134] (-3609.106) (-3772.663) (-3648.657) 500 -- (-2702.032) (-2714.980) (-2714.531) [-2695.966] * [-2698.134] (-2719.159) (-2708.532) (-2729.284) -- 0:00:00 1000 -- (-2684.128) [-2662.617] (-2672.332) (-2659.847) * [-2647.834] (-2671.827) (-2679.420) (-2675.484) -- 0:00:00 1500 -- (-2654.171) [-2621.785] (-2645.812) (-2648.403) * [-2633.393] (-2649.545) (-2662.447) (-2646.467) -- 0:00:00 2000 -- (-2630.891) [-2613.033] (-2644.875) (-2638.822) * (-2641.472) [-2629.799] (-2641.630) (-2636.074) -- 0:08:19 2500 -- (-2637.323) [-2613.980] (-2629.923) (-2638.558) * (-2638.155) (-2620.258) [-2622.996] (-2628.022) -- 0:06:39 3000 -- (-2628.351) (-2620.983) [-2622.190] (-2624.501) * (-2635.935) [-2616.359] (-2628.369) (-2626.938) -- 0:05:32 3500 -- (-2625.183) (-2616.210) (-2631.820) [-2615.846] * (-2619.654) [-2622.916] (-2629.503) (-2618.145) -- 0:04:44 4000 -- [-2620.286] (-2615.040) (-2625.848) (-2619.413) * (-2625.575) [-2619.976] (-2638.197) (-2614.922) -- 0:08:18 4500 -- [-2615.333] (-2615.010) (-2617.556) (-2613.529) * (-2629.982) [-2620.622] (-2618.438) (-2614.932) -- 0:07:22 5000 -- (-2621.910) [-2617.885] (-2628.727) (-2627.110) * (-2629.806) [-2612.246] (-2625.305) (-2618.530) -- 0:06:38 Average standard deviation of split frequencies: 0.057140 5500 -- (-2621.072) (-2619.294) (-2625.686) [-2620.428] * (-2631.817) (-2628.889) [-2624.216] (-2614.244) -- 0:09:02 6000 -- (-2629.206) [-2613.948] (-2622.973) (-2624.985) * (-2626.471) [-2614.424] (-2626.350) (-2617.556) -- 0:08:17 6500 -- (-2627.296) [-2617.547] (-2624.475) (-2621.855) * (-2617.216) [-2623.115] (-2628.390) (-2619.935) -- 0:07:38 7000 -- (-2616.504) [-2624.128] (-2624.376) (-2627.529) * (-2623.809) (-2613.176) (-2633.077) [-2619.602] -- 0:07:05 7500 -- (-2626.482) (-2618.193) (-2625.619) [-2626.729] * [-2617.376] (-2621.248) (-2618.736) (-2615.520) -- 0:08:49 8000 -- (-2625.279) (-2617.739) [-2614.765] (-2617.797) * (-2615.710) (-2632.048) (-2621.556) [-2617.149] -- 0:08:16 8500 -- (-2624.464) (-2626.780) (-2613.672) [-2624.343] * [-2616.180] (-2623.688) (-2620.204) (-2618.756) -- 0:07:46 9000 -- (-2626.732) (-2621.881) [-2616.096] (-2624.825) * [-2613.928] (-2623.528) (-2625.312) (-2619.706) -- 0:07:20 9500 -- (-2638.239) (-2621.260) [-2617.786] (-2616.903) * (-2614.292) (-2616.847) (-2630.148) [-2622.880] -- 0:08:41 10000 -- (-2637.318) (-2627.860) [-2615.336] (-2629.228) * (-2628.425) [-2612.479] (-2614.542) (-2619.538) -- 0:08:15 Average standard deviation of split frequencies: 0.036828 10500 -- (-2627.144) [-2619.898] (-2620.607) (-2620.117) * (-2625.706) [-2618.527] (-2624.909) (-2620.905) -- 0:07:51 11000 -- (-2621.639) (-2625.418) [-2622.639] (-2620.456) * (-2625.545) (-2637.561) [-2620.134] (-2621.779) -- 0:08:59 11500 -- (-2621.175) (-2625.835) [-2615.708] (-2619.841) * (-2617.406) (-2621.666) (-2635.286) [-2620.712] -- 0:08:35 12000 -- (-2628.463) [-2617.977] (-2620.254) (-2623.115) * [-2615.730] (-2621.762) (-2623.162) (-2619.062) -- 0:08:14 12500 -- (-2621.882) (-2624.449) [-2617.382] (-2624.880) * (-2617.397) [-2620.299] (-2621.502) (-2630.713) -- 0:07:54 13000 -- (-2614.942) (-2614.258) [-2618.975] (-2625.902) * (-2624.309) (-2621.033) [-2613.553] (-2618.585) -- 0:08:51 13500 -- (-2620.101) [-2617.021] (-2613.437) (-2623.821) * (-2623.210) [-2616.277] (-2618.546) (-2621.267) -- 0:08:31 14000 -- (-2629.403) (-2619.294) [-2620.040] (-2621.774) * (-2612.599) [-2617.486] (-2625.315) (-2621.418) -- 0:08:13 14500 -- (-2624.028) [-2626.590] (-2623.142) (-2615.469) * (-2617.551) (-2623.592) (-2623.647) [-2624.603] -- 0:07:55 15000 -- (-2623.928) [-2622.593] (-2618.737) (-2617.082) * [-2611.921] (-2627.459) (-2622.497) (-2613.760) -- 0:08:45 Average standard deviation of split frequencies: 0.022097 15500 -- [-2622.508] (-2622.953) (-2614.351) (-2625.199) * (-2618.405) (-2624.638) (-2635.016) [-2616.315] -- 0:08:28 16000 -- (-2618.562) (-2628.101) [-2614.660] (-2627.665) * (-2616.835) (-2626.161) [-2619.234] (-2628.408) -- 0:08:12 16500 -- (-2625.413) (-2627.071) (-2615.432) [-2621.384] * (-2627.063) (-2619.823) [-2624.840] (-2612.387) -- 0:08:56 17000 -- (-2624.899) [-2615.397] (-2617.275) (-2617.992) * (-2619.190) (-2624.496) [-2619.584] (-2624.221) -- 0:08:40 17500 -- (-2622.340) (-2618.157) (-2629.108) [-2625.334] * (-2620.762) (-2618.627) [-2617.785] (-2621.555) -- 0:08:25 18000 -- (-2622.768) (-2614.226) (-2627.311) [-2617.583] * [-2612.164] (-2618.997) (-2612.969) (-2618.538) -- 0:08:11 18500 -- [-2617.727] (-2616.940) (-2625.277) (-2621.141) * [-2630.763] (-2619.844) (-2619.597) (-2624.044) -- 0:08:50 19000 -- (-2621.335) (-2622.298) (-2628.545) [-2618.504] * (-2617.637) [-2621.182] (-2619.124) (-2622.470) -- 0:08:36 19500 -- (-2622.470) (-2620.697) [-2615.393] (-2619.779) * (-2616.743) (-2621.247) (-2623.321) [-2629.783] -- 0:08:22 20000 -- (-2622.537) (-2621.349) [-2615.482] (-2618.189) * (-2620.552) [-2616.826] (-2624.246) (-2618.010) -- 0:08:59 Average standard deviation of split frequencies: 0.020909 20500 -- [-2627.419] (-2624.285) (-2618.652) (-2626.371) * [-2621.758] (-2619.728) (-2623.516) (-2623.840) -- 0:08:45 21000 -- (-2632.881) (-2615.572) (-2618.669) [-2618.588] * (-2620.977) (-2615.790) [-2618.794] (-2620.373) -- 0:08:32 21500 -- [-2615.557] (-2624.361) (-2635.897) (-2623.423) * (-2631.368) [-2620.035] (-2631.615) (-2615.970) -- 0:08:20 22000 -- (-2625.051) (-2623.373) (-2617.027) [-2619.396] * (-2618.530) [-2619.113] (-2619.492) (-2624.101) -- 0:08:53 22500 -- (-2615.137) [-2621.509] (-2617.825) (-2624.989) * (-2634.122) [-2615.530] (-2630.677) (-2617.544) -- 0:08:41 23000 -- (-2624.234) [-2626.922] (-2619.685) (-2617.498) * (-2626.218) [-2622.940] (-2617.787) (-2614.605) -- 0:08:29 23500 -- (-2627.245) (-2621.898) (-2620.295) [-2621.244] * [-2614.493] (-2625.283) (-2617.823) (-2625.884) -- 0:08:18 24000 -- [-2627.519] (-2622.346) (-2614.634) (-2615.286) * (-2618.201) [-2619.355] (-2611.656) (-2623.582) -- 0:08:48 24500 -- [-2616.929] (-2618.175) (-2623.897) (-2619.795) * (-2611.531) (-2623.665) (-2626.394) [-2622.178] -- 0:08:37 25000 -- (-2622.310) (-2624.289) [-2617.989] (-2620.284) * [-2616.383] (-2623.061) (-2622.112) (-2619.956) -- 0:08:26 Average standard deviation of split frequencies: 0.028707 25500 -- [-2622.346] (-2625.105) (-2624.064) (-2626.189) * (-2622.485) (-2617.273) (-2616.454) [-2616.751] -- 0:08:55 26000 -- (-2623.473) (-2621.143) (-2616.322) [-2618.307] * (-2619.196) (-2617.220) [-2618.379] (-2620.718) -- 0:08:44 26500 -- (-2626.415) (-2615.281) [-2624.719] (-2626.969) * (-2623.834) (-2616.176) [-2616.377] (-2617.973) -- 0:08:34 27000 -- (-2623.665) (-2617.583) (-2636.543) [-2618.231] * [-2622.273] (-2614.569) (-2617.137) (-2621.365) -- 0:08:24 27500 -- (-2618.850) (-2628.899) (-2622.388) [-2618.872] * (-2625.972) (-2618.688) (-2614.058) [-2621.725] -- 0:08:50 28000 -- (-2626.836) (-2614.751) [-2624.759] (-2621.001) * (-2625.079) (-2619.887) (-2619.988) [-2616.487] -- 0:08:40 28500 -- [-2617.408] (-2617.836) (-2622.712) (-2619.071) * [-2631.218] (-2622.715) (-2622.207) (-2610.948) -- 0:08:31 29000 -- (-2615.286) (-2622.565) [-2613.841] (-2618.124) * (-2626.902) [-2614.063] (-2620.396) (-2620.914) -- 0:08:55 29500 -- (-2617.745) (-2622.785) (-2616.523) [-2617.579] * [-2614.869] (-2625.676) (-2616.478) (-2622.430) -- 0:08:46 30000 -- (-2622.424) (-2622.043) [-2617.507] (-2624.972) * (-2618.306) (-2625.873) [-2615.880] (-2615.247) -- 0:08:37 Average standard deviation of split frequencies: 0.032025 30500 -- (-2622.839) [-2617.902] (-2623.513) (-2622.928) * [-2621.713] (-2624.060) (-2621.527) (-2624.294) -- 0:08:28 31000 -- (-2622.436) [-2623.756] (-2617.072) (-2620.426) * [-2620.787] (-2626.683) (-2630.250) (-2621.782) -- 0:08:51 31500 -- (-2622.052) [-2617.891] (-2622.265) (-2613.332) * (-2620.113) (-2616.739) [-2617.891] (-2623.189) -- 0:08:42 32000 -- (-2622.909) [-2620.243] (-2621.566) (-2614.571) * (-2614.578) (-2622.070) (-2616.188) [-2615.154] -- 0:08:34 32500 -- [-2617.457] (-2616.872) (-2624.371) (-2615.735) * [-2616.660] (-2622.644) (-2617.437) (-2622.029) -- 0:08:55 33000 -- (-2626.987) (-2613.076) [-2617.703] (-2631.827) * (-2617.412) [-2617.225] (-2626.865) (-2612.274) -- 0:08:47 33500 -- (-2624.854) (-2626.161) [-2616.396] (-2618.768) * (-2622.508) [-2612.876] (-2610.602) (-2619.660) -- 0:08:39 34000 -- [-2625.286] (-2630.111) (-2615.879) (-2622.732) * [-2621.808] (-2619.050) (-2621.515) (-2625.785) -- 0:08:31 34500 -- (-2623.652) [-2624.426] (-2619.604) (-2616.446) * (-2639.686) [-2622.155] (-2624.769) (-2618.900) -- 0:08:51 35000 -- (-2623.062) (-2623.165) (-2628.677) [-2621.174] * (-2622.288) [-2616.249] (-2623.378) (-2614.275) -- 0:08:43 Average standard deviation of split frequencies: 0.033828 35500 -- [-2620.470] (-2625.422) (-2624.105) (-2627.347) * [-2624.524] (-2626.225) (-2622.190) (-2614.266) -- 0:08:36 36000 -- (-2622.166) [-2629.814] (-2619.695) (-2625.556) * (-2622.238) (-2624.176) (-2622.120) [-2612.829] -- 0:08:28 36500 -- (-2628.546) (-2625.872) [-2621.877] (-2624.809) * (-2625.711) (-2627.419) (-2625.651) [-2620.323] -- 0:08:47 37000 -- (-2621.584) [-2627.233] (-2622.015) (-2621.565) * (-2626.752) (-2629.528) (-2632.885) [-2613.972] -- 0:08:40 37500 -- [-2625.579] (-2633.024) (-2620.606) (-2626.277) * (-2623.033) [-2617.389] (-2618.158) (-2621.628) -- 0:08:33 38000 -- [-2626.669] (-2629.259) (-2615.638) (-2622.752) * (-2622.726) (-2616.188) (-2623.735) [-2614.792] -- 0:08:51 38500 -- (-2624.359) (-2627.856) (-2626.791) [-2618.138] * (-2629.224) (-2617.764) (-2626.906) [-2615.754] -- 0:08:44 39000 -- (-2618.738) [-2624.191] (-2627.421) (-2616.224) * (-2620.510) (-2615.311) [-2616.951] (-2617.570) -- 0:08:37 39500 -- [-2621.662] (-2641.522) (-2616.319) (-2614.214) * (-2617.771) (-2615.970) (-2619.231) [-2617.176] -- 0:08:30 40000 -- [-2621.625] (-2625.933) (-2618.261) (-2618.802) * (-2619.971) (-2624.032) [-2617.082] (-2619.355) -- 0:08:48 Average standard deviation of split frequencies: 0.028980 40500 -- (-2618.777) [-2624.904] (-2628.802) (-2620.386) * (-2623.836) (-2618.219) [-2617.779] (-2625.525) -- 0:08:41 41000 -- (-2626.021) [-2626.719] (-2616.213) (-2616.861) * (-2623.528) [-2619.052] (-2615.353) (-2618.458) -- 0:08:34 41500 -- (-2620.134) (-2632.972) (-2614.086) [-2615.026] * (-2628.066) (-2618.879) [-2614.785] (-2613.086) -- 0:08:51 42000 -- (-2622.863) [-2625.580] (-2623.371) (-2617.801) * (-2615.408) (-2619.453) (-2621.771) [-2623.579] -- 0:08:44 42500 -- (-2627.503) [-2622.706] (-2620.126) (-2613.299) * (-2622.444) (-2625.384) (-2617.071) [-2622.192] -- 0:08:38 43000 -- (-2613.165) (-2640.851) (-2622.337) [-2622.615] * (-2631.410) (-2622.244) [-2620.101] (-2619.756) -- 0:08:31 43500 -- (-2621.279) (-2624.484) (-2623.938) [-2621.176] * (-2617.413) (-2617.006) [-2618.706] (-2623.963) -- 0:08:47 44000 -- (-2619.119) (-2625.555) (-2623.097) [-2615.587] * (-2624.164) (-2627.465) (-2623.196) [-2613.556] -- 0:08:41 44500 -- [-2619.686] (-2623.058) (-2622.779) (-2618.616) * (-2620.412) (-2624.211) (-2620.402) [-2616.544] -- 0:08:35 45000 -- [-2614.811] (-2619.581) (-2626.699) (-2616.095) * (-2639.511) (-2622.394) [-2620.888] (-2617.128) -- 0:08:50 Average standard deviation of split frequencies: 0.017934 45500 -- (-2618.704) [-2619.036] (-2613.186) (-2621.867) * (-2626.820) [-2619.208] (-2623.380) (-2620.146) -- 0:08:44 46000 -- (-2624.543) [-2617.669] (-2620.442) (-2619.960) * (-2629.133) (-2624.623) [-2620.465] (-2617.274) -- 0:08:38 46500 -- (-2622.441) (-2622.084) [-2621.183] (-2614.108) * (-2619.288) (-2618.765) [-2614.664] (-2617.926) -- 0:08:32 47000 -- (-2625.972) (-2615.644) [-2622.291] (-2622.359) * (-2625.535) (-2627.999) (-2618.512) [-2619.314] -- 0:08:47 47500 -- (-2626.022) (-2616.785) [-2617.553] (-2617.273) * (-2620.060) (-2626.664) (-2627.885) [-2615.185] -- 0:08:41 48000 -- (-2615.966) (-2622.002) (-2614.172) [-2617.614] * (-2622.452) (-2618.559) (-2627.852) [-2618.635] -- 0:08:35 48500 -- (-2617.492) [-2618.140] (-2623.832) (-2620.030) * [-2618.052] (-2618.266) (-2620.961) (-2621.231) -- 0:08:30 49000 -- (-2616.306) (-2625.138) [-2616.593] (-2619.038) * (-2619.192) (-2624.405) (-2634.912) [-2622.136] -- 0:08:44 49500 -- (-2616.797) (-2621.746) [-2615.157] (-2616.335) * (-2621.033) [-2613.709] (-2620.069) (-2622.062) -- 0:08:38 50000 -- [-2621.423] (-2628.003) (-2620.010) (-2633.563) * (-2618.495) (-2619.115) [-2623.659] (-2620.964) -- 0:08:33 Average standard deviation of split frequencies: 0.014731 50500 -- (-2623.258) (-2619.927) [-2619.498] (-2635.553) * (-2629.462) (-2618.330) (-2619.979) [-2618.780] -- 0:08:46 51000 -- (-2617.437) [-2617.981] (-2620.209) (-2630.093) * (-2619.611) (-2625.905) [-2614.751] (-2626.992) -- 0:08:41 51500 -- (-2630.396) (-2620.214) [-2618.277] (-2628.182) * (-2629.254) (-2626.629) [-2614.349] (-2623.315) -- 0:08:35 52000 -- (-2620.057) (-2624.085) [-2619.158] (-2627.555) * (-2618.409) (-2622.480) [-2622.071] (-2627.150) -- 0:08:30 52500 -- (-2615.520) (-2620.492) (-2622.973) [-2618.156] * (-2623.062) (-2618.948) [-2624.440] (-2621.093) -- 0:08:43 53000 -- (-2617.526) (-2621.911) [-2616.155] (-2621.230) * (-2624.343) [-2622.106] (-2633.042) (-2619.320) -- 0:08:38 53500 -- (-2618.883) (-2623.583) (-2617.600) [-2622.348] * [-2624.478] (-2624.779) (-2626.184) (-2620.750) -- 0:08:33 54000 -- (-2632.232) [-2618.404] (-2622.838) (-2618.733) * (-2625.530) [-2624.137] (-2629.070) (-2625.034) -- 0:08:28 54500 -- [-2628.533] (-2617.739) (-2621.054) (-2625.019) * [-2614.129] (-2613.264) (-2616.487) (-2620.818) -- 0:08:40 55000 -- [-2614.206] (-2615.692) (-2625.438) (-2624.418) * (-2617.092) (-2622.222) (-2625.382) [-2611.205] -- 0:08:35 Average standard deviation of split frequencies: 0.012627 55500 -- [-2616.117] (-2631.085) (-2619.772) (-2633.761) * (-2634.561) (-2626.671) (-2621.267) [-2617.704] -- 0:08:30 56000 -- [-2615.861] (-2627.613) (-2622.286) (-2629.441) * [-2616.461] (-2626.961) (-2626.923) (-2626.544) -- 0:08:42 56500 -- [-2619.329] (-2622.614) (-2618.618) (-2626.930) * (-2623.457) (-2621.622) [-2616.925] (-2620.909) -- 0:08:37 57000 -- (-2619.908) [-2618.658] (-2628.564) (-2626.014) * (-2619.149) [-2622.903] (-2615.889) (-2628.102) -- 0:08:32 57500 -- [-2615.531] (-2619.927) (-2615.114) (-2632.452) * (-2615.399) (-2628.333) [-2616.067] (-2624.125) -- 0:08:28 58000 -- (-2624.807) (-2625.134) [-2622.829] (-2624.002) * [-2615.455] (-2625.658) (-2620.326) (-2627.682) -- 0:08:39 58500 -- [-2617.733] (-2617.112) (-2615.927) (-2624.881) * [-2617.044] (-2621.049) (-2613.528) (-2625.433) -- 0:08:35 59000 -- [-2614.745] (-2623.197) (-2620.356) (-2627.624) * (-2615.832) [-2626.389] (-2630.643) (-2624.467) -- 0:08:30 59500 -- (-2630.765) (-2623.096) [-2617.766] (-2621.379) * (-2620.629) (-2624.233) (-2615.908) [-2616.955] -- 0:08:41 60000 -- (-2621.138) (-2617.665) [-2618.053] (-2631.308) * [-2612.546] (-2626.301) (-2629.766) (-2620.251) -- 0:08:37 Average standard deviation of split frequencies: 0.017483 60500 -- (-2615.732) (-2624.010) [-2615.200] (-2623.704) * (-2619.832) [-2623.351] (-2623.486) (-2622.083) -- 0:08:32 61000 -- [-2620.154] (-2625.484) (-2616.213) (-2634.994) * (-2614.146) (-2620.547) (-2618.756) [-2619.704] -- 0:08:27 61500 -- [-2621.594] (-2619.707) (-2617.704) (-2618.636) * (-2618.982) [-2621.475] (-2624.341) (-2625.121) -- 0:08:38 62000 -- (-2628.239) (-2617.806) [-2613.551] (-2622.780) * (-2631.520) (-2615.883) [-2615.560] (-2629.968) -- 0:08:34 62500 -- (-2627.236) (-2621.848) [-2619.573] (-2616.752) * [-2619.806] (-2620.235) (-2623.337) (-2617.535) -- 0:08:30 63000 -- (-2616.335) (-2623.530) [-2622.252] (-2619.617) * [-2619.827] (-2616.477) (-2620.221) (-2624.007) -- 0:08:25 63500 -- [-2622.876] (-2624.996) (-2618.259) (-2625.398) * [-2629.828] (-2623.958) (-2622.086) (-2626.617) -- 0:08:36 64000 -- [-2614.403] (-2623.287) (-2622.228) (-2617.186) * [-2616.382] (-2631.766) (-2623.571) (-2622.738) -- 0:08:31 64500 -- (-2616.700) (-2612.344) [-2622.227] (-2616.141) * [-2616.061] (-2623.692) (-2627.060) (-2622.265) -- 0:08:27 65000 -- (-2625.099) (-2620.394) [-2619.701] (-2620.659) * [-2620.193] (-2625.008) (-2624.601) (-2629.326) -- 0:08:37 Average standard deviation of split frequencies: 0.019642 65500 -- (-2620.977) (-2624.775) [-2620.941] (-2615.508) * (-2622.130) (-2627.900) [-2621.363] (-2621.147) -- 0:08:33 66000 -- (-2619.167) (-2616.972) [-2616.614] (-2619.037) * (-2618.554) (-2616.171) (-2619.921) [-2617.307] -- 0:08:29 66500 -- (-2624.257) (-2632.389) [-2622.501] (-2622.251) * (-2623.140) (-2634.171) (-2627.283) [-2618.463] -- 0:08:25 67000 -- [-2621.509] (-2618.842) (-2624.716) (-2622.292) * (-2621.476) (-2621.264) (-2627.958) [-2620.759] -- 0:08:35 67500 -- (-2632.421) (-2624.246) [-2612.690] (-2619.242) * (-2622.161) (-2621.069) (-2633.108) [-2618.668] -- 0:08:31 68000 -- (-2625.873) (-2635.296) [-2619.098] (-2622.946) * (-2611.106) (-2616.928) (-2622.606) [-2620.099] -- 0:08:27 68500 -- (-2630.270) (-2620.354) [-2621.837] (-2613.158) * [-2622.410] (-2630.844) (-2621.991) (-2620.697) -- 0:08:23 69000 -- (-2623.952) (-2615.681) [-2616.447] (-2621.304) * [-2618.458] (-2623.502) (-2620.512) (-2624.259) -- 0:08:32 69500 -- (-2623.514) [-2618.427] (-2623.498) (-2616.033) * (-2616.109) [-2625.816] (-2620.074) (-2620.242) -- 0:08:28 70000 -- (-2623.670) (-2626.840) [-2632.737] (-2620.905) * (-2634.520) (-2622.555) [-2614.076] (-2626.843) -- 0:08:24 Average standard deviation of split frequencies: 0.026127 70500 -- (-2618.295) [-2620.239] (-2614.378) (-2622.016) * [-2618.161] (-2614.751) (-2618.129) (-2613.823) -- 0:08:34 71000 -- (-2616.716) [-2618.189] (-2613.005) (-2616.822) * (-2621.003) (-2615.450) [-2617.024] (-2619.448) -- 0:08:30 71500 -- (-2624.358) (-2632.382) [-2617.264] (-2624.549) * (-2621.393) [-2621.012] (-2616.041) (-2617.634) -- 0:08:26 72000 -- (-2618.489) [-2618.513] (-2616.779) (-2623.787) * [-2613.701] (-2629.958) (-2622.635) (-2626.597) -- 0:08:22 72500 -- (-2623.627) (-2615.091) [-2616.756] (-2628.865) * (-2617.925) (-2625.436) (-2622.378) [-2616.699] -- 0:08:31 73000 -- (-2625.667) [-2614.113] (-2619.190) (-2633.178) * (-2617.096) (-2619.168) (-2618.437) [-2621.208] -- 0:08:27 73500 -- (-2623.003) (-2618.709) (-2628.297) [-2617.000] * [-2620.254] (-2618.253) (-2621.248) (-2623.127) -- 0:08:24 74000 -- (-2616.447) (-2621.996) (-2617.203) [-2616.064] * (-2619.242) (-2619.125) (-2623.419) [-2623.095] -- 0:08:33 74500 -- (-2621.315) (-2620.656) (-2619.567) [-2618.827] * [-2619.610] (-2616.933) (-2618.000) (-2615.793) -- 0:08:29 75000 -- (-2632.182) (-2627.094) [-2615.545] (-2625.602) * (-2615.243) (-2617.379) [-2617.911] (-2617.120) -- 0:08:25 Average standard deviation of split frequencies: 0.027912 75500 -- (-2618.131) (-2620.542) (-2620.183) [-2614.490] * (-2628.917) (-2615.195) [-2626.337] (-2616.612) -- 0:08:22 76000 -- (-2618.014) (-2618.253) (-2625.207) [-2616.100] * (-2622.894) [-2616.155] (-2626.053) (-2619.910) -- 0:08:30 76500 -- (-2623.660) (-2624.875) (-2626.248) [-2619.810] * (-2623.869) (-2619.899) (-2623.147) [-2622.985] -- 0:08:27 77000 -- (-2614.283) (-2625.294) (-2626.182) [-2620.179] * [-2623.362] (-2617.544) (-2618.141) (-2623.761) -- 0:08:23 77500 -- (-2625.108) [-2621.588] (-2617.546) (-2620.783) * (-2614.505) (-2621.229) [-2617.265] (-2623.136) -- 0:08:19 78000 -- [-2617.354] (-2620.790) (-2618.205) (-2615.580) * (-2619.707) [-2618.284] (-2621.339) (-2614.918) -- 0:08:28 78500 -- (-2620.380) (-2624.946) [-2614.424] (-2622.749) * (-2617.485) (-2616.833) [-2613.399] (-2617.184) -- 0:08:24 79000 -- (-2620.173) [-2623.162] (-2618.176) (-2616.940) * [-2620.354] (-2618.739) (-2616.832) (-2618.429) -- 0:08:21 79500 -- [-2624.637] (-2620.617) (-2626.662) (-2624.798) * [-2618.038] (-2624.195) (-2620.827) (-2621.773) -- 0:08:29 80000 -- (-2617.869) (-2619.274) [-2624.014] (-2623.103) * (-2623.524) [-2618.118] (-2615.591) (-2622.776) -- 0:08:26 Average standard deviation of split frequencies: 0.026297 80500 -- (-2624.599) [-2621.200] (-2617.661) (-2627.455) * (-2626.399) (-2618.775) (-2617.488) [-2613.000] -- 0:08:22 81000 -- (-2623.185) (-2622.806) (-2618.678) [-2626.115] * (-2623.012) [-2618.490] (-2621.901) (-2611.655) -- 0:08:19 81500 -- [-2615.343] (-2617.808) (-2618.833) (-2621.501) * [-2619.349] (-2623.589) (-2617.425) (-2619.708) -- 0:08:27 82000 -- (-2620.387) (-2617.517) [-2619.712] (-2626.228) * (-2634.917) (-2618.697) (-2624.425) [-2616.310] -- 0:08:23 82500 -- (-2625.239) (-2617.112) [-2615.203] (-2622.473) * (-2632.062) (-2627.585) [-2619.476] (-2618.682) -- 0:08:20 83000 -- (-2625.200) [-2612.260] (-2619.186) (-2624.889) * (-2621.730) (-2614.919) (-2624.691) [-2616.099] -- 0:08:17 83500 -- [-2624.713] (-2622.641) (-2619.116) (-2622.724) * [-2622.994] (-2621.011) (-2627.177) (-2614.612) -- 0:08:24 84000 -- (-2615.831) [-2626.713] (-2625.942) (-2624.967) * (-2626.214) [-2618.094] (-2620.674) (-2629.496) -- 0:08:21 84500 -- (-2615.222) (-2626.567) [-2623.976] (-2624.710) * (-2613.686) (-2618.402) [-2620.116] (-2623.585) -- 0:08:18 85000 -- (-2628.764) (-2622.226) [-2617.422] (-2623.572) * [-2618.191] (-2621.397) (-2618.294) (-2618.597) -- 0:08:25 Average standard deviation of split frequencies: 0.025123 85500 -- (-2621.440) (-2621.890) [-2613.665] (-2617.069) * [-2620.380] (-2620.815) (-2622.368) (-2618.498) -- 0:08:22 86000 -- (-2616.690) (-2615.775) [-2618.954] (-2625.797) * (-2620.147) (-2628.315) (-2620.308) [-2621.421] -- 0:08:19 86500 -- [-2616.864] (-2613.479) (-2616.306) (-2618.966) * (-2617.197) (-2624.678) [-2622.698] (-2615.157) -- 0:08:16 87000 -- (-2616.770) (-2618.843) (-2621.664) [-2617.964] * [-2614.342] (-2628.050) (-2618.942) (-2633.633) -- 0:08:23 87500 -- [-2615.814] (-2616.382) (-2619.324) (-2619.699) * [-2614.788] (-2618.489) (-2630.693) (-2621.487) -- 0:08:20 88000 -- (-2621.340) (-2620.963) [-2618.471] (-2624.786) * [-2619.847] (-2613.420) (-2630.032) (-2635.589) -- 0:08:17 88500 -- [-2617.123] (-2623.941) (-2616.758) (-2623.748) * [-2624.878] (-2616.024) (-2624.571) (-2621.464) -- 0:08:24 89000 -- [-2618.181] (-2618.807) (-2618.356) (-2614.845) * [-2623.767] (-2620.624) (-2622.331) (-2618.429) -- 0:08:21 89500 -- (-2616.618) [-2621.268] (-2626.914) (-2621.716) * (-2616.020) (-2617.314) [-2614.156] (-2624.827) -- 0:08:18 90000 -- (-2633.293) (-2614.743) (-2620.178) [-2619.946] * (-2610.892) (-2624.633) (-2624.870) [-2619.609] -- 0:08:15 Average standard deviation of split frequencies: 0.022530 90500 -- [-2627.821] (-2613.507) (-2627.371) (-2629.967) * (-2619.039) (-2621.149) (-2617.612) [-2620.207] -- 0:08:22 91000 -- [-2612.173] (-2621.047) (-2621.927) (-2622.448) * [-2613.893] (-2616.051) (-2623.459) (-2623.511) -- 0:08:19 91500 -- (-2620.006) (-2619.190) (-2626.248) [-2621.268] * (-2626.041) [-2616.791] (-2620.068) (-2630.719) -- 0:08:16 92000 -- (-2617.317) (-2619.306) (-2630.334) [-2613.826] * (-2620.392) (-2624.176) (-2624.703) [-2623.053] -- 0:08:13 92500 -- (-2623.927) (-2617.531) (-2636.735) [-2619.845] * (-2615.767) [-2621.402] (-2630.652) (-2623.195) -- 0:08:20 93000 -- (-2627.168) [-2618.687] (-2623.159) (-2616.391) * (-2609.555) [-2614.435] (-2636.935) (-2614.859) -- 0:08:17 93500 -- [-2625.515] (-2616.040) (-2623.646) (-2617.979) * (-2620.155) [-2615.653] (-2629.526) (-2620.002) -- 0:08:14 94000 -- (-2621.179) (-2621.931) (-2624.037) [-2613.300] * (-2631.051) [-2622.170] (-2622.112) (-2613.623) -- 0:08:21 94500 -- (-2621.201) [-2619.702] (-2624.926) (-2625.772) * (-2623.656) (-2629.596) (-2624.727) [-2618.549] -- 0:08:18 95000 -- [-2621.653] (-2615.209) (-2624.572) (-2622.684) * (-2626.525) (-2623.625) (-2634.689) [-2614.991] -- 0:08:15 Average standard deviation of split frequencies: 0.026189 95500 -- [-2617.198] (-2613.073) (-2617.105) (-2620.577) * (-2619.084) (-2630.198) [-2619.913] (-2632.252) -- 0:08:12 96000 -- (-2616.536) (-2622.724) [-2624.624] (-2622.511) * (-2618.371) [-2620.657] (-2618.730) (-2619.890) -- 0:08:19 96500 -- (-2620.513) (-2618.598) [-2622.870] (-2621.003) * (-2621.597) [-2618.338] (-2613.719) (-2620.091) -- 0:08:16 97000 -- (-2630.254) [-2615.733] (-2621.333) (-2626.361) * (-2617.385) (-2626.785) (-2617.536) [-2622.783] -- 0:08:13 97500 -- (-2615.307) (-2617.548) [-2624.606] (-2628.872) * [-2615.314] (-2633.079) (-2613.957) (-2624.817) -- 0:08:19 98000 -- [-2611.288] (-2625.349) (-2624.778) (-2622.693) * (-2617.041) (-2628.418) [-2617.530] (-2620.778) -- 0:08:17 98500 -- (-2620.322) [-2619.936] (-2630.622) (-2630.400) * [-2613.880] (-2621.313) (-2619.989) (-2627.550) -- 0:08:14 99000 -- (-2620.394) (-2617.553) [-2623.914] (-2628.083) * (-2619.062) (-2626.852) [-2624.998] (-2616.940) -- 0:08:11 99500 -- (-2620.134) [-2619.954] (-2629.674) (-2623.536) * (-2618.657) (-2619.013) [-2614.530] (-2616.969) -- 0:08:17 100000 -- [-2614.008] (-2621.895) (-2625.808) (-2618.699) * (-2624.520) [-2619.120] (-2614.453) (-2615.955) -- 0:08:15 Average standard deviation of split frequencies: 0.025756 100500 -- (-2628.095) [-2629.863] (-2624.522) (-2619.751) * (-2621.977) (-2620.789) (-2620.573) [-2621.102] -- 0:08:12 101000 -- (-2615.307) (-2629.258) (-2621.762) [-2621.931] * (-2616.197) (-2623.281) [-2620.790] (-2626.282) -- 0:08:09 101500 -- (-2611.642) (-2627.626) [-2617.542] (-2619.662) * (-2612.741) [-2622.115] (-2630.228) (-2631.198) -- 0:08:15 102000 -- (-2617.788) (-2620.069) (-2617.414) [-2619.403] * [-2616.872] (-2620.437) (-2629.875) (-2624.454) -- 0:08:13 102500 -- (-2626.490) (-2623.709) [-2620.797] (-2627.905) * [-2620.227] (-2621.525) (-2619.095) (-2617.135) -- 0:08:10 103000 -- (-2624.088) [-2621.106] (-2616.564) (-2622.703) * (-2620.311) [-2624.484] (-2622.328) (-2620.076) -- 0:08:16 103500 -- (-2621.265) (-2624.809) [-2616.142] (-2615.898) * [-2624.387] (-2622.366) (-2616.625) (-2628.981) -- 0:08:13 104000 -- (-2615.179) (-2628.371) [-2613.836] (-2616.773) * (-2620.054) (-2631.927) [-2618.568] (-2616.037) -- 0:08:11 104500 -- (-2615.939) [-2621.426] (-2619.681) (-2619.903) * (-2624.557) [-2616.520] (-2614.324) (-2618.222) -- 0:08:08 105000 -- (-2612.934) (-2617.632) (-2623.275) [-2620.326] * (-2624.698) (-2615.938) (-2630.003) [-2615.387] -- 0:08:14 Average standard deviation of split frequencies: 0.028536 105500 -- [-2613.843] (-2618.299) (-2614.935) (-2618.000) * (-2613.095) (-2618.220) [-2618.529] (-2615.438) -- 0:08:11 106000 -- [-2614.140] (-2622.759) (-2621.583) (-2617.634) * (-2617.245) (-2621.317) [-2613.107] (-2628.488) -- 0:08:09 106500 -- (-2624.574) [-2619.933] (-2622.643) (-2624.356) * (-2617.047) (-2625.666) [-2619.610] (-2617.659) -- 0:08:14 107000 -- [-2619.475] (-2618.644) (-2622.203) (-2616.910) * (-2627.005) (-2622.617) (-2621.499) [-2620.023] -- 0:08:12 107500 -- (-2620.163) [-2625.069] (-2626.149) (-2620.616) * (-2622.077) (-2622.836) [-2631.946] (-2624.100) -- 0:08:09 108000 -- (-2618.940) [-2621.212] (-2619.772) (-2625.981) * (-2622.651) [-2616.892] (-2621.962) (-2625.164) -- 0:08:07 108500 -- (-2629.298) (-2621.240) [-2627.877] (-2622.397) * (-2620.419) (-2615.594) (-2622.189) [-2620.189] -- 0:08:12 109000 -- (-2612.578) [-2620.197] (-2628.854) (-2623.842) * [-2620.397] (-2628.360) (-2623.235) (-2623.913) -- 0:08:10 109500 -- (-2620.404) (-2626.765) [-2614.758] (-2625.507) * (-2630.804) [-2613.355] (-2621.651) (-2621.901) -- 0:08:07 110000 -- (-2619.520) [-2614.879] (-2615.921) (-2627.103) * (-2617.197) (-2625.968) [-2621.069] (-2619.194) -- 0:08:05 Average standard deviation of split frequencies: 0.030173 110500 -- (-2628.068) (-2632.791) [-2614.113] (-2614.646) * (-2626.533) [-2628.578] (-2625.978) (-2618.428) -- 0:08:11 111000 -- [-2618.676] (-2622.020) (-2617.888) (-2625.524) * (-2618.713) (-2623.454) (-2623.110) [-2620.670] -- 0:08:08 111500 -- (-2619.371) (-2615.632) [-2616.827] (-2624.526) * [-2622.207] (-2623.088) (-2623.947) (-2611.981) -- 0:08:06 112000 -- (-2619.845) [-2616.240] (-2630.446) (-2619.597) * (-2617.791) (-2625.059) [-2614.734] (-2616.399) -- 0:08:11 112500 -- [-2619.611] (-2620.869) (-2629.068) (-2619.696) * (-2631.539) [-2624.769] (-2621.175) (-2626.574) -- 0:08:09 113000 -- (-2618.311) (-2624.661) (-2620.199) [-2618.436] * (-2626.611) (-2621.324) (-2618.808) [-2618.474] -- 0:08:06 113500 -- [-2613.957] (-2623.066) (-2616.700) (-2631.314) * (-2617.388) (-2618.337) (-2618.154) [-2622.172] -- 0:08:04 114000 -- (-2620.625) [-2618.568] (-2618.857) (-2628.745) * (-2618.689) (-2624.813) (-2625.229) [-2625.649] -- 0:08:09 114500 -- (-2621.267) [-2618.999] (-2621.450) (-2625.563) * (-2617.384) (-2624.912) [-2620.936] (-2617.974) -- 0:08:07 115000 -- [-2620.055] (-2623.814) (-2616.669) (-2614.557) * (-2615.277) (-2634.346) (-2621.207) [-2614.692] -- 0:08:04 Average standard deviation of split frequencies: 0.027770 115500 -- (-2617.902) [-2623.663] (-2622.874) (-2616.871) * [-2614.294] (-2622.153) (-2625.787) (-2628.941) -- 0:08:02 116000 -- (-2618.215) (-2617.613) (-2625.616) [-2620.766] * (-2617.429) [-2620.719] (-2623.880) (-2623.646) -- 0:08:07 116500 -- [-2616.727] (-2622.943) (-2627.617) (-2620.778) * [-2624.034] (-2619.949) (-2624.445) (-2620.276) -- 0:08:05 117000 -- [-2616.242] (-2616.439) (-2621.684) (-2626.586) * [-2625.594] (-2625.376) (-2620.470) (-2613.108) -- 0:08:03 117500 -- (-2620.505) [-2617.335] (-2622.980) (-2618.666) * (-2617.678) (-2623.449) (-2620.277) [-2620.321] -- 0:08:08 118000 -- (-2611.575) (-2621.620) [-2615.655] (-2617.071) * (-2624.846) (-2623.024) [-2621.556] (-2624.388) -- 0:08:05 118500 -- (-2626.689) (-2621.773) [-2617.534] (-2611.503) * (-2616.787) (-2619.609) [-2613.587] (-2617.831) -- 0:08:03 119000 -- (-2618.368) (-2614.184) [-2615.860] (-2616.431) * (-2613.145) (-2631.203) (-2622.210) [-2619.872] -- 0:08:01 119500 -- [-2623.052] (-2625.420) (-2623.079) (-2616.636) * [-2614.005] (-2616.532) (-2619.881) (-2626.862) -- 0:08:06 120000 -- (-2622.684) (-2626.363) [-2616.682] (-2626.466) * (-2622.914) (-2614.674) (-2628.275) [-2625.123] -- 0:08:04 Average standard deviation of split frequencies: 0.024417 120500 -- [-2614.694] (-2618.024) (-2616.532) (-2637.337) * (-2619.886) (-2620.799) (-2624.493) [-2617.766] -- 0:08:01 121000 -- (-2615.701) [-2617.185] (-2620.091) (-2624.690) * (-2622.416) (-2628.815) (-2622.522) [-2613.168] -- 0:08:06 121500 -- (-2627.477) [-2617.445] (-2618.347) (-2623.567) * (-2625.703) (-2624.766) (-2620.812) [-2619.555] -- 0:08:04 122000 -- (-2626.745) [-2617.623] (-2617.511) (-2627.586) * (-2622.987) [-2617.991] (-2618.117) (-2623.896) -- 0:08:02 122500 -- (-2631.221) [-2615.654] (-2624.674) (-2631.629) * (-2616.989) (-2615.965) (-2621.481) [-2623.972] -- 0:07:59 123000 -- [-2624.197] (-2621.911) (-2631.207) (-2617.380) * (-2616.904) (-2620.309) [-2624.525] (-2623.654) -- 0:08:04 123500 -- [-2621.420] (-2621.132) (-2621.541) (-2622.133) * (-2622.776) (-2614.856) [-2621.735] (-2615.814) -- 0:08:02 124000 -- (-2625.432) [-2617.522] (-2625.069) (-2620.036) * (-2614.201) (-2624.743) [-2619.918] (-2623.144) -- 0:08:00 124500 -- (-2625.967) [-2620.388] (-2619.642) (-2619.011) * [-2618.919] (-2623.404) (-2620.762) (-2628.199) -- 0:07:58 125000 -- (-2620.720) [-2619.081] (-2621.366) (-2612.093) * (-2628.799) [-2614.467] (-2630.288) (-2624.637) -- 0:08:03 Average standard deviation of split frequencies: 0.023383 125500 -- (-2618.502) (-2614.625) [-2631.782] (-2624.761) * (-2629.557) [-2619.455] (-2617.165) (-2619.008) -- 0:08:00 126000 -- (-2622.798) (-2622.841) [-2633.479] (-2624.904) * [-2623.585] (-2627.834) (-2622.031) (-2629.393) -- 0:07:58 126500 -- (-2619.122) (-2629.692) (-2617.437) [-2629.261] * [-2624.188] (-2622.021) (-2618.774) (-2621.134) -- 0:08:03 127000 -- (-2616.446) (-2622.147) [-2612.557] (-2627.790) * (-2621.461) [-2619.227] (-2625.841) (-2622.087) -- 0:08:01 127500 -- [-2621.102] (-2617.346) (-2614.576) (-2621.625) * (-2618.671) (-2621.765) [-2618.396] (-2616.979) -- 0:07:59 128000 -- (-2622.439) [-2612.604] (-2621.857) (-2625.395) * [-2619.475] (-2618.541) (-2624.707) (-2623.292) -- 0:07:56 128500 -- (-2623.884) [-2626.510] (-2632.638) (-2624.687) * [-2614.262] (-2614.527) (-2620.146) (-2626.494) -- 0:08:01 129000 -- (-2619.292) (-2624.070) (-2629.530) [-2615.122] * [-2618.820] (-2624.915) (-2615.422) (-2628.429) -- 0:07:59 129500 -- (-2620.123) (-2624.391) (-2621.585) [-2616.197] * (-2623.926) (-2626.611) (-2619.742) [-2624.854] -- 0:07:57 130000 -- (-2623.064) [-2617.591] (-2623.459) (-2617.464) * [-2625.700] (-2620.144) (-2620.118) (-2623.447) -- 0:07:55 Average standard deviation of split frequencies: 0.024051 130500 -- (-2625.949) [-2620.941] (-2623.147) (-2616.061) * (-2624.531) [-2618.766] (-2622.153) (-2625.737) -- 0:07:59 131000 -- (-2617.104) [-2620.042] (-2626.627) (-2630.091) * (-2622.699) [-2620.428] (-2630.358) (-2615.604) -- 0:07:57 131500 -- (-2620.422) (-2617.477) (-2625.677) [-2621.615] * (-2620.027) [-2618.047] (-2614.156) (-2625.522) -- 0:07:55 132000 -- [-2617.269] (-2618.512) (-2628.473) (-2617.112) * [-2626.549] (-2617.614) (-2623.187) (-2610.773) -- 0:08:00 132500 -- [-2624.545] (-2623.639) (-2626.324) (-2617.232) * (-2621.283) [-2612.943] (-2623.867) (-2621.700) -- 0:07:57 133000 -- (-2616.038) [-2620.390] (-2631.398) (-2618.356) * (-2623.817) [-2619.144] (-2627.839) (-2618.543) -- 0:07:55 133500 -- (-2614.706) (-2616.971) (-2630.890) [-2620.905] * [-2619.784] (-2617.332) (-2621.327) (-2621.429) -- 0:07:53 134000 -- (-2623.409) (-2619.514) (-2633.364) [-2613.486] * (-2613.077) (-2624.204) [-2617.631] (-2626.493) -- 0:07:58 134500 -- (-2620.993) (-2624.360) [-2616.270] (-2623.241) * (-2615.853) [-2621.162] (-2616.910) (-2621.481) -- 0:07:56 135000 -- [-2620.156] (-2627.574) (-2619.888) (-2620.295) * [-2614.321] (-2618.901) (-2613.690) (-2622.977) -- 0:07:54 Average standard deviation of split frequencies: 0.021664 135500 -- (-2623.723) (-2617.468) [-2617.335] (-2631.531) * [-2618.126] (-2625.087) (-2623.367) (-2619.203) -- 0:07:58 136000 -- (-2634.316) (-2618.341) (-2618.321) [-2617.651] * (-2623.058) [-2621.352] (-2621.407) (-2630.807) -- 0:07:56 136500 -- (-2633.799) [-2617.501] (-2614.026) (-2622.669) * (-2618.039) [-2619.280] (-2616.298) (-2619.143) -- 0:07:54 137000 -- (-2628.643) (-2616.063) [-2621.180] (-2628.320) * (-2612.938) (-2630.920) [-2621.981] (-2625.258) -- 0:07:52 137500 -- (-2625.012) (-2623.112) (-2623.987) [-2614.089] * [-2618.581] (-2619.976) (-2634.826) (-2621.739) -- 0:07:56 138000 -- (-2624.850) (-2619.814) [-2620.127] (-2615.833) * [-2625.277] (-2615.076) (-2637.027) (-2628.653) -- 0:07:54 138500 -- (-2629.098) [-2612.884] (-2618.015) (-2620.713) * (-2619.870) (-2621.971) [-2620.888] (-2634.263) -- 0:07:52 139000 -- (-2623.894) (-2621.033) [-2617.765] (-2614.955) * (-2617.824) (-2624.992) (-2621.892) [-2614.937] -- 0:07:50 139500 -- (-2619.540) (-2614.130) (-2628.972) [-2614.001] * (-2613.722) [-2613.137] (-2616.170) (-2625.191) -- 0:07:54 140000 -- (-2615.679) [-2621.739] (-2613.823) (-2635.422) * (-2626.483) (-2623.057) [-2619.366] (-2635.370) -- 0:07:53 Average standard deviation of split frequencies: 0.019828 140500 -- (-2623.388) (-2621.614) [-2624.653] (-2626.691) * (-2615.145) (-2622.806) (-2626.498) [-2618.811] -- 0:07:51 141000 -- [-2620.670] (-2632.753) (-2633.838) (-2622.805) * (-2616.887) (-2614.262) [-2619.174] (-2620.258) -- 0:07:55 141500 -- (-2627.112) (-2622.585) (-2625.888) [-2617.053] * [-2621.634] (-2623.075) (-2624.997) (-2622.454) -- 0:07:53 142000 -- (-2619.943) (-2618.916) (-2621.069) [-2611.395] * [-2618.894] (-2618.699) (-2618.132) (-2624.802) -- 0:07:51 142500 -- (-2628.413) (-2619.328) [-2617.002] (-2627.589) * (-2624.011) (-2616.233) [-2613.855] (-2623.115) -- 0:07:49 143000 -- (-2629.917) (-2619.350) (-2617.824) [-2622.666] * [-2618.480] (-2622.533) (-2616.559) (-2620.530) -- 0:07:53 143500 -- (-2625.745) [-2619.274] (-2613.481) (-2622.618) * [-2625.862] (-2616.159) (-2614.876) (-2624.068) -- 0:07:51 144000 -- (-2614.295) (-2620.779) (-2618.362) [-2627.509] * (-2619.861) (-2623.362) (-2628.765) [-2619.065] -- 0:07:49 144500 -- (-2616.845) [-2617.902] (-2616.132) (-2615.096) * (-2619.125) (-2620.298) (-2618.753) [-2620.303] -- 0:07:47 145000 -- [-2618.612] (-2624.054) (-2617.820) (-2627.964) * [-2620.477] (-2615.903) (-2618.117) (-2617.530) -- 0:07:51 Average standard deviation of split frequencies: 0.021256 145500 -- (-2621.243) (-2624.193) [-2613.974] (-2619.991) * (-2617.986) (-2620.143) (-2618.422) [-2615.048] -- 0:07:49 146000 -- (-2611.195) (-2617.028) (-2617.829) [-2627.661] * (-2621.980) (-2624.917) (-2618.666) [-2612.277] -- 0:07:47 146500 -- (-2622.149) [-2626.495] (-2617.652) (-2619.882) * (-2626.300) [-2620.140] (-2619.272) (-2624.114) -- 0:07:51 147000 -- (-2620.101) (-2630.349) (-2617.683) [-2619.276] * (-2621.841) (-2615.364) [-2628.096] (-2621.047) -- 0:07:50 147500 -- (-2621.261) [-2616.236] (-2628.275) (-2617.969) * [-2621.407] (-2625.234) (-2619.751) (-2617.359) -- 0:07:48 148000 -- (-2621.229) (-2618.755) [-2616.690] (-2618.360) * [-2624.996] (-2618.274) (-2619.927) (-2616.184) -- 0:07:46 148500 -- [-2619.867] (-2620.150) (-2623.051) (-2621.521) * (-2624.994) (-2635.479) [-2619.197] (-2618.006) -- 0:07:50 149000 -- (-2625.267) (-2613.550) [-2619.041] (-2619.550) * (-2618.028) (-2629.297) (-2627.240) [-2613.163] -- 0:07:48 149500 -- [-2619.286] (-2613.348) (-2620.324) (-2623.676) * (-2633.719) (-2623.308) (-2623.731) [-2615.157] -- 0:07:46 150000 -- [-2620.681] (-2624.185) (-2616.576) (-2630.297) * (-2617.016) [-2619.838] (-2619.491) (-2617.122) -- 0:07:50 Average standard deviation of split frequencies: 0.021641 150500 -- (-2625.904) (-2618.870) [-2621.831] (-2622.933) * (-2623.513) [-2615.739] (-2620.902) (-2619.783) -- 0:07:48 151000 -- [-2621.266] (-2617.378) (-2620.604) (-2623.724) * (-2625.436) (-2624.503) [-2619.230] (-2621.964) -- 0:07:46 151500 -- (-2621.251) [-2623.440] (-2618.620) (-2615.594) * (-2623.233) (-2618.990) [-2617.090] (-2624.765) -- 0:07:44 152000 -- [-2629.222] (-2616.580) (-2619.435) (-2616.701) * (-2634.834) (-2615.326) (-2624.771) [-2618.781] -- 0:07:48 152500 -- [-2622.433] (-2617.627) (-2623.656) (-2622.554) * [-2621.374] (-2628.766) (-2621.787) (-2627.237) -- 0:07:46 153000 -- (-2623.178) (-2620.071) (-2619.159) [-2613.621] * [-2616.408] (-2621.523) (-2618.504) (-2622.022) -- 0:07:45 153500 -- [-2621.148] (-2622.798) (-2621.704) (-2623.745) * (-2625.754) (-2615.441) [-2620.136] (-2621.302) -- 0:07:48 154000 -- [-2612.311] (-2612.798) (-2618.846) (-2628.758) * [-2618.311] (-2616.043) (-2619.126) (-2623.482) -- 0:07:46 154500 -- (-2619.905) (-2620.172) (-2617.687) [-2616.488] * [-2617.378] (-2622.780) (-2621.564) (-2619.391) -- 0:07:45 155000 -- (-2617.890) (-2642.160) [-2627.576] (-2635.130) * (-2621.901) (-2619.284) (-2617.264) [-2616.911] -- 0:07:43 Average standard deviation of split frequencies: 0.018131 155500 -- [-2617.390] (-2623.252) (-2627.190) (-2629.370) * (-2622.697) (-2623.339) (-2623.680) [-2615.382] -- 0:07:47 156000 -- [-2629.150] (-2619.853) (-2627.079) (-2622.326) * (-2619.708) (-2612.392) (-2623.957) [-2618.702] -- 0:07:45 156500 -- [-2616.202] (-2625.301) (-2614.934) (-2617.249) * (-2616.914) (-2617.687) [-2616.639] (-2631.540) -- 0:07:43 157000 -- (-2614.699) [-2618.467] (-2618.578) (-2628.304) * (-2622.402) [-2622.390] (-2622.820) (-2628.472) -- 0:07:47 157500 -- (-2619.597) (-2627.767) (-2627.409) [-2619.483] * (-2621.371) (-2626.383) (-2616.048) [-2618.212] -- 0:07:45 158000 -- [-2621.826] (-2615.622) (-2623.301) (-2631.614) * (-2622.991) (-2619.814) [-2620.966] (-2620.222) -- 0:07:43 158500 -- (-2620.736) (-2620.514) (-2618.788) [-2621.490] * (-2628.926) (-2624.459) (-2615.539) [-2625.405] -- 0:07:41 159000 -- [-2626.737] (-2618.513) (-2622.543) (-2621.195) * [-2625.530] (-2616.639) (-2620.993) (-2626.293) -- 0:07:45 159500 -- (-2625.450) (-2613.059) [-2619.426] (-2621.292) * (-2624.993) (-2618.672) [-2618.530] (-2623.401) -- 0:07:43 160000 -- [-2623.124] (-2618.605) (-2623.010) (-2624.755) * (-2622.217) [-2615.001] (-2621.205) (-2630.380) -- 0:07:42 Average standard deviation of split frequencies: 0.015159 160500 -- (-2621.084) (-2616.888) [-2614.189] (-2623.609) * [-2622.809] (-2618.228) (-2614.350) (-2623.430) -- 0:07:40 161000 -- (-2623.598) [-2616.714] (-2623.886) (-2620.559) * [-2622.319] (-2622.480) (-2618.688) (-2621.596) -- 0:07:43 161500 -- (-2624.689) (-2632.401) [-2625.156] (-2619.127) * (-2622.369) (-2626.021) [-2619.807] (-2625.725) -- 0:07:42 162000 -- (-2616.358) (-2621.645) [-2616.227] (-2630.139) * (-2631.022) (-2614.207) [-2613.817] (-2617.005) -- 0:07:40 162500 -- (-2627.458) (-2624.198) [-2610.550] (-2624.636) * (-2632.987) (-2626.687) [-2616.385] (-2616.886) -- 0:07:43 163000 -- (-2630.175) (-2624.231) (-2610.951) [-2617.463] * (-2636.322) (-2623.138) (-2615.008) [-2615.056] -- 0:07:42 163500 -- (-2626.527) (-2615.568) [-2615.918] (-2623.169) * (-2627.706) (-2626.037) (-2620.691) [-2619.963] -- 0:07:40 164000 -- (-2634.105) [-2618.709] (-2632.758) (-2619.055) * (-2617.712) (-2626.778) [-2616.871] (-2619.807) -- 0:07:38 164500 -- (-2629.672) (-2619.397) [-2619.566] (-2620.302) * (-2622.238) (-2620.664) (-2623.385) [-2614.661] -- 0:07:42 165000 -- [-2623.872] (-2610.441) (-2619.007) (-2626.664) * (-2634.372) [-2615.342] (-2623.818) (-2623.805) -- 0:07:40 Average standard deviation of split frequencies: 0.013016 165500 -- (-2625.569) (-2625.933) [-2622.407] (-2619.253) * (-2632.529) [-2620.093] (-2632.624) (-2627.216) -- 0:07:38 166000 -- (-2626.885) [-2616.453] (-2626.231) (-2624.296) * (-2626.504) [-2611.581] (-2631.802) (-2618.150) -- 0:07:37 166500 -- (-2618.964) (-2616.841) (-2633.095) [-2630.901] * (-2618.209) (-2615.778) [-2621.552] (-2615.493) -- 0:07:40 167000 -- (-2614.727) (-2622.475) [-2621.170] (-2625.163) * (-2619.626) [-2614.944] (-2624.275) (-2624.773) -- 0:07:38 167500 -- (-2616.757) (-2615.939) [-2624.901] (-2621.882) * [-2612.564] (-2615.954) (-2620.259) (-2634.370) -- 0:07:37 168000 -- (-2616.458) (-2619.917) (-2628.081) [-2621.596] * [-2615.375] (-2620.727) (-2624.813) (-2623.705) -- 0:07:40 168500 -- (-2611.401) (-2618.524) (-2625.179) [-2617.139] * (-2618.843) (-2611.737) [-2619.394] (-2623.655) -- 0:07:38 169000 -- (-2616.979) (-2622.083) (-2620.806) [-2617.998] * [-2614.981] (-2629.697) (-2619.520) (-2628.767) -- 0:07:37 169500 -- (-2619.703) (-2622.525) [-2615.534] (-2619.202) * [-2613.515] (-2620.570) (-2616.748) (-2621.691) -- 0:07:35 170000 -- (-2621.607) (-2621.652) (-2619.075) [-2618.502] * (-2627.287) (-2622.994) (-2624.527) [-2622.737] -- 0:07:38 Average standard deviation of split frequencies: 0.014041 170500 -- [-2617.778] (-2624.323) (-2626.508) (-2616.330) * (-2624.698) (-2616.736) [-2621.117] (-2631.811) -- 0:07:37 171000 -- (-2623.829) (-2627.109) [-2613.654] (-2617.794) * (-2620.542) [-2624.060] (-2619.474) (-2625.869) -- 0:07:35 171500 -- (-2619.373) (-2618.977) (-2615.780) [-2612.496] * (-2623.578) (-2621.965) (-2631.175) [-2621.739] -- 0:07:38 172000 -- (-2628.484) [-2610.180] (-2613.757) (-2616.461) * (-2619.224) (-2614.202) (-2619.656) [-2616.605] -- 0:07:37 172500 -- (-2621.658) (-2617.342) (-2619.908) [-2616.128] * (-2619.535) (-2628.424) (-2620.296) [-2613.875] -- 0:07:35 173000 -- (-2620.998) (-2622.124) [-2616.689] (-2620.395) * [-2616.136] (-2614.751) (-2618.654) (-2623.149) -- 0:07:34 173500 -- (-2637.548) (-2628.872) [-2618.078] (-2621.426) * [-2623.992] (-2615.962) (-2627.325) (-2632.776) -- 0:07:37 174000 -- (-2628.502) (-2622.007) [-2623.580] (-2621.617) * (-2622.140) (-2626.548) (-2626.951) [-2624.831] -- 0:07:35 174500 -- (-2627.218) [-2624.635] (-2620.875) (-2622.785) * [-2616.141] (-2619.301) (-2623.241) (-2617.630) -- 0:07:34 175000 -- [-2618.087] (-2623.638) (-2618.035) (-2623.113) * (-2627.573) [-2619.563] (-2629.100) (-2624.761) -- 0:07:37 Average standard deviation of split frequencies: 0.016740 175500 -- (-2626.458) (-2621.537) [-2618.016] (-2617.335) * [-2619.540] (-2623.390) (-2620.838) (-2618.608) -- 0:07:35 176000 -- [-2631.875] (-2615.826) (-2622.329) (-2626.943) * (-2618.809) (-2626.226) (-2620.586) [-2614.876] -- 0:07:34 176500 -- (-2622.440) [-2620.985] (-2628.802) (-2618.294) * (-2622.888) (-2621.917) [-2618.726] (-2620.561) -- 0:07:32 177000 -- (-2622.898) [-2620.850] (-2622.727) (-2615.583) * (-2619.874) (-2624.047) (-2611.604) [-2621.086] -- 0:07:35 177500 -- [-2615.731] (-2634.377) (-2622.959) (-2618.667) * [-2623.419] (-2633.043) (-2622.914) (-2620.025) -- 0:07:34 178000 -- [-2616.708] (-2628.235) (-2621.023) (-2619.947) * (-2621.933) (-2634.520) (-2623.616) [-2617.148] -- 0:07:32 178500 -- (-2619.734) [-2618.092] (-2622.136) (-2620.866) * (-2632.315) (-2618.820) (-2620.365) [-2617.252] -- 0:07:35 179000 -- (-2625.840) (-2622.247) (-2623.257) [-2619.609] * (-2621.477) (-2619.417) (-2620.570) [-2616.523] -- 0:07:34 179500 -- (-2620.473) (-2627.487) [-2610.201] (-2619.075) * (-2627.153) (-2622.703) [-2613.629] (-2616.711) -- 0:07:32 180000 -- (-2629.251) (-2626.276) (-2613.473) [-2620.837] * (-2627.173) (-2620.161) [-2614.308] (-2616.394) -- 0:07:31 Average standard deviation of split frequencies: 0.015438 180500 -- (-2621.405) (-2632.825) [-2615.036] (-2617.119) * (-2621.184) (-2620.945) (-2622.927) [-2612.310] -- 0:07:34 181000 -- [-2623.258] (-2615.410) (-2624.623) (-2622.026) * (-2627.974) (-2631.839) (-2618.104) [-2618.797] -- 0:07:32 181500 -- [-2613.811] (-2626.162) (-2614.867) (-2621.146) * (-2626.902) (-2622.902) [-2614.312] (-2618.970) -- 0:07:30 182000 -- (-2619.678) (-2630.736) (-2635.555) [-2615.584] * (-2621.902) (-2624.620) (-2626.158) [-2620.807] -- 0:07:33 182500 -- [-2615.631] (-2624.744) (-2621.366) (-2620.802) * (-2628.309) [-2621.853] (-2624.549) (-2628.966) -- 0:07:32 183000 -- (-2620.647) [-2616.530] (-2630.226) (-2631.001) * (-2615.274) (-2628.148) [-2619.716] (-2616.426) -- 0:07:30 183500 -- [-2616.891] (-2622.688) (-2624.027) (-2618.150) * [-2613.982] (-2624.271) (-2619.064) (-2618.792) -- 0:07:29 184000 -- (-2623.480) (-2630.186) (-2627.831) [-2614.476] * (-2624.175) (-2625.616) [-2624.166] (-2617.767) -- 0:07:32 184500 -- [-2619.540] (-2615.605) (-2626.547) (-2619.777) * (-2622.979) (-2626.127) (-2620.484) [-2628.332] -- 0:07:30 185000 -- [-2626.209] (-2617.428) (-2617.448) (-2618.593) * (-2618.778) (-2627.795) (-2622.427) [-2616.570] -- 0:07:29 Average standard deviation of split frequencies: 0.014784 185500 -- (-2616.943) (-2615.125) (-2613.827) [-2616.736] * (-2620.614) [-2615.032] (-2626.107) (-2621.824) -- 0:07:27 186000 -- [-2619.157] (-2622.500) (-2614.544) (-2622.806) * (-2623.423) [-2618.520] (-2621.922) (-2634.411) -- 0:07:30 186500 -- (-2622.611) [-2621.362] (-2623.039) (-2635.526) * (-2629.080) [-2617.076] (-2617.191) (-2641.822) -- 0:07:29 187000 -- (-2620.084) (-2621.543) (-2621.544) [-2618.335] * (-2625.154) [-2621.649] (-2626.228) (-2625.785) -- 0:07:27 187500 -- (-2621.318) (-2628.711) [-2619.768] (-2620.640) * [-2619.949] (-2619.043) (-2617.371) (-2621.570) -- 0:07:30 188000 -- (-2620.813) [-2622.467] (-2619.693) (-2611.479) * [-2617.944] (-2612.473) (-2618.184) (-2621.900) -- 0:07:29 188500 -- (-2624.768) (-2623.411) [-2619.890] (-2618.298) * [-2622.404] (-2616.951) (-2619.489) (-2624.097) -- 0:07:27 189000 -- (-2624.333) [-2622.820] (-2623.996) (-2624.176) * (-2620.220) (-2619.478) [-2624.662] (-2620.950) -- 0:07:26 189500 -- (-2627.841) (-2628.952) [-2619.223] (-2629.957) * (-2623.497) (-2620.891) [-2628.391] (-2623.672) -- 0:07:29 190000 -- (-2620.648) [-2622.628] (-2615.010) (-2619.770) * (-2629.321) [-2623.054] (-2616.950) (-2622.245) -- 0:07:27 Average standard deviation of split frequencies: 0.017925 190500 -- (-2617.671) (-2627.455) [-2616.027] (-2629.967) * (-2621.434) (-2619.940) [-2617.192] (-2617.653) -- 0:07:26 191000 -- (-2630.467) (-2630.024) (-2623.153) [-2620.530] * (-2613.675) (-2624.070) (-2623.536) [-2618.224] -- 0:07:24 191500 -- [-2614.678] (-2619.507) (-2628.309) (-2624.270) * (-2624.262) (-2622.457) [-2617.753] (-2619.759) -- 0:07:27 192000 -- (-2620.925) [-2620.595] (-2631.166) (-2619.164) * (-2620.753) [-2620.254] (-2624.949) (-2623.437) -- 0:07:26 192500 -- (-2615.467) [-2616.142] (-2624.713) (-2621.731) * (-2617.371) (-2624.872) (-2620.836) [-2621.364] -- 0:07:24 193000 -- (-2625.857) (-2617.151) (-2631.379) [-2620.539] * [-2619.807] (-2624.029) (-2622.310) (-2621.427) -- 0:07:27 193500 -- (-2623.962) [-2621.225] (-2622.902) (-2619.870) * (-2618.870) (-2633.980) [-2617.323] (-2619.158) -- 0:07:25 194000 -- (-2621.021) (-2617.491) [-2618.834] (-2624.396) * (-2613.501) (-2614.399) [-2627.762] (-2623.627) -- 0:07:24 194500 -- (-2619.028) (-2625.755) [-2622.398] (-2621.246) * [-2612.713] (-2625.298) (-2624.044) (-2621.494) -- 0:07:23 195000 -- (-2616.743) (-2622.320) (-2618.768) [-2615.591] * (-2616.158) (-2624.421) [-2618.498] (-2629.963) -- 0:07:25 Average standard deviation of split frequencies: 0.018439 195500 -- (-2623.531) (-2626.640) [-2615.044] (-2626.439) * [-2615.167] (-2616.170) (-2616.840) (-2622.752) -- 0:07:24 196000 -- (-2618.155) (-2622.733) (-2615.941) [-2616.091] * [-2618.933] (-2617.119) (-2617.204) (-2638.896) -- 0:07:23 196500 -- (-2620.408) (-2628.355) [-2615.680] (-2623.092) * (-2620.151) [-2616.041] (-2620.117) (-2629.158) -- 0:07:25 197000 -- (-2629.029) (-2628.228) (-2616.189) [-2618.971] * (-2626.786) (-2615.754) (-2614.294) [-2619.157] -- 0:07:24 197500 -- (-2623.708) [-2628.676] (-2623.151) (-2620.435) * (-2627.271) [-2620.942] (-2626.333) (-2619.372) -- 0:07:22 198000 -- (-2617.438) (-2619.156) (-2625.373) [-2616.527] * (-2631.983) [-2614.364] (-2622.221) (-2625.712) -- 0:07:21 198500 -- (-2618.772) [-2621.751] (-2614.607) (-2627.486) * (-2623.854) (-2617.358) [-2624.413] (-2633.600) -- 0:07:24 199000 -- [-2617.141] (-2620.548) (-2620.184) (-2626.252) * [-2616.915] (-2616.643) (-2620.295) (-2632.081) -- 0:07:22 199500 -- (-2614.886) (-2622.605) [-2617.820] (-2618.472) * (-2617.189) (-2617.810) [-2614.909] (-2621.213) -- 0:07:21 200000 -- (-2622.377) (-2621.724) [-2619.401] (-2625.751) * (-2620.734) (-2624.055) [-2617.074] (-2622.865) -- 0:07:24 Average standard deviation of split frequencies: 0.015466 200500 -- (-2611.706) [-2619.850] (-2621.007) (-2624.782) * (-2620.845) [-2624.522] (-2619.524) (-2617.829) -- 0:07:22 201000 -- (-2625.550) (-2616.052) (-2621.625) [-2618.759] * (-2629.021) [-2615.769] (-2619.048) (-2619.718) -- 0:07:21 201500 -- [-2619.034] (-2625.651) (-2620.748) (-2621.395) * (-2623.913) [-2612.524] (-2616.241) (-2633.179) -- 0:07:19 202000 -- [-2626.534] (-2618.292) (-2622.335) (-2620.814) * (-2621.549) [-2621.870] (-2616.289) (-2616.300) -- 0:07:22 202500 -- (-2632.583) (-2617.366) [-2614.897] (-2615.599) * [-2625.952] (-2623.499) (-2623.979) (-2621.067) -- 0:07:21 203000 -- (-2614.752) (-2625.329) (-2620.273) [-2612.338] * [-2628.369] (-2618.477) (-2628.685) (-2624.174) -- 0:07:19 203500 -- [-2613.464] (-2624.637) (-2627.854) (-2617.164) * (-2628.307) (-2616.451) [-2618.927] (-2623.123) -- 0:07:18 204000 -- (-2625.233) (-2625.702) (-2634.364) [-2617.662] * [-2619.724] (-2631.058) (-2621.760) (-2624.121) -- 0:07:20 204500 -- [-2612.802] (-2618.753) (-2623.176) (-2626.065) * (-2623.146) (-2631.742) [-2616.621] (-2617.242) -- 0:07:19 205000 -- (-2616.077) (-2623.646) [-2620.580] (-2626.631) * (-2614.569) (-2624.147) [-2618.445] (-2630.188) -- 0:07:18 Average standard deviation of split frequencies: 0.016019 205500 -- (-2616.155) [-2616.986] (-2623.420) (-2625.432) * (-2624.664) (-2622.056) (-2618.418) [-2623.827] -- 0:07:20 206000 -- (-2618.498) [-2619.418] (-2627.100) (-2627.782) * (-2630.445) (-2619.393) (-2618.026) [-2613.367] -- 0:07:19 206500 -- (-2619.287) [-2617.734] (-2626.873) (-2619.107) * (-2623.393) (-2635.759) [-2617.246] (-2616.710) -- 0:07:18 207000 -- (-2624.650) (-2626.674) [-2620.778] (-2619.967) * [-2616.067] (-2631.010) (-2619.580) (-2615.716) -- 0:07:16 207500 -- (-2620.003) [-2627.876] (-2623.180) (-2623.355) * (-2627.212) (-2625.437) [-2617.086] (-2618.096) -- 0:07:19 208000 -- [-2619.089] (-2625.665) (-2623.154) (-2618.000) * (-2623.609) [-2616.632] (-2624.978) (-2623.321) -- 0:07:17 208500 -- [-2618.490] (-2624.723) (-2628.163) (-2623.367) * (-2622.758) (-2618.701) [-2619.526] (-2622.708) -- 0:07:16 209000 -- (-2620.213) (-2616.392) (-2619.145) [-2627.277] * (-2621.707) [-2616.644] (-2624.898) (-2620.556) -- 0:07:19 209500 -- (-2621.291) (-2613.922) [-2613.211] (-2623.014) * [-2617.354] (-2617.214) (-2625.509) (-2624.255) -- 0:07:17 210000 -- (-2619.901) (-2619.903) [-2616.252] (-2626.493) * (-2626.866) (-2616.039) [-2615.510] (-2625.777) -- 0:07:16 Average standard deviation of split frequencies: 0.015477 210500 -- (-2620.276) (-2627.169) (-2618.103) [-2617.965] * [-2620.521] (-2622.443) (-2620.822) (-2626.987) -- 0:07:15 211000 -- (-2621.107) (-2628.845) (-2625.980) [-2621.648] * (-2615.910) (-2623.786) [-2619.651] (-2626.578) -- 0:07:17 211500 -- (-2618.550) (-2620.627) (-2616.397) [-2618.862] * (-2626.189) (-2621.459) (-2622.523) [-2613.306] -- 0:07:16 212000 -- (-2614.899) [-2623.182] (-2624.160) (-2617.270) * (-2627.513) (-2635.576) [-2620.041] (-2619.270) -- 0:07:14 212500 -- [-2618.371] (-2625.769) (-2620.150) (-2625.434) * [-2620.718] (-2619.610) (-2631.237) (-2617.907) -- 0:07:13 213000 -- [-2612.576] (-2621.370) (-2622.844) (-2624.878) * (-2617.256) [-2619.263] (-2617.286) (-2619.681) -- 0:07:15 213500 -- (-2620.967) (-2623.997) (-2630.217) [-2618.193] * (-2620.604) (-2628.052) (-2627.447) [-2617.292] -- 0:07:14 214000 -- (-2621.465) (-2617.334) [-2620.086] (-2613.816) * [-2615.604] (-2620.179) (-2629.440) (-2629.326) -- 0:07:13 214500 -- (-2626.300) (-2622.442) (-2617.724) [-2613.673] * (-2623.280) (-2627.404) (-2623.989) [-2622.033] -- 0:07:15 215000 -- (-2617.309) (-2621.559) (-2622.982) [-2617.421] * [-2623.227] (-2624.361) (-2619.578) (-2618.683) -- 0:07:14 Average standard deviation of split frequencies: 0.013276 215500 -- (-2623.668) (-2628.487) (-2617.587) [-2618.609] * [-2620.546] (-2615.671) (-2633.378) (-2619.400) -- 0:07:13 216000 -- (-2622.913) [-2620.783] (-2616.473) (-2620.677) * (-2625.153) (-2619.226) (-2616.504) [-2615.501] -- 0:07:11 216500 -- (-2623.796) (-2629.056) (-2616.876) [-2624.831] * (-2616.378) (-2618.540) [-2612.023] (-2618.359) -- 0:07:14 217000 -- (-2626.899) (-2631.329) (-2619.155) [-2625.191] * (-2624.729) [-2618.575] (-2618.548) (-2617.550) -- 0:07:12 217500 -- (-2620.369) (-2632.738) (-2619.664) [-2617.752] * (-2621.559) [-2616.189] (-2620.573) (-2631.720) -- 0:07:11 218000 -- (-2617.465) (-2620.018) (-2624.317) [-2619.934] * (-2629.125) [-2619.605] (-2620.567) (-2621.967) -- 0:07:14 218500 -- (-2619.016) (-2614.162) [-2617.925] (-2618.179) * (-2622.515) (-2617.271) [-2616.524] (-2633.676) -- 0:07:12 219000 -- [-2613.639] (-2622.880) (-2629.287) (-2616.278) * (-2629.643) (-2620.606) [-2617.101] (-2627.230) -- 0:07:11 219500 -- [-2615.091] (-2615.917) (-2632.067) (-2621.361) * (-2632.976) (-2612.723) (-2616.602) [-2621.706] -- 0:07:10 220000 -- [-2619.202] (-2622.641) (-2621.314) (-2615.237) * (-2620.057) (-2626.329) (-2612.951) [-2624.247] -- 0:07:12 Average standard deviation of split frequencies: 0.013174 220500 -- [-2617.995] (-2616.055) (-2620.740) (-2614.880) * [-2617.654] (-2619.048) (-2617.996) (-2614.919) -- 0:07:11 221000 -- [-2623.633] (-2624.774) (-2622.492) (-2629.657) * (-2623.300) (-2615.981) [-2616.370] (-2627.975) -- 0:07:10 221500 -- [-2621.107] (-2624.397) (-2626.096) (-2623.795) * [-2615.157] (-2621.914) (-2618.003) (-2615.288) -- 0:07:12 222000 -- (-2617.157) (-2625.316) [-2619.348] (-2624.857) * (-2617.096) (-2621.849) [-2626.873] (-2622.150) -- 0:07:11 222500 -- (-2627.667) [-2614.289] (-2628.494) (-2612.557) * [-2623.077] (-2623.359) (-2622.297) (-2626.216) -- 0:07:09 223000 -- [-2622.073] (-2618.536) (-2622.879) (-2617.828) * (-2619.564) (-2624.284) (-2629.299) [-2621.726] -- 0:07:08 223500 -- (-2619.661) [-2618.065] (-2620.177) (-2620.331) * (-2624.168) (-2623.367) (-2620.927) [-2624.280] -- 0:07:10 224000 -- (-2623.201) (-2625.163) [-2611.964] (-2625.942) * [-2624.294] (-2621.826) (-2619.540) (-2617.054) -- 0:07:09 224500 -- (-2615.526) (-2616.907) [-2616.130] (-2629.241) * (-2613.832) (-2618.288) (-2620.594) [-2624.239] -- 0:07:08 225000 -- (-2626.204) (-2624.415) (-2621.360) [-2622.058] * (-2634.124) (-2621.289) (-2625.385) [-2621.621] -- 0:07:07 Average standard deviation of split frequencies: 0.013210 225500 -- (-2617.607) (-2616.871) (-2619.660) [-2613.822] * (-2627.497) [-2622.871] (-2633.057) (-2623.238) -- 0:07:09 226000 -- (-2624.214) [-2617.312] (-2622.506) (-2622.326) * [-2619.127] (-2616.138) (-2621.074) (-2614.154) -- 0:07:08 226500 -- (-2621.732) (-2616.932) [-2617.218] (-2618.515) * [-2626.243] (-2625.631) (-2622.123) (-2620.842) -- 0:07:06 227000 -- (-2622.425) (-2620.704) [-2614.802] (-2625.942) * (-2616.231) (-2618.576) (-2619.138) [-2623.653] -- 0:07:09 227500 -- (-2617.132) [-2616.461] (-2623.269) (-2617.560) * (-2621.619) (-2633.544) [-2618.597] (-2618.279) -- 0:07:07 228000 -- (-2617.552) (-2629.346) [-2617.906] (-2623.987) * (-2625.473) (-2622.472) (-2631.065) [-2625.158] -- 0:07:06 228500 -- [-2620.878] (-2631.459) (-2616.913) (-2616.522) * (-2625.180) (-2631.853) (-2619.985) [-2631.737] -- 0:07:05 229000 -- [-2617.538] (-2616.729) (-2618.135) (-2622.369) * [-2619.861] (-2617.695) (-2620.424) (-2614.262) -- 0:07:07 229500 -- (-2624.986) (-2617.900) [-2623.524] (-2621.470) * [-2617.560] (-2625.169) (-2625.966) (-2622.269) -- 0:07:06 230000 -- (-2629.408) [-2623.006] (-2626.832) (-2617.924) * (-2615.643) (-2617.808) [-2613.932] (-2625.173) -- 0:07:05 Average standard deviation of split frequencies: 0.013284 230500 -- [-2622.176] (-2622.185) (-2624.600) (-2616.523) * (-2623.109) (-2614.049) [-2615.144] (-2614.052) -- 0:07:07 231000 -- (-2629.591) [-2617.139] (-2623.964) (-2612.386) * (-2624.488) [-2626.543] (-2627.398) (-2622.104) -- 0:07:06 231500 -- (-2625.170) (-2617.939) [-2620.057] (-2625.719) * [-2615.328] (-2626.853) (-2622.497) (-2621.203) -- 0:07:04 232000 -- (-2622.266) [-2612.202] (-2616.904) (-2623.113) * (-2620.128) (-2617.537) [-2615.067] (-2617.030) -- 0:07:03 232500 -- [-2618.761] (-2628.740) (-2634.797) (-2624.515) * [-2618.996] (-2618.510) (-2617.218) (-2624.847) -- 0:07:05 233000 -- (-2624.887) (-2625.547) [-2619.009] (-2623.486) * (-2633.553) (-2632.898) (-2622.925) [-2618.720] -- 0:07:04 233500 -- (-2622.150) (-2627.049) [-2623.234] (-2620.714) * [-2617.355] (-2620.089) (-2632.162) (-2617.986) -- 0:07:03 234000 -- (-2626.248) (-2620.599) [-2611.652] (-2620.263) * (-2623.012) (-2623.092) (-2617.152) [-2621.006] -- 0:07:02 234500 -- (-2619.199) (-2628.717) (-2623.524) [-2625.988] * (-2616.902) (-2628.618) (-2625.239) [-2614.980] -- 0:07:04 235000 -- (-2623.493) (-2622.362) [-2617.913] (-2621.669) * (-2624.341) (-2630.496) [-2625.635] (-2623.534) -- 0:07:03 Average standard deviation of split frequencies: 0.013317 235500 -- (-2622.150) (-2621.755) (-2613.425) [-2610.995] * (-2626.506) [-2641.821] (-2621.463) (-2617.911) -- 0:07:02 236000 -- (-2619.886) (-2614.968) [-2618.405] (-2620.371) * [-2622.304] (-2631.667) (-2622.253) (-2622.893) -- 0:07:04 236500 -- (-2633.788) (-2619.040) [-2618.851] (-2616.006) * (-2612.771) (-2619.542) [-2623.967] (-2622.143) -- 0:07:02 237000 -- (-2623.761) (-2620.064) (-2612.862) [-2620.092] * (-2622.521) [-2620.647] (-2621.044) (-2621.308) -- 0:07:01 237500 -- (-2616.535) (-2619.725) [-2611.646] (-2619.548) * (-2643.656) (-2623.156) (-2617.658) [-2613.491] -- 0:07:00 238000 -- (-2629.121) (-2635.977) [-2617.543] (-2621.504) * (-2619.830) (-2619.840) (-2626.813) [-2616.317] -- 0:07:02 238500 -- (-2614.935) (-2627.502) [-2617.318] (-2621.820) * (-2616.677) [-2619.356] (-2625.829) (-2615.346) -- 0:07:01 239000 -- (-2617.042) (-2621.595) [-2617.308] (-2628.083) * (-2615.638) [-2619.300] (-2622.643) (-2624.136) -- 0:07:00 239500 -- [-2615.614] (-2615.781) (-2622.537) (-2623.237) * (-2617.193) [-2618.503] (-2622.878) (-2616.606) -- 0:07:02 240000 -- (-2613.818) [-2617.604] (-2622.251) (-2623.963) * (-2626.838) [-2615.324] (-2619.882) (-2624.514) -- 0:07:01 Average standard deviation of split frequencies: 0.011752 240500 -- [-2621.614] (-2618.225) (-2620.856) (-2622.788) * (-2623.090) (-2615.124) [-2622.398] (-2619.150) -- 0:07:00 241000 -- (-2623.615) [-2617.209] (-2614.332) (-2621.479) * (-2608.862) (-2627.977) (-2626.097) [-2619.775] -- 0:06:58 241500 -- (-2627.505) (-2621.036) [-2622.284] (-2619.425) * (-2613.927) (-2621.756) [-2616.036] (-2627.057) -- 0:07:00 242000 -- (-2619.445) [-2617.015] (-2623.710) (-2621.502) * (-2627.321) (-2617.179) (-2623.104) [-2621.693] -- 0:06:59 242500 -- [-2614.191] (-2624.379) (-2628.387) (-2619.652) * [-2615.510] (-2629.390) (-2623.168) (-2617.338) -- 0:06:58 243000 -- (-2618.544) [-2614.659] (-2618.176) (-2620.975) * (-2628.654) [-2621.952] (-2612.505) (-2624.467) -- 0:07:00 243500 -- [-2618.567] (-2622.933) (-2615.807) (-2622.974) * (-2627.705) [-2621.250] (-2618.045) (-2630.366) -- 0:06:59 244000 -- (-2624.607) (-2619.285) [-2619.101] (-2624.543) * (-2629.491) (-2623.266) [-2615.454] (-2631.283) -- 0:06:58 244500 -- (-2625.998) (-2619.399) (-2618.601) [-2612.651] * (-2614.984) (-2634.179) [-2622.059] (-2618.618) -- 0:06:57 245000 -- (-2618.140) [-2618.010] (-2618.455) (-2618.644) * (-2616.597) (-2617.270) [-2623.880] (-2634.365) -- 0:06:59 Average standard deviation of split frequencies: 0.011657 245500 -- (-2625.323) (-2620.445) (-2617.846) [-2614.116] * (-2620.323) (-2617.539) (-2626.415) [-2623.390] -- 0:06:57 246000 -- (-2618.945) [-2618.562] (-2620.328) (-2616.734) * [-2613.778] (-2622.835) (-2624.156) (-2616.913) -- 0:06:56 246500 -- [-2619.949] (-2620.017) (-2624.042) (-2618.808) * (-2623.861) (-2615.870) [-2618.437] (-2616.989) -- 0:06:55 247000 -- (-2618.822) (-2617.325) [-2619.575] (-2613.625) * (-2619.783) (-2627.114) [-2618.009] (-2629.543) -- 0:06:57 247500 -- (-2613.628) [-2624.012] (-2618.169) (-2617.185) * (-2618.983) [-2617.956] (-2622.634) (-2620.679) -- 0:06:56 248000 -- [-2617.271] (-2616.093) (-2625.878) (-2625.456) * (-2617.734) (-2620.800) (-2636.017) [-2617.625] -- 0:06:55 248500 -- (-2624.075) (-2614.506) [-2618.375] (-2625.061) * (-2625.624) [-2622.855] (-2625.137) (-2621.639) -- 0:06:57 249000 -- (-2620.479) (-2623.182) (-2612.095) [-2618.640] * (-2618.349) (-2622.314) (-2626.487) [-2628.170] -- 0:06:56 249500 -- [-2618.428] (-2629.593) (-2620.578) (-2619.829) * (-2624.022) (-2625.840) (-2627.893) [-2617.752] -- 0:06:55 250000 -- (-2623.788) (-2623.322) (-2621.509) [-2628.187] * (-2632.878) (-2619.056) (-2620.278) [-2619.204] -- 0:06:54 Average standard deviation of split frequencies: 0.012381 250500 -- (-2621.640) (-2613.200) (-2629.212) [-2615.912] * (-2621.970) [-2619.568] (-2623.296) (-2623.081) -- 0:06:55 251000 -- (-2628.081) [-2616.636] (-2631.677) (-2633.144) * (-2624.214) (-2616.723) [-2617.258] (-2625.517) -- 0:06:54 251500 -- (-2625.599) (-2619.826) (-2616.207) [-2615.965] * (-2619.666) (-2620.948) [-2625.970] (-2616.407) -- 0:06:53 252000 -- (-2622.655) [-2617.561] (-2626.691) (-2612.153) * [-2618.816] (-2619.456) (-2619.116) (-2619.267) -- 0:06:55 252500 -- (-2622.545) (-2614.254) [-2618.521] (-2610.166) * (-2627.087) (-2626.774) (-2625.166) [-2621.413] -- 0:06:54 253000 -- (-2615.570) [-2617.347] (-2618.253) (-2630.299) * (-2622.475) (-2620.841) (-2623.198) [-2615.643] -- 0:06:53 253500 -- (-2618.295) [-2618.084] (-2615.427) (-2628.664) * [-2618.498] (-2619.204) (-2624.605) (-2620.427) -- 0:06:52 254000 -- (-2627.469) [-2614.644] (-2617.328) (-2626.891) * (-2618.451) (-2614.928) [-2613.172] (-2626.555) -- 0:06:54 254500 -- (-2625.617) [-2626.230] (-2625.016) (-2622.462) * (-2620.031) [-2618.814] (-2620.766) (-2626.320) -- 0:06:53 255000 -- (-2638.570) (-2620.546) [-2617.947] (-2626.808) * (-2619.059) [-2619.605] (-2620.991) (-2617.851) -- 0:06:51 Average standard deviation of split frequencies: 0.012430 255500 -- (-2622.245) (-2619.113) [-2620.017] (-2630.646) * (-2623.804) [-2612.307] (-2618.305) (-2620.875) -- 0:06:50 256000 -- (-2616.893) [-2618.974] (-2615.912) (-2626.250) * (-2630.894) (-2623.989) [-2622.162] (-2619.579) -- 0:06:52 256500 -- (-2621.438) (-2614.583) (-2618.003) [-2622.592] * (-2619.927) (-2628.490) (-2612.515) [-2621.708] -- 0:06:51 257000 -- (-2623.195) [-2618.830] (-2612.156) (-2628.757) * (-2617.467) (-2616.993) (-2617.804) [-2617.124] -- 0:06:50 257500 -- (-2616.870) [-2620.866] (-2627.314) (-2618.489) * (-2626.126) [-2624.621] (-2629.218) (-2632.013) -- 0:06:52 258000 -- (-2620.096) [-2613.834] (-2617.513) (-2616.438) * [-2620.333] (-2613.820) (-2638.542) (-2624.759) -- 0:06:51 258500 -- [-2616.122] (-2617.998) (-2626.645) (-2623.561) * [-2618.923] (-2619.983) (-2625.059) (-2624.139) -- 0:06:50 259000 -- (-2624.156) (-2619.101) [-2617.509] (-2627.528) * [-2623.817] (-2618.895) (-2618.438) (-2622.858) -- 0:06:49 259500 -- (-2613.804) (-2625.886) [-2617.791] (-2619.495) * (-2622.263) (-2615.580) [-2616.662] (-2624.662) -- 0:06:50 260000 -- (-2619.691) (-2620.213) (-2623.920) [-2622.927] * (-2618.877) [-2617.432] (-2613.598) (-2626.868) -- 0:06:49 Average standard deviation of split frequencies: 0.013865 260500 -- (-2620.974) (-2625.560) [-2616.357] (-2622.615) * [-2625.796] (-2617.421) (-2624.503) (-2619.178) -- 0:06:48 261000 -- (-2623.535) [-2619.395] (-2622.059) (-2621.077) * (-2630.913) [-2614.660] (-2613.769) (-2621.261) -- 0:06:50 261500 -- [-2616.922] (-2616.828) (-2621.520) (-2626.964) * [-2625.133] (-2623.482) (-2622.759) (-2616.852) -- 0:06:49 262000 -- (-2623.791) (-2616.634) (-2619.027) [-2620.928] * (-2623.193) [-2617.838] (-2620.730) (-2624.485) -- 0:06:48 262500 -- [-2623.946] (-2624.819) (-2615.979) (-2615.607) * (-2619.245) [-2615.555] (-2625.494) (-2620.681) -- 0:06:47 263000 -- [-2617.448] (-2632.282) (-2616.455) (-2619.093) * (-2622.528) (-2612.953) [-2618.033] (-2614.594) -- 0:06:49 263500 -- [-2618.673] (-2620.329) (-2633.575) (-2626.537) * (-2619.088) [-2616.716] (-2631.002) (-2620.935) -- 0:06:48 264000 -- [-2617.454] (-2618.428) (-2625.318) (-2622.985) * [-2625.408] (-2619.497) (-2615.843) (-2613.948) -- 0:06:47 264500 -- (-2617.271) [-2624.769] (-2636.331) (-2634.308) * (-2621.725) (-2635.019) [-2617.815] (-2618.661) -- 0:06:45 265000 -- [-2624.693] (-2632.399) (-2615.834) (-2621.801) * (-2624.686) (-2644.168) [-2622.418] (-2623.169) -- 0:06:47 Average standard deviation of split frequencies: 0.013882 265500 -- (-2631.014) (-2634.461) [-2615.203] (-2635.388) * (-2619.047) (-2625.046) (-2627.618) [-2615.632] -- 0:06:46 266000 -- [-2619.707] (-2618.879) (-2617.149) (-2627.562) * (-2616.782) (-2625.731) [-2618.811] (-2622.481) -- 0:06:45 266500 -- (-2634.171) (-2621.546) (-2625.308) [-2612.227] * (-2625.791) (-2617.720) [-2624.795] (-2626.942) -- 0:06:47 267000 -- (-2620.799) (-2619.207) (-2619.982) [-2613.105] * (-2622.889) [-2625.309] (-2625.391) (-2624.042) -- 0:06:46 267500 -- (-2616.422) (-2623.451) [-2618.838] (-2624.271) * (-2626.281) (-2617.430) (-2627.940) [-2615.969] -- 0:06:45 268000 -- [-2621.444] (-2623.464) (-2625.558) (-2622.165) * (-2622.560) [-2616.759] (-2628.382) (-2626.490) -- 0:06:46 268500 -- (-2619.278) (-2620.807) [-2612.381] (-2614.893) * (-2636.133) [-2624.056] (-2623.119) (-2622.638) -- 0:06:45 269000 -- (-2614.705) (-2627.557) [-2614.120] (-2614.451) * (-2616.675) [-2619.507] (-2623.057) (-2620.373) -- 0:06:44 269500 -- (-2617.426) (-2618.403) (-2613.442) [-2619.022] * (-2620.915) (-2617.073) (-2621.675) [-2615.029] -- 0:06:43 270000 -- (-2619.547) (-2626.581) (-2617.234) [-2618.643] * (-2621.035) [-2620.380] (-2631.952) (-2622.951) -- 0:06:45 Average standard deviation of split frequencies: 0.011611 270500 -- (-2619.676) (-2619.542) [-2612.976] (-2616.515) * (-2619.431) (-2630.604) [-2615.843] (-2629.769) -- 0:06:44 271000 -- (-2620.371) (-2627.644) [-2613.544] (-2626.523) * [-2620.147] (-2616.384) (-2628.107) (-2624.038) -- 0:06:43 271500 -- (-2625.681) (-2613.916) [-2619.833] (-2625.873) * [-2617.144] (-2617.065) (-2626.659) (-2619.133) -- 0:06:45 272000 -- (-2615.793) (-2623.005) [-2620.145] (-2625.144) * [-2617.428] (-2624.464) (-2618.044) (-2616.875) -- 0:06:44 272500 -- (-2620.712) (-2624.128) (-2614.851) [-2625.354] * (-2620.790) (-2626.829) (-2615.988) [-2628.266] -- 0:06:43 273000 -- [-2618.833] (-2619.924) (-2621.853) (-2623.471) * (-2634.001) [-2626.290] (-2619.056) (-2627.921) -- 0:06:44 273500 -- (-2618.354) (-2619.383) (-2629.262) [-2614.466] * (-2622.861) (-2619.039) (-2620.131) [-2622.173] -- 0:06:43 274000 -- (-2621.041) (-2626.547) [-2617.882] (-2624.834) * (-2621.912) (-2617.506) (-2619.045) [-2618.420] -- 0:06:42 274500 -- [-2619.946] (-2620.010) (-2622.408) (-2622.915) * (-2616.935) (-2624.536) (-2619.979) [-2617.593] -- 0:06:44 275000 -- (-2617.488) (-2619.228) (-2624.080) [-2619.710] * (-2625.944) [-2615.354] (-2620.511) (-2624.677) -- 0:06:43 Average standard deviation of split frequencies: 0.013237 275500 -- [-2618.846] (-2619.050) (-2621.391) (-2618.515) * [-2620.270] (-2613.969) (-2619.347) (-2618.987) -- 0:06:42 276000 -- [-2618.400] (-2626.603) (-2628.143) (-2623.750) * (-2620.071) (-2624.508) [-2617.974] (-2615.812) -- 0:06:41 276500 -- (-2631.466) (-2620.095) [-2622.316] (-2620.207) * (-2624.172) (-2619.976) [-2622.426] (-2625.811) -- 0:06:42 277000 -- (-2625.691) [-2623.392] (-2614.975) (-2629.451) * (-2638.548) (-2618.401) (-2616.892) [-2625.775] -- 0:06:41 277500 -- (-2620.066) (-2623.899) [-2616.675] (-2622.184) * (-2622.022) [-2618.257] (-2617.947) (-2632.986) -- 0:06:40 278000 -- (-2618.744) (-2622.060) (-2618.064) [-2614.435] * (-2622.483) [-2616.450] (-2621.392) (-2630.065) -- 0:06:42 278500 -- (-2623.353) (-2623.867) [-2619.858] (-2623.764) * (-2629.876) (-2617.463) (-2631.475) [-2616.897] -- 0:06:41 279000 -- (-2617.871) (-2623.602) (-2618.291) [-2620.929] * (-2637.137) [-2614.963] (-2620.158) (-2626.117) -- 0:06:40 279500 -- (-2615.535) [-2622.372] (-2623.122) (-2624.180) * (-2620.111) (-2618.362) [-2621.939] (-2623.765) -- 0:06:42 280000 -- (-2616.843) (-2618.628) [-2618.639] (-2624.524) * (-2625.378) (-2630.248) (-2617.260) [-2618.686] -- 0:06:41 Average standard deviation of split frequencies: 0.012877 280500 -- (-2615.079) (-2623.035) [-2622.844] (-2621.008) * (-2627.370) (-2621.070) [-2609.681] (-2618.790) -- 0:06:40 281000 -- (-2620.468) [-2617.701] (-2627.705) (-2617.713) * (-2643.814) [-2620.795] (-2621.408) (-2624.606) -- 0:06:39 281500 -- (-2617.550) [-2625.303] (-2621.865) (-2623.804) * (-2627.878) [-2624.941] (-2625.213) (-2631.361) -- 0:06:40 282000 -- (-2619.915) [-2622.671] (-2617.508) (-2619.230) * (-2623.807) (-2624.067) [-2622.922] (-2637.887) -- 0:06:39 282500 -- (-2624.917) (-2618.599) (-2624.832) [-2619.001] * [-2615.961] (-2631.212) (-2622.855) (-2616.134) -- 0:06:38 283000 -- [-2622.514] (-2627.552) (-2624.843) (-2614.781) * [-2617.812] (-2628.177) (-2628.056) (-2621.640) -- 0:06:40 283500 -- (-2619.068) (-2622.594) [-2624.071] (-2616.095) * [-2617.782] (-2625.707) (-2625.437) (-2615.488) -- 0:06:39 284000 -- (-2618.638) (-2620.624) (-2627.031) [-2614.729] * (-2615.182) [-2621.746] (-2622.473) (-2616.701) -- 0:06:38 284500 -- [-2616.918] (-2617.486) (-2625.342) (-2628.713) * (-2615.210) (-2622.346) (-2626.867) [-2620.185] -- 0:06:37 285000 -- (-2624.194) [-2617.107] (-2631.245) (-2622.107) * [-2621.068] (-2616.894) (-2620.602) (-2617.212) -- 0:06:38 Average standard deviation of split frequencies: 0.012225 285500 -- (-2618.916) [-2623.634] (-2627.942) (-2627.057) * (-2622.410) [-2620.018] (-2631.715) (-2618.100) -- 0:06:37 286000 -- (-2627.785) (-2616.870) [-2629.792] (-2626.710) * (-2622.335) (-2621.888) (-2617.419) [-2616.868] -- 0:06:36 286500 -- (-2624.593) (-2619.702) (-2619.429) [-2623.171] * (-2627.297) (-2615.460) [-2621.560] (-2617.911) -- 0:06:38 287000 -- (-2622.532) [-2615.397] (-2621.075) (-2613.861) * (-2621.293) [-2616.573] (-2618.022) (-2618.841) -- 0:06:37 287500 -- (-2627.220) (-2622.904) [-2615.301] (-2613.955) * [-2617.402] (-2626.163) (-2620.120) (-2619.602) -- 0:06:36 288000 -- (-2624.679) (-2629.809) [-2617.000] (-2618.770) * (-2622.218) (-2615.352) [-2619.098] (-2621.173) -- 0:06:35 288500 -- (-2625.273) [-2623.641] (-2620.662) (-2629.655) * (-2624.089) (-2614.509) [-2612.654] (-2615.182) -- 0:06:37 289000 -- (-2617.102) (-2627.368) [-2616.668] (-2620.122) * (-2631.631) (-2617.792) (-2619.892) [-2622.079] -- 0:06:36 289500 -- (-2624.372) [-2619.576] (-2621.488) (-2618.686) * [-2623.609] (-2612.330) (-2618.629) (-2618.959) -- 0:06:35 290000 -- (-2626.438) [-2622.870] (-2614.144) (-2618.681) * [-2618.981] (-2620.882) (-2620.839) (-2613.647) -- 0:06:34 Average standard deviation of split frequencies: 0.011893 290500 -- (-2621.238) (-2627.508) [-2619.962] (-2620.987) * (-2628.744) (-2623.484) [-2617.961] (-2627.491) -- 0:06:35 291000 -- [-2615.624] (-2625.341) (-2615.714) (-2625.523) * (-2635.105) (-2616.760) (-2624.187) [-2619.151] -- 0:06:34 291500 -- [-2620.212] (-2614.791) (-2618.360) (-2618.333) * (-2640.307) [-2617.144] (-2619.775) (-2632.720) -- 0:06:33 292000 -- (-2623.679) [-2621.558] (-2631.951) (-2627.676) * (-2623.174) [-2611.643] (-2623.039) (-2627.037) -- 0:06:35 292500 -- (-2624.522) (-2621.726) (-2624.752) [-2624.905] * [-2619.630] (-2620.575) (-2620.826) (-2624.471) -- 0:06:34 293000 -- (-2627.758) (-2617.422) [-2617.766] (-2621.870) * (-2625.967) [-2614.981] (-2615.737) (-2623.057) -- 0:06:33 293500 -- (-2618.855) (-2626.087) (-2621.625) [-2626.438] * [-2622.429] (-2625.593) (-2613.647) (-2626.411) -- 0:06:32 294000 -- (-2626.670) [-2625.667] (-2620.524) (-2620.854) * (-2630.738) [-2617.235] (-2627.256) (-2626.217) -- 0:06:33 294500 -- (-2618.268) [-2615.127] (-2617.243) (-2618.248) * [-2614.604] (-2621.954) (-2622.515) (-2617.519) -- 0:06:32 295000 -- (-2635.264) [-2618.790] (-2619.426) (-2620.836) * (-2617.495) [-2620.264] (-2627.047) (-2616.938) -- 0:06:31 Average standard deviation of split frequencies: 0.013272 295500 -- [-2619.823] (-2614.239) (-2620.022) (-2629.041) * (-2618.396) (-2613.568) (-2625.371) [-2612.355] -- 0:06:33 296000 -- (-2623.697) (-2609.886) [-2620.325] (-2620.347) * (-2623.199) (-2622.765) [-2612.202] (-2619.266) -- 0:06:32 296500 -- (-2630.907) (-2615.824) (-2625.225) [-2621.389] * (-2617.095) (-2619.310) (-2617.637) [-2619.007] -- 0:06:31 297000 -- (-2614.086) [-2615.392] (-2630.579) (-2627.720) * (-2620.158) (-2620.767) [-2617.459] (-2618.210) -- 0:06:30 297500 -- (-2620.181) (-2624.179) [-2615.422] (-2620.366) * (-2624.842) (-2615.421) (-2611.460) [-2621.549] -- 0:06:31 298000 -- (-2615.232) (-2623.516) (-2617.613) [-2617.724] * [-2618.100] (-2616.091) (-2614.709) (-2624.182) -- 0:06:31 298500 -- (-2616.481) (-2618.098) (-2623.133) [-2621.215] * (-2634.634) (-2621.908) [-2622.014] (-2626.989) -- 0:06:30 299000 -- (-2622.151) (-2628.741) [-2619.981] (-2617.375) * [-2621.956] (-2614.885) (-2619.836) (-2629.879) -- 0:06:31 299500 -- (-2619.694) [-2620.309] (-2625.444) (-2622.145) * (-2625.476) (-2619.601) [-2621.610] (-2619.458) -- 0:06:30 300000 -- [-2616.007] (-2617.720) (-2628.381) (-2629.982) * (-2620.869) (-2625.869) (-2630.167) [-2620.083] -- 0:06:29 Average standard deviation of split frequencies: 0.013066 300500 -- [-2618.108] (-2614.360) (-2621.296) (-2620.566) * [-2621.349] (-2620.632) (-2619.863) (-2618.268) -- 0:06:28 301000 -- (-2620.777) (-2621.528) (-2626.946) [-2618.903] * [-2617.929] (-2625.943) (-2619.552) (-2614.743) -- 0:06:30 301500 -- [-2614.526] (-2624.370) (-2618.531) (-2621.745) * (-2621.487) (-2618.542) [-2620.601] (-2620.535) -- 0:06:29 302000 -- (-2623.556) (-2614.918) [-2624.442] (-2621.626) * (-2620.485) (-2626.447) (-2620.948) [-2617.280] -- 0:06:28 302500 -- (-2626.619) (-2625.364) (-2621.589) [-2621.300] * (-2620.492) [-2615.871] (-2618.511) (-2627.302) -- 0:06:29 303000 -- (-2622.473) (-2623.132) [-2616.968] (-2621.960) * (-2616.551) (-2623.031) [-2610.882] (-2619.263) -- 0:06:28 303500 -- [-2624.249] (-2626.901) (-2620.757) (-2620.859) * [-2618.690] (-2621.089) (-2623.636) (-2619.494) -- 0:06:27 304000 -- (-2627.175) [-2628.093] (-2616.832) (-2626.260) * (-2619.535) (-2615.761) [-2617.315] (-2621.958) -- 0:06:26 304500 -- (-2621.458) [-2620.893] (-2619.616) (-2628.210) * (-2621.242) (-2628.739) (-2620.903) [-2612.729] -- 0:06:28 305000 -- [-2613.925] (-2619.258) (-2619.120) (-2623.937) * (-2616.673) (-2624.809) [-2616.205] (-2615.481) -- 0:06:27 Average standard deviation of split frequencies: 0.012581 305500 -- [-2614.512] (-2617.222) (-2630.243) (-2638.905) * (-2615.073) [-2625.528] (-2619.778) (-2613.747) -- 0:06:26 306000 -- [-2616.073] (-2622.742) (-2626.922) (-2635.105) * (-2616.433) (-2632.867) [-2614.960] (-2616.765) -- 0:06:25 306500 -- (-2620.402) (-2622.111) [-2615.764] (-2628.130) * (-2614.315) [-2618.593] (-2629.073) (-2631.532) -- 0:06:26 307000 -- (-2624.565) (-2618.918) [-2616.913] (-2631.212) * (-2614.901) (-2621.527) (-2624.157) [-2621.831] -- 0:06:26 307500 -- [-2620.313] (-2620.619) (-2624.671) (-2625.085) * [-2619.170] (-2629.060) (-2629.990) (-2617.889) -- 0:06:25 308000 -- (-2623.506) (-2624.198) [-2617.292] (-2619.046) * [-2625.751] (-2629.495) (-2616.130) (-2618.151) -- 0:06:26 308500 -- (-2619.382) (-2619.973) (-2614.035) [-2618.683] * (-2621.315) (-2625.126) [-2623.963] (-2616.833) -- 0:06:25 309000 -- (-2621.951) [-2616.310] (-2619.856) (-2618.957) * (-2615.423) (-2625.251) (-2615.270) [-2616.049] -- 0:06:24 309500 -- [-2619.872] (-2622.979) (-2619.324) (-2623.530) * (-2626.685) [-2622.980] (-2624.968) (-2619.064) -- 0:06:23 310000 -- (-2615.366) (-2626.345) [-2619.132] (-2621.139) * [-2618.511] (-2631.791) (-2616.821) (-2617.385) -- 0:06:25 Average standard deviation of split frequencies: 0.013404 310500 -- [-2617.089] (-2637.263) (-2624.313) (-2628.921) * (-2621.143) (-2626.783) (-2626.302) [-2620.571] -- 0:06:24 311000 -- (-2619.569) (-2615.356) [-2617.492] (-2623.624) * (-2623.901) (-2620.161) [-2616.382] (-2619.990) -- 0:06:23 311500 -- (-2629.562) (-2625.765) (-2620.911) [-2615.639] * (-2621.526) (-2627.164) (-2613.669) [-2615.627] -- 0:06:24 312000 -- (-2625.271) (-2618.784) [-2613.326] (-2622.252) * (-2623.418) (-2614.412) [-2610.544] (-2621.133) -- 0:06:23 312500 -- (-2618.584) (-2618.386) [-2610.262] (-2620.810) * (-2622.455) (-2617.386) [-2617.618] (-2615.631) -- 0:06:22 313000 -- [-2617.175] (-2630.617) (-2620.322) (-2624.772) * (-2619.918) [-2618.710] (-2625.723) (-2621.317) -- 0:06:21 313500 -- (-2620.001) (-2617.452) (-2623.792) [-2622.088] * (-2618.178) [-2615.565] (-2626.085) (-2620.702) -- 0:06:23 314000 -- (-2621.411) (-2611.747) [-2618.932] (-2631.934) * [-2621.349] (-2618.108) (-2622.722) (-2623.212) -- 0:06:22 314500 -- (-2618.121) (-2622.173) [-2617.661] (-2626.376) * (-2620.214) (-2620.695) [-2617.486] (-2617.274) -- 0:06:21 315000 -- [-2615.985] (-2620.549) (-2625.779) (-2616.522) * [-2624.398] (-2626.031) (-2620.746) (-2616.148) -- 0:06:22 Average standard deviation of split frequencies: 0.012059 315500 -- (-2614.773) (-2624.960) [-2620.601] (-2614.684) * (-2617.473) [-2619.929] (-2616.031) (-2625.176) -- 0:06:21 316000 -- (-2623.458) [-2620.541] (-2611.659) (-2635.144) * (-2629.974) (-2617.165) [-2617.287] (-2621.524) -- 0:06:20 316500 -- [-2625.171] (-2615.325) (-2616.559) (-2623.692) * (-2618.225) [-2621.236] (-2621.824) (-2626.061) -- 0:06:20 317000 -- (-2618.910) (-2613.924) (-2627.417) [-2616.766] * [-2618.281] (-2627.261) (-2620.694) (-2617.560) -- 0:06:21 317500 -- (-2620.287) (-2620.771) [-2617.632] (-2618.895) * (-2623.902) [-2616.790] (-2619.359) (-2616.757) -- 0:06:20 318000 -- [-2623.202] (-2615.335) (-2626.911) (-2623.826) * (-2621.890) [-2614.256] (-2624.553) (-2626.220) -- 0:06:19 318500 -- (-2627.426) (-2619.712) (-2625.810) [-2617.604] * (-2617.317) (-2613.960) (-2622.577) [-2620.192] -- 0:06:18 319000 -- [-2624.049] (-2625.164) (-2627.169) (-2621.983) * [-2620.304] (-2615.085) (-2620.509) (-2627.798) -- 0:06:19 319500 -- (-2621.697) (-2618.547) (-2618.326) [-2620.299] * (-2617.445) [-2621.643] (-2632.664) (-2620.070) -- 0:06:19 320000 -- (-2624.840) (-2621.380) (-2629.904) [-2623.462] * (-2620.271) (-2617.099) (-2622.965) [-2615.732] -- 0:06:18 Average standard deviation of split frequencies: 0.012373 320500 -- (-2613.415) (-2626.851) [-2621.176] (-2612.617) * [-2616.799] (-2621.263) (-2632.960) (-2619.114) -- 0:06:19 321000 -- (-2616.666) (-2617.877) [-2612.736] (-2616.711) * (-2620.094) (-2616.115) (-2631.972) [-2614.775] -- 0:06:18 321500 -- (-2621.653) (-2620.617) [-2620.242] (-2617.305) * (-2631.103) [-2624.402] (-2614.820) (-2619.838) -- 0:06:17 322000 -- (-2617.318) [-2614.114] (-2615.531) (-2631.434) * [-2616.782] (-2612.965) (-2631.806) (-2620.945) -- 0:06:16 322500 -- (-2618.744) (-2619.294) [-2618.050] (-2628.562) * (-2615.162) (-2612.468) (-2620.814) [-2623.059] -- 0:06:18 323000 -- (-2617.083) (-2623.414) (-2627.514) [-2622.931] * [-2622.497] (-2620.169) (-2619.572) (-2616.629) -- 0:06:17 323500 -- (-2622.888) [-2619.461] (-2622.586) (-2615.554) * (-2625.920) (-2626.486) (-2627.180) [-2621.359] -- 0:06:16 324000 -- (-2619.191) (-2624.885) [-2619.967] (-2618.967) * [-2620.521] (-2617.029) (-2627.740) (-2621.531) -- 0:06:17 324500 -- (-2624.314) [-2627.520] (-2621.805) (-2623.903) * (-2620.402) [-2615.434] (-2624.941) (-2624.053) -- 0:06:16 325000 -- (-2624.391) (-2622.334) (-2621.435) [-2625.220] * (-2620.077) (-2631.899) (-2619.569) [-2622.119] -- 0:06:15 Average standard deviation of split frequencies: 0.012653 325500 -- (-2631.161) [-2620.446] (-2620.653) (-2627.023) * (-2617.490) (-2624.404) [-2624.311] (-2615.833) -- 0:06:15 326000 -- (-2619.964) [-2615.115] (-2619.848) (-2623.535) * (-2614.512) (-2633.940) [-2621.768] (-2626.115) -- 0:06:16 326500 -- [-2619.458] (-2624.358) (-2634.743) (-2625.633) * (-2620.068) (-2619.585) [-2630.895] (-2622.533) -- 0:06:15 327000 -- [-2607.988] (-2628.530) (-2632.908) (-2638.070) * [-2619.123] (-2616.328) (-2620.000) (-2625.411) -- 0:06:14 327500 -- [-2612.819] (-2625.537) (-2631.700) (-2632.195) * (-2617.736) [-2613.900] (-2616.669) (-2619.916) -- 0:06:15 328000 -- (-2612.917) [-2611.799] (-2626.409) (-2632.895) * (-2621.901) [-2615.956] (-2620.942) (-2619.221) -- 0:06:14 328500 -- (-2624.098) (-2619.029) (-2626.954) [-2618.734] * (-2615.235) (-2625.539) [-2617.147] (-2614.389) -- 0:06:14 329000 -- (-2627.115) [-2616.020] (-2619.111) (-2617.847) * (-2617.773) (-2630.879) [-2617.565] (-2617.314) -- 0:06:13 329500 -- (-2618.325) [-2617.878] (-2620.099) (-2620.555) * (-2614.762) (-2622.235) [-2624.380] (-2616.846) -- 0:06:14 330000 -- [-2614.784] (-2619.053) (-2625.120) (-2617.998) * (-2617.851) (-2630.006) (-2615.154) [-2623.124] -- 0:06:13 Average standard deviation of split frequencies: 0.012831 330500 -- (-2614.996) (-2619.003) (-2631.640) [-2611.464] * (-2622.517) (-2625.038) (-2625.063) [-2618.623] -- 0:06:12 331000 -- [-2619.289] (-2622.439) (-2625.945) (-2631.958) * [-2617.580] (-2622.660) (-2634.353) (-2619.749) -- 0:06:13 331500 -- (-2621.914) (-2622.583) [-2613.574] (-2618.604) * (-2621.016) [-2619.126] (-2631.429) (-2621.887) -- 0:06:13 332000 -- [-2627.991] (-2621.760) (-2618.484) (-2615.773) * [-2623.613] (-2625.423) (-2621.963) (-2618.328) -- 0:06:12 332500 -- (-2635.546) (-2628.268) (-2620.900) [-2617.378] * (-2622.295) (-2631.553) (-2638.983) [-2613.448] -- 0:06:11 333000 -- (-2615.299) [-2622.108] (-2618.194) (-2627.229) * [-2624.375] (-2622.672) (-2631.584) (-2619.834) -- 0:06:12 333500 -- [-2614.515] (-2629.699) (-2617.809) (-2620.605) * (-2620.412) (-2627.980) (-2618.456) [-2616.235] -- 0:06:11 334000 -- (-2616.927) [-2621.567] (-2620.453) (-2622.337) * (-2628.267) [-2617.934] (-2618.139) (-2633.603) -- 0:06:10 334500 -- (-2613.484) (-2620.170) (-2629.082) [-2617.648] * (-2630.451) [-2617.912] (-2618.956) (-2620.466) -- 0:06:10 335000 -- [-2614.155] (-2622.442) (-2617.267) (-2626.042) * [-2620.891] (-2620.454) (-2624.445) (-2634.379) -- 0:06:11 Average standard deviation of split frequencies: 0.011224 335500 -- [-2614.403] (-2620.348) (-2619.568) (-2614.229) * (-2617.736) [-2620.053] (-2630.280) (-2618.455) -- 0:06:10 336000 -- (-2621.874) (-2622.986) (-2619.440) [-2623.519] * [-2616.804] (-2628.375) (-2624.059) (-2629.378) -- 0:06:09 336500 -- (-2618.269) (-2625.787) (-2617.071) [-2624.665] * (-2625.979) [-2619.020] (-2621.559) (-2634.679) -- 0:06:10 337000 -- [-2620.925] (-2617.686) (-2617.992) (-2616.285) * (-2623.068) [-2617.155] (-2620.658) (-2628.567) -- 0:06:09 337500 -- (-2630.073) (-2614.544) (-2628.823) [-2614.273] * (-2614.624) (-2627.814) (-2633.001) [-2616.237] -- 0:06:09 338000 -- (-2615.917) (-2622.375) [-2616.380] (-2623.404) * (-2612.971) [-2612.326] (-2620.867) (-2628.503) -- 0:06:08 338500 -- [-2614.789] (-2624.358) (-2622.996) (-2618.546) * (-2613.416) [-2617.710] (-2615.765) (-2627.714) -- 0:06:09 339000 -- (-2625.726) [-2620.464] (-2617.167) (-2618.399) * (-2635.167) (-2613.503) [-2618.120] (-2626.622) -- 0:06:08 339500 -- (-2621.035) [-2619.154] (-2617.986) (-2626.134) * (-2623.363) [-2623.871] (-2627.321) (-2614.760) -- 0:06:07 340000 -- (-2621.211) (-2628.698) [-2619.769] (-2628.227) * (-2618.590) [-2618.907] (-2619.504) (-2621.500) -- 0:06:08 Average standard deviation of split frequencies: 0.012454 340500 -- (-2625.851) (-2632.616) [-2618.920] (-2625.390) * [-2614.837] (-2626.102) (-2617.153) (-2623.933) -- 0:06:08 341000 -- (-2627.258) (-2615.978) (-2622.124) [-2624.391] * [-2612.484] (-2614.633) (-2618.543) (-2621.229) -- 0:06:07 341500 -- (-2622.110) (-2632.484) (-2619.138) [-2616.981] * (-2624.799) (-2618.912) (-2627.172) [-2620.522] -- 0:06:06 342000 -- (-2625.966) (-2622.841) (-2620.886) [-2616.516] * (-2627.592) (-2612.972) [-2618.371] (-2620.997) -- 0:06:07 342500 -- [-2618.328] (-2629.789) (-2618.169) (-2620.322) * (-2616.111) [-2613.802] (-2614.247) (-2621.869) -- 0:06:06 343000 -- (-2624.937) (-2618.782) [-2621.132] (-2622.131) * (-2627.726) (-2626.839) (-2630.611) [-2619.530] -- 0:06:05 343500 -- [-2617.828] (-2621.060) (-2612.500) (-2620.179) * [-2616.648] (-2624.971) (-2623.023) (-2634.111) -- 0:06:06 344000 -- [-2617.641] (-2620.861) (-2621.377) (-2619.141) * (-2627.026) (-2620.047) [-2619.036] (-2624.669) -- 0:06:06 344500 -- (-2628.195) (-2618.535) (-2627.717) [-2614.715] * (-2627.405) (-2614.826) [-2622.091] (-2622.364) -- 0:06:05 345000 -- (-2630.220) (-2626.155) (-2620.718) [-2620.710] * (-2625.597) [-2613.923] (-2616.915) (-2625.948) -- 0:06:06 Average standard deviation of split frequencies: 0.010105 345500 -- [-2613.851] (-2617.955) (-2621.309) (-2614.134) * (-2639.042) (-2620.747) [-2617.110] (-2618.329) -- 0:06:05 346000 -- (-2618.440) [-2627.876] (-2621.473) (-2619.218) * [-2626.712] (-2621.841) (-2622.661) (-2620.480) -- 0:06:04 346500 -- (-2616.619) [-2619.030] (-2622.950) (-2617.499) * (-2628.813) [-2617.445] (-2619.758) (-2625.776) -- 0:06:03 347000 -- (-2626.605) [-2616.775] (-2624.638) (-2616.629) * (-2618.887) (-2622.603) (-2623.231) [-2628.914] -- 0:06:05 347500 -- [-2631.686] (-2622.545) (-2615.924) (-2614.545) * (-2620.923) [-2616.721] (-2629.820) (-2624.661) -- 0:06:04 348000 -- (-2621.031) (-2620.859) [-2618.408] (-2629.927) * (-2616.287) (-2619.035) [-2617.875] (-2630.773) -- 0:06:03 348500 -- (-2614.513) [-2614.820] (-2614.289) (-2622.389) * [-2627.103] (-2631.479) (-2621.319) (-2619.909) -- 0:06:02 349000 -- [-2628.018] (-2615.880) (-2616.887) (-2616.981) * (-2624.290) [-2627.465] (-2630.657) (-2626.705) -- 0:06:03 349500 -- (-2611.908) (-2620.540) (-2621.731) [-2620.438] * [-2622.263] (-2623.786) (-2621.859) (-2629.397) -- 0:06:02 350000 -- (-2620.693) (-2624.924) (-2625.477) [-2620.390] * (-2622.220) [-2619.143] (-2622.158) (-2615.989) -- 0:06:02 Average standard deviation of split frequencies: 0.009410 350500 -- (-2624.222) (-2615.682) [-2617.107] (-2625.004) * (-2624.403) [-2617.644] (-2624.381) (-2623.971) -- 0:06:03 351000 -- (-2623.071) [-2622.749] (-2621.026) (-2623.630) * (-2632.450) [-2617.991] (-2620.779) (-2622.388) -- 0:06:02 351500 -- (-2621.712) (-2618.019) [-2611.533] (-2619.611) * (-2626.713) [-2618.909] (-2629.242) (-2618.345) -- 0:06:01 352000 -- [-2625.824] (-2625.369) (-2615.102) (-2622.354) * (-2618.655) (-2614.711) (-2619.688) [-2621.074] -- 0:06:00 352500 -- (-2620.207) (-2625.110) (-2619.781) [-2620.458] * (-2621.248) [-2612.583] (-2626.229) (-2615.637) -- 0:06:01 353000 -- (-2622.585) (-2619.720) [-2615.722] (-2618.957) * (-2628.594) (-2618.029) (-2618.948) [-2622.521] -- 0:06:01 353500 -- (-2618.892) (-2618.249) [-2618.497] (-2619.206) * (-2618.677) (-2621.039) [-2620.618] (-2616.846) -- 0:06:00 354000 -- (-2617.567) [-2622.274] (-2615.590) (-2614.038) * [-2619.133] (-2622.260) (-2620.862) (-2614.291) -- 0:05:59 354500 -- (-2616.096) (-2627.283) [-2612.932] (-2620.235) * [-2619.623] (-2619.327) (-2614.115) (-2615.985) -- 0:06:00 355000 -- [-2613.649] (-2629.135) (-2616.083) (-2621.647) * (-2621.440) (-2616.568) [-2617.349] (-2620.572) -- 0:05:59 Average standard deviation of split frequencies: 0.009048 355500 -- (-2623.817) (-2620.941) (-2623.581) [-2615.345] * (-2630.937) (-2630.176) [-2618.152] (-2617.567) -- 0:05:58 356000 -- (-2613.816) (-2627.863) (-2633.184) [-2620.542] * (-2622.167) (-2624.233) [-2618.389] (-2621.000) -- 0:05:59 356500 -- [-2617.215] (-2618.473) (-2619.472) (-2619.554) * (-2624.656) (-2621.120) (-2613.408) [-2618.660] -- 0:05:59 357000 -- (-2612.805) (-2621.420) (-2619.889) [-2621.403] * (-2615.797) [-2617.348] (-2623.423) (-2618.105) -- 0:05:58 357500 -- (-2618.398) (-2621.648) [-2619.676] (-2616.458) * (-2618.457) [-2611.915] (-2627.101) (-2623.418) -- 0:05:57 358000 -- (-2618.047) [-2625.042] (-2622.640) (-2627.143) * [-2614.766] (-2615.463) (-2611.683) (-2624.626) -- 0:05:58 358500 -- (-2633.951) (-2614.266) [-2616.290] (-2622.776) * (-2618.026) (-2626.988) [-2623.858] (-2620.441) -- 0:05:57 359000 -- (-2625.375) (-2622.721) [-2623.715] (-2617.671) * (-2619.900) (-2620.173) (-2626.393) [-2630.657] -- 0:05:57 359500 -- [-2621.127] (-2622.048) (-2619.804) (-2624.593) * [-2614.302] (-2624.276) (-2626.981) (-2620.734) -- 0:05:58 360000 -- (-2631.538) (-2619.573) (-2620.132) [-2619.228] * (-2618.546) (-2615.600) [-2624.700] (-2627.409) -- 0:05:57 Average standard deviation of split frequencies: 0.008931 360500 -- (-2616.798) [-2616.428] (-2620.132) (-2618.281) * (-2625.990) (-2632.401) (-2614.090) [-2619.168] -- 0:05:56 361000 -- [-2620.394] (-2622.782) (-2634.339) (-2616.585) * [-2617.588] (-2624.850) (-2624.522) (-2615.371) -- 0:05:55 361500 -- (-2620.552) (-2617.438) (-2621.150) [-2624.078] * (-2623.183) (-2624.150) (-2617.261) [-2616.745] -- 0:05:56 362000 -- (-2622.867) (-2620.421) (-2618.946) [-2616.049] * (-2624.858) (-2621.719) [-2615.165] (-2629.708) -- 0:05:56 362500 -- [-2614.898] (-2615.205) (-2621.761) (-2618.589) * [-2618.799] (-2613.857) (-2626.612) (-2629.024) -- 0:05:55 363000 -- (-2621.057) [-2619.276] (-2619.020) (-2618.478) * (-2616.411) [-2622.709] (-2620.384) (-2629.147) -- 0:05:56 363500 -- (-2618.179) [-2616.456] (-2626.797) (-2621.782) * [-2616.742] (-2622.151) (-2619.635) (-2635.994) -- 0:05:55 364000 -- (-2628.336) (-2620.679) [-2616.131] (-2616.998) * (-2622.213) (-2617.257) [-2624.777] (-2624.667) -- 0:05:54 364500 -- (-2619.623) [-2617.076] (-2614.993) (-2620.032) * (-2624.619) (-2615.452) (-2624.979) [-2624.662] -- 0:05:53 365000 -- (-2616.928) [-2614.807] (-2619.688) (-2619.734) * (-2627.590) [-2629.415] (-2623.908) (-2622.817) -- 0:05:54 Average standard deviation of split frequencies: 0.008587 365500 -- [-2624.740] (-2617.569) (-2615.735) (-2626.774) * (-2617.448) [-2622.130] (-2617.903) (-2616.686) -- 0:05:54 366000 -- [-2618.665] (-2632.201) (-2626.536) (-2619.540) * (-2622.116) [-2620.894] (-2619.703) (-2616.080) -- 0:05:53 366500 -- (-2617.446) [-2623.277] (-2629.692) (-2621.694) * (-2621.556) (-2623.255) [-2616.047] (-2623.266) -- 0:05:54 367000 -- (-2621.665) [-2618.938] (-2625.498) (-2616.986) * (-2633.914) [-2618.340] (-2622.421) (-2612.861) -- 0:05:53 367500 -- (-2621.559) [-2618.012] (-2622.469) (-2614.332) * (-2624.170) [-2618.219] (-2626.723) (-2621.159) -- 0:05:52 368000 -- [-2623.407] (-2618.945) (-2623.280) (-2615.287) * [-2617.566] (-2617.230) (-2614.704) (-2614.542) -- 0:05:52 368500 -- (-2623.634) (-2617.906) [-2616.949] (-2619.526) * (-2631.687) (-2629.135) [-2617.535] (-2614.158) -- 0:05:53 369000 -- (-2626.097) (-2620.195) (-2619.903) [-2626.663] * (-2621.759) (-2618.334) (-2617.297) [-2616.434] -- 0:05:52 369500 -- (-2616.841) [-2618.694] (-2618.829) (-2624.238) * (-2625.477) [-2619.646] (-2621.428) (-2614.593) -- 0:05:51 370000 -- [-2619.148] (-2628.622) (-2618.174) (-2623.505) * [-2623.014] (-2619.124) (-2619.104) (-2616.879) -- 0:05:50 Average standard deviation of split frequencies: 0.008373 370500 -- (-2620.657) (-2617.011) [-2620.746] (-2625.848) * (-2636.759) (-2627.758) (-2618.708) [-2617.615] -- 0:05:51 371000 -- (-2624.802) (-2622.601) (-2618.534) [-2616.942] * (-2628.889) (-2625.439) (-2621.784) [-2620.059] -- 0:05:50 371500 -- (-2613.066) [-2626.367] (-2616.344) (-2616.322) * (-2628.029) [-2616.573] (-2619.586) (-2618.542) -- 0:05:50 372000 -- (-2629.627) (-2623.405) [-2622.339] (-2623.468) * [-2621.106] (-2617.046) (-2620.294) (-2619.678) -- 0:05:51 372500 -- (-2622.443) [-2619.251] (-2627.275) (-2619.066) * (-2624.894) [-2614.339] (-2618.293) (-2623.442) -- 0:05:50 373000 -- (-2621.396) [-2622.751] (-2616.297) (-2620.849) * (-2623.705) [-2614.831] (-2613.099) (-2625.758) -- 0:05:49 373500 -- (-2618.663) (-2621.927) [-2631.997] (-2619.385) * (-2619.138) (-2614.196) (-2619.501) [-2618.091] -- 0:05:48 374000 -- [-2615.418] (-2623.026) (-2627.863) (-2629.289) * (-2622.827) (-2624.111) [-2624.972] (-2625.097) -- 0:05:49 374500 -- (-2620.628) (-2612.403) [-2620.228] (-2623.634) * [-2621.406] (-2613.686) (-2617.927) (-2620.535) -- 0:05:49 375000 -- (-2628.795) (-2615.784) [-2620.550] (-2623.755) * [-2620.023] (-2617.475) (-2619.716) (-2617.486) -- 0:05:48 Average standard deviation of split frequencies: 0.007209 375500 -- (-2615.604) (-2622.640) (-2619.125) [-2628.276] * (-2618.894) (-2620.515) (-2617.820) [-2609.804] -- 0:05:49 376000 -- (-2621.190) (-2621.163) [-2624.482] (-2616.936) * (-2619.593) (-2622.021) (-2613.945) [-2616.474] -- 0:05:48 376500 -- (-2615.528) (-2623.155) (-2617.780) [-2611.160] * [-2618.079] (-2624.728) (-2630.718) (-2629.689) -- 0:05:47 377000 -- (-2620.137) [-2615.443] (-2618.923) (-2624.281) * (-2617.515) (-2616.554) (-2627.275) [-2616.647] -- 0:05:48 377500 -- (-2618.236) (-2622.289) (-2616.600) [-2617.493] * [-2611.831] (-2624.345) (-2626.771) (-2621.131) -- 0:05:47 378000 -- (-2629.854) (-2616.521) (-2621.872) [-2611.409] * (-2623.167) [-2616.962] (-2620.447) (-2619.256) -- 0:05:47 378500 -- (-2631.521) [-2615.443] (-2621.631) (-2613.035) * (-2621.661) (-2626.275) [-2616.294] (-2629.865) -- 0:05:48 379000 -- (-2632.656) [-2622.013] (-2614.578) (-2618.870) * (-2622.951) [-2617.471] (-2614.565) (-2618.626) -- 0:05:47 379500 -- [-2632.748] (-2627.567) (-2615.475) (-2617.901) * (-2617.050) [-2618.378] (-2626.770) (-2620.561) -- 0:05:46 380000 -- (-2628.665) (-2618.059) (-2614.951) [-2617.684] * [-2614.830] (-2615.980) (-2621.365) (-2627.373) -- 0:05:47 Average standard deviation of split frequencies: 0.007121 380500 -- (-2624.123) (-2622.980) [-2621.660] (-2618.820) * (-2624.562) [-2615.978] (-2627.411) (-2622.840) -- 0:05:46 381000 -- (-2622.719) (-2619.954) (-2619.142) [-2614.429] * (-2617.959) (-2616.788) (-2617.472) [-2619.154] -- 0:05:46 381500 -- [-2617.419] (-2615.726) (-2623.012) (-2634.253) * [-2615.981] (-2624.042) (-2622.171) (-2620.516) -- 0:05:45 382000 -- (-2627.087) (-2615.185) (-2618.138) [-2625.507] * [-2626.625] (-2615.626) (-2627.238) (-2622.951) -- 0:05:46 382500 -- (-2627.059) (-2620.555) (-2620.450) [-2622.267] * [-2616.474] (-2618.005) (-2623.505) (-2616.300) -- 0:05:45 383000 -- [-2618.008] (-2626.213) (-2615.800) (-2621.153) * (-2621.414) [-2617.576] (-2621.339) (-2621.163) -- 0:05:44 383500 -- (-2620.836) (-2619.148) [-2615.061] (-2621.375) * [-2624.296] (-2623.176) (-2622.184) (-2614.071) -- 0:05:45 384000 -- [-2616.097] (-2628.469) (-2615.290) (-2617.745) * (-2625.276) [-2615.470] (-2617.610) (-2622.795) -- 0:05:44 384500 -- [-2615.885] (-2620.689) (-2632.463) (-2618.270) * (-2624.483) (-2626.295) [-2616.305] (-2622.915) -- 0:05:44 385000 -- [-2616.198] (-2626.979) (-2624.143) (-2620.057) * (-2620.652) [-2622.095] (-2629.974) (-2623.371) -- 0:05:43 Average standard deviation of split frequencies: 0.007531 385500 -- (-2617.699) (-2623.752) [-2624.328] (-2628.375) * [-2621.654] (-2616.982) (-2622.323) (-2621.429) -- 0:05:44 386000 -- (-2617.402) [-2624.046] (-2627.553) (-2623.759) * [-2614.885] (-2625.187) (-2615.816) (-2629.614) -- 0:05:43 386500 -- (-2617.335) (-2623.667) [-2623.601] (-2614.921) * (-2618.947) [-2622.569] (-2622.198) (-2623.232) -- 0:05:42 387000 -- (-2621.153) (-2622.616) (-2620.118) [-2619.115] * [-2623.518] (-2623.691) (-2621.489) (-2626.205) -- 0:05:42 387500 -- [-2618.776] (-2618.696) (-2628.733) (-2619.957) * [-2625.757] (-2620.218) (-2619.714) (-2627.070) -- 0:05:42 388000 -- (-2619.904) (-2621.925) (-2627.847) [-2623.501] * (-2618.086) [-2618.667] (-2614.625) (-2618.956) -- 0:05:42 388500 -- (-2617.417) (-2621.555) (-2625.319) [-2612.964] * [-2613.595] (-2621.249) (-2616.695) (-2626.068) -- 0:05:41 389000 -- (-2621.066) (-2623.757) (-2625.043) [-2619.685] * [-2614.343] (-2620.237) (-2622.299) (-2620.340) -- 0:05:42 389500 -- (-2622.947) (-2623.955) (-2620.771) [-2625.160] * (-2621.908) [-2612.251] (-2616.076) (-2618.359) -- 0:05:41 390000 -- (-2627.833) [-2617.194] (-2622.589) (-2622.480) * [-2621.464] (-2619.948) (-2624.604) (-2631.294) -- 0:05:40 Average standard deviation of split frequencies: 0.007843 390500 -- (-2623.159) (-2621.822) [-2615.965] (-2620.786) * (-2626.053) (-2615.703) [-2619.508] (-2625.440) -- 0:05:40 391000 -- [-2617.090] (-2629.630) (-2626.263) (-2622.971) * (-2619.745) (-2623.315) [-2624.112] (-2627.723) -- 0:05:41 391500 -- [-2619.313] (-2624.030) (-2624.484) (-2620.107) * (-2615.753) (-2615.465) [-2623.110] (-2623.031) -- 0:05:40 392000 -- (-2624.440) [-2625.790] (-2624.516) (-2619.471) * [-2622.765] (-2619.396) (-2625.668) (-2619.619) -- 0:05:39 392500 -- (-2631.083) (-2623.834) [-2623.998] (-2616.703) * (-2621.852) [-2621.064] (-2620.438) (-2618.291) -- 0:05:40 393000 -- [-2611.425] (-2625.695) (-2624.436) (-2625.448) * (-2622.459) (-2627.730) [-2620.465] (-2627.386) -- 0:05:39 393500 -- (-2627.404) [-2614.872] (-2623.573) (-2624.136) * (-2619.084) [-2617.588] (-2616.303) (-2623.358) -- 0:05:39 394000 -- (-2634.987) [-2615.343] (-2621.670) (-2616.108) * (-2620.246) (-2631.380) [-2618.246] (-2618.689) -- 0:05:38 394500 -- (-2623.032) [-2617.768] (-2634.642) (-2620.999) * (-2628.009) (-2625.081) (-2616.341) [-2615.138] -- 0:05:39 395000 -- (-2626.245) [-2621.965] (-2635.526) (-2615.938) * (-2624.850) (-2622.169) [-2624.465] (-2620.238) -- 0:05:38 Average standard deviation of split frequencies: 0.008333 395500 -- (-2623.000) (-2621.635) [-2623.134] (-2629.493) * (-2627.321) (-2615.557) [-2615.966] (-2621.241) -- 0:05:37 396000 -- (-2616.936) [-2617.022] (-2624.251) (-2631.042) * (-2620.948) (-2629.855) [-2619.927] (-2623.148) -- 0:05:37 396500 -- (-2625.441) (-2625.698) [-2623.014] (-2626.536) * [-2615.230] (-2627.344) (-2615.906) (-2625.778) -- 0:05:37 397000 -- [-2618.057] (-2632.913) (-2615.228) (-2624.327) * (-2616.719) (-2622.210) [-2609.755] (-2623.983) -- 0:05:37 397500 -- (-2624.470) (-2627.716) (-2622.666) [-2622.332] * (-2620.320) (-2635.905) [-2618.212] (-2621.749) -- 0:05:36 398000 -- (-2622.230) [-2630.479] (-2625.527) (-2622.630) * [-2622.366] (-2623.561) (-2617.026) (-2620.954) -- 0:05:37 398500 -- (-2628.106) [-2617.459] (-2623.771) (-2625.853) * (-2617.812) (-2622.343) (-2615.110) [-2619.144] -- 0:05:36 399000 -- (-2620.125) [-2621.171] (-2620.054) (-2615.376) * (-2618.654) (-2622.994) (-2622.302) [-2619.198] -- 0:05:35 399500 -- (-2614.768) (-2626.293) [-2619.255] (-2619.351) * (-2624.361) [-2615.948] (-2618.114) (-2620.260) -- 0:05:35 400000 -- (-2616.201) [-2629.623] (-2637.961) (-2614.670) * [-2621.435] (-2622.767) (-2624.220) (-2613.450) -- 0:05:35 Average standard deviation of split frequencies: 0.007942 400500 -- [-2624.684] (-2619.795) (-2614.749) (-2620.121) * (-2624.075) (-2611.911) (-2636.403) [-2618.525] -- 0:05:35 401000 -- (-2618.722) [-2622.703] (-2617.817) (-2617.393) * [-2619.687] (-2615.589) (-2628.991) (-2617.399) -- 0:05:34 401500 -- (-2620.566) (-2618.054) (-2621.475) [-2616.116] * (-2621.290) [-2619.324] (-2619.530) (-2631.636) -- 0:05:35 402000 -- (-2624.556) (-2618.022) (-2617.675) [-2616.377] * (-2621.346) [-2612.740] (-2625.190) (-2625.895) -- 0:05:34 402500 -- (-2618.548) (-2616.625) [-2617.989] (-2623.157) * (-2617.704) (-2621.271) [-2621.642] (-2620.036) -- 0:05:34 403000 -- (-2618.284) (-2628.297) [-2615.735] (-2619.691) * (-2627.121) [-2616.116] (-2620.338) (-2616.196) -- 0:05:34 403500 -- (-2620.723) (-2634.960) [-2615.881] (-2617.387) * (-2624.868) (-2614.716) (-2623.057) [-2632.676] -- 0:05:34 404000 -- [-2618.424] (-2624.064) (-2632.532) (-2621.914) * (-2622.145) (-2624.004) (-2630.510) [-2615.811] -- 0:05:33 404500 -- (-2623.242) (-2625.062) [-2619.539] (-2624.763) * (-2628.580) [-2625.436] (-2624.122) (-2620.249) -- 0:05:34 405000 -- [-2613.070] (-2616.991) (-2640.305) (-2618.495) * (-2617.052) [-2622.642] (-2619.845) (-2617.632) -- 0:05:33 Average standard deviation of split frequencies: 0.007547 405500 -- (-2614.342) (-2627.759) [-2616.433] (-2624.614) * [-2619.875] (-2611.434) (-2626.363) (-2615.200) -- 0:05:32 406000 -- [-2617.871] (-2616.448) (-2618.133) (-2616.152) * (-2624.148) [-2614.461] (-2618.283) (-2621.741) -- 0:05:33 406500 -- (-2618.787) [-2619.598] (-2625.171) (-2612.956) * (-2614.820) (-2621.674) (-2618.388) [-2622.329] -- 0:05:32 407000 -- [-2617.624] (-2625.006) (-2624.914) (-2616.948) * (-2626.466) (-2619.873) [-2615.310] (-2625.628) -- 0:05:32 407500 -- (-2620.077) [-2619.135] (-2621.117) (-2617.571) * (-2619.887) [-2615.287] (-2622.251) (-2612.296) -- 0:05:31 408000 -- (-2618.411) (-2615.460) (-2624.984) [-2619.469] * [-2617.400] (-2617.866) (-2622.151) (-2622.536) -- 0:05:32 408500 -- [-2617.284] (-2618.010) (-2619.213) (-2616.790) * (-2627.215) (-2616.824) [-2619.648] (-2622.719) -- 0:05:31 409000 -- (-2626.547) (-2617.008) (-2619.118) [-2610.040] * [-2617.011] (-2619.406) (-2630.086) (-2612.046) -- 0:05:30 409500 -- [-2620.627] (-2621.864) (-2623.495) (-2619.643) * (-2618.751) (-2614.522) (-2642.006) [-2619.436] -- 0:05:30 410000 -- [-2620.516] (-2617.506) (-2634.406) (-2621.033) * [-2616.768] (-2622.682) (-2625.301) (-2615.753) -- 0:05:30 Average standard deviation of split frequencies: 0.008322 410500 -- (-2617.584) [-2623.210] (-2630.320) (-2626.958) * (-2620.464) [-2622.688] (-2623.606) (-2615.568) -- 0:05:30 411000 -- (-2617.844) (-2627.564) [-2628.792] (-2624.662) * [-2617.292] (-2620.610) (-2618.707) (-2615.518) -- 0:05:29 411500 -- (-2619.421) [-2614.497] (-2629.175) (-2621.715) * (-2621.785) (-2622.629) [-2616.917] (-2618.722) -- 0:05:30 412000 -- (-2626.699) [-2618.710] (-2617.644) (-2621.477) * (-2620.102) [-2620.020] (-2622.720) (-2624.270) -- 0:05:29 412500 -- [-2616.523] (-2619.449) (-2626.360) (-2624.626) * [-2615.905] (-2625.309) (-2625.145) (-2620.302) -- 0:05:28 413000 -- (-2627.488) (-2615.495) [-2619.346] (-2614.043) * (-2619.406) (-2624.079) [-2621.865] (-2616.965) -- 0:05:28 413500 -- [-2620.396] (-2623.125) (-2617.628) (-2621.047) * (-2617.302) (-2622.112) (-2618.738) [-2621.570] -- 0:05:29 414000 -- [-2625.472] (-2625.554) (-2619.591) (-2614.505) * (-2627.204) (-2624.541) (-2626.334) [-2626.284] -- 0:05:28 414500 -- (-2620.436) [-2625.671] (-2625.616) (-2621.910) * (-2617.018) (-2626.763) (-2617.022) [-2616.788] -- 0:05:27 415000 -- (-2623.019) [-2621.727] (-2631.583) (-2628.428) * (-2617.018) (-2626.421) [-2618.432] (-2616.860) -- 0:05:27 Average standard deviation of split frequencies: 0.008688 415500 -- [-2616.997] (-2625.305) (-2623.171) (-2623.734) * (-2621.855) (-2617.713) (-2627.312) [-2620.609] -- 0:05:27 416000 -- (-2618.290) (-2631.580) (-2623.240) [-2621.567] * (-2625.122) [-2616.044] (-2614.816) (-2623.620) -- 0:05:27 416500 -- [-2625.084] (-2620.015) (-2626.887) (-2622.672) * (-2619.150) [-2612.574] (-2622.482) (-2623.611) -- 0:05:26 417000 -- (-2624.577) (-2617.850) (-2632.114) [-2619.930] * (-2618.589) (-2619.451) (-2616.587) [-2615.708] -- 0:05:27 417500 -- (-2621.131) [-2623.629] (-2623.271) (-2616.658) * [-2623.225] (-2621.829) (-2631.396) (-2629.261) -- 0:05:26 418000 -- (-2619.838) (-2620.124) [-2616.462] (-2619.087) * (-2625.736) (-2621.803) (-2619.505) [-2624.287] -- 0:05:25 418500 -- (-2622.840) (-2632.176) [-2617.789] (-2620.732) * (-2620.478) (-2619.895) [-2617.443] (-2621.136) -- 0:05:26 419000 -- [-2623.738] (-2622.479) (-2623.923) (-2620.129) * (-2620.697) (-2633.052) [-2623.010] (-2618.645) -- 0:05:25 419500 -- (-2631.633) (-2616.239) (-2622.449) [-2614.987] * (-2617.830) [-2625.320] (-2615.378) (-2619.275) -- 0:05:25 420000 -- (-2621.360) (-2617.637) [-2619.850] (-2627.646) * [-2612.198] (-2621.400) (-2623.349) (-2634.153) -- 0:05:24 Average standard deviation of split frequencies: 0.008311 420500 -- (-2622.728) (-2622.966) (-2631.705) [-2623.520] * [-2615.369] (-2618.509) (-2614.106) (-2626.838) -- 0:05:25 421000 -- (-2628.001) (-2615.969) [-2621.573] (-2624.659) * (-2631.240) [-2614.056] (-2617.912) (-2636.993) -- 0:05:24 421500 -- (-2620.967) [-2614.768] (-2632.739) (-2620.348) * (-2612.103) [-2627.396] (-2617.277) (-2627.410) -- 0:05:23 422000 -- [-2617.112] (-2621.052) (-2620.361) (-2621.372) * (-2619.169) (-2625.642) [-2618.574] (-2619.793) -- 0:05:24 422500 -- [-2621.757] (-2622.977) (-2625.576) (-2634.757) * (-2624.868) (-2619.501) (-2625.934) [-2620.363] -- 0:05:23 423000 -- (-2620.074) (-2637.849) [-2614.812] (-2620.926) * (-2620.746) [-2619.709] (-2617.647) (-2625.787) -- 0:05:23 423500 -- (-2612.646) (-2624.366) (-2624.509) [-2613.191] * [-2615.941] (-2629.785) (-2616.856) (-2622.188) -- 0:05:22 424000 -- (-2627.670) (-2618.649) (-2628.323) [-2622.232] * (-2629.308) (-2619.551) [-2618.327] (-2621.907) -- 0:05:23 424500 -- (-2617.351) (-2618.312) (-2619.888) [-2617.046] * (-2630.705) [-2614.930] (-2619.421) (-2620.759) -- 0:05:22 425000 -- (-2620.892) (-2614.542) [-2625.250] (-2623.881) * (-2618.488) (-2617.273) (-2617.765) [-2613.760] -- 0:05:22 Average standard deviation of split frequencies: 0.007469 425500 -- (-2619.222) [-2621.972] (-2623.768) (-2624.293) * [-2614.747] (-2622.871) (-2624.537) (-2622.643) -- 0:05:22 426000 -- (-2617.943) (-2629.446) [-2618.729] (-2623.781) * (-2616.972) [-2625.217] (-2628.426) (-2627.375) -- 0:05:22 426500 -- (-2624.143) (-2623.124) [-2616.186] (-2615.913) * (-2622.088) (-2626.298) (-2629.214) [-2618.247] -- 0:05:21 427000 -- (-2616.221) (-2629.765) [-2616.595] (-2617.308) * (-2627.325) (-2622.816) [-2615.635] (-2622.976) -- 0:05:20 427500 -- (-2620.116) (-2624.183) (-2623.321) [-2616.349] * (-2632.366) (-2623.909) [-2626.086] (-2621.515) -- 0:05:21 428000 -- (-2620.829) (-2626.878) (-2620.485) [-2622.535] * [-2620.974] (-2617.745) (-2614.146) (-2622.460) -- 0:05:20 428500 -- (-2620.100) [-2620.171] (-2625.441) (-2629.682) * (-2624.190) [-2616.614] (-2616.268) (-2619.704) -- 0:05:20 429000 -- [-2615.482] (-2617.726) (-2623.291) (-2617.703) * (-2634.104) (-2626.201) [-2616.532] (-2619.467) -- 0:05:19 429500 -- (-2614.992) (-2615.699) [-2616.513] (-2627.319) * (-2623.059) (-2623.411) (-2622.098) [-2619.980] -- 0:05:20 430000 -- [-2627.177] (-2629.536) (-2622.244) (-2627.035) * (-2615.020) (-2613.335) [-2615.823] (-2624.055) -- 0:05:19 Average standard deviation of split frequencies: 0.006841 430500 -- (-2623.554) (-2628.680) [-2612.295] (-2629.518) * [-2617.539] (-2619.929) (-2611.345) (-2625.348) -- 0:05:18 431000 -- (-2622.291) [-2616.077] (-2618.957) (-2618.878) * (-2625.488) (-2622.390) [-2615.997] (-2646.234) -- 0:05:19 431500 -- (-2626.617) (-2625.649) [-2615.582] (-2615.081) * (-2622.567) (-2628.253) [-2619.421] (-2628.550) -- 0:05:18 432000 -- (-2620.803) [-2619.866] (-2620.464) (-2622.305) * (-2625.016) (-2616.608) [-2608.421] (-2623.492) -- 0:05:18 432500 -- (-2622.341) [-2614.784] (-2622.219) (-2623.790) * (-2621.502) (-2618.329) (-2623.930) [-2619.860] -- 0:05:17 433000 -- (-2622.934) (-2617.047) [-2615.758] (-2628.589) * [-2617.305] (-2623.862) (-2624.155) (-2624.243) -- 0:05:18 433500 -- [-2618.309] (-2614.311) (-2621.374) (-2619.917) * [-2619.467] (-2615.416) (-2626.447) (-2621.548) -- 0:05:17 434000 -- (-2625.928) (-2621.125) (-2627.042) [-2623.566] * (-2620.030) [-2630.423] (-2625.419) (-2619.756) -- 0:05:16 434500 -- (-2616.346) (-2620.022) [-2621.701] (-2636.765) * (-2626.651) (-2622.844) [-2626.081] (-2618.980) -- 0:05:17 435000 -- [-2620.607] (-2621.162) (-2613.694) (-2633.526) * [-2621.502] (-2619.892) (-2612.713) (-2621.159) -- 0:05:16 Average standard deviation of split frequencies: 0.006848 435500 -- (-2630.518) (-2615.264) [-2617.593] (-2618.102) * (-2617.152) [-2616.978] (-2617.219) (-2622.299) -- 0:05:16 436000 -- (-2626.429) (-2628.157) [-2617.475] (-2616.349) * (-2629.813) [-2619.484] (-2622.524) (-2632.357) -- 0:05:15 436500 -- [-2621.263] (-2619.369) (-2616.451) (-2623.094) * [-2620.778] (-2616.422) (-2617.933) (-2636.234) -- 0:05:16 437000 -- (-2625.623) (-2625.131) (-2624.572) [-2620.444] * (-2628.044) (-2617.641) [-2623.045] (-2633.126) -- 0:05:15 437500 -- (-2624.588) (-2622.196) [-2621.129] (-2619.010) * (-2613.189) [-2622.733] (-2619.986) (-2625.338) -- 0:05:15 438000 -- (-2627.920) (-2616.057) (-2616.788) [-2616.358] * [-2628.267] (-2618.802) (-2623.695) (-2627.113) -- 0:05:14 438500 -- (-2615.035) [-2614.640] (-2618.095) (-2625.710) * (-2618.231) (-2616.466) [-2614.548] (-2628.516) -- 0:05:15 439000 -- (-2621.014) (-2620.571) (-2621.015) [-2617.217] * (-2621.462) [-2623.787] (-2619.271) (-2626.937) -- 0:05:14 439500 -- (-2618.254) (-2627.450) [-2622.131] (-2616.384) * (-2619.878) [-2614.780] (-2621.881) (-2627.576) -- 0:05:13 440000 -- (-2619.602) (-2622.574) [-2621.666] (-2618.338) * [-2617.559] (-2619.591) (-2618.501) (-2627.815) -- 0:05:14 Average standard deviation of split frequencies: 0.006953 440500 -- (-2611.634) [-2617.622] (-2622.494) (-2625.674) * (-2624.935) (-2623.563) [-2619.161] (-2621.379) -- 0:05:13 441000 -- [-2625.956] (-2625.827) (-2629.415) (-2632.364) * (-2624.820) (-2621.255) (-2620.418) [-2624.842] -- 0:05:13 441500 -- (-2626.085) [-2616.272] (-2627.246) (-2628.558) * (-2620.487) (-2621.047) (-2628.764) [-2625.582] -- 0:05:12 442000 -- (-2616.797) [-2611.928] (-2629.281) (-2624.019) * [-2615.568] (-2618.256) (-2628.151) (-2615.498) -- 0:05:13 442500 -- (-2624.064) (-2613.620) (-2623.290) [-2619.452] * (-2614.824) (-2629.754) (-2619.472) [-2618.501] -- 0:05:12 443000 -- [-2618.687] (-2620.903) (-2620.941) (-2622.591) * (-2614.287) [-2619.722] (-2618.157) (-2619.607) -- 0:05:11 443500 -- (-2622.232) (-2620.563) [-2615.549] (-2622.315) * [-2617.603] (-2621.632) (-2628.019) (-2619.468) -- 0:05:11 444000 -- (-2621.196) (-2628.625) [-2620.619] (-2617.016) * (-2624.745) [-2610.968] (-2613.822) (-2628.405) -- 0:05:11 444500 -- (-2618.897) (-2612.862) (-2616.524) [-2620.343] * (-2625.522) (-2633.367) (-2621.570) [-2621.064] -- 0:05:11 445000 -- (-2618.317) (-2624.412) [-2615.452] (-2629.034) * (-2615.503) (-2620.533) [-2613.681] (-2628.600) -- 0:05:10 Average standard deviation of split frequencies: 0.005461 445500 -- (-2622.633) [-2624.225] (-2618.203) (-2621.527) * [-2616.869] (-2622.561) (-2618.730) (-2617.968) -- 0:05:11 446000 -- (-2615.021) [-2615.807] (-2620.213) (-2619.697) * (-2619.793) (-2618.235) [-2618.634] (-2614.710) -- 0:05:10 446500 -- [-2616.881] (-2612.410) (-2623.223) (-2617.460) * [-2617.293] (-2621.628) (-2628.862) (-2618.054) -- 0:05:09 447000 -- (-2615.186) (-2621.286) (-2618.739) [-2615.139] * (-2619.212) [-2625.601] (-2625.772) (-2618.126) -- 0:05:09 447500 -- (-2620.135) (-2623.839) (-2628.848) [-2614.144] * [-2611.917] (-2616.812) (-2628.820) (-2626.264) -- 0:05:09 448000 -- (-2621.390) (-2623.029) (-2620.424) [-2621.995] * (-2617.463) (-2620.950) [-2617.088] (-2617.433) -- 0:05:09 448500 -- (-2623.604) [-2621.346] (-2625.555) (-2623.563) * (-2614.347) (-2619.763) [-2621.023] (-2621.766) -- 0:05:08 449000 -- (-2616.904) (-2624.812) (-2620.734) [-2619.696] * (-2622.073) [-2617.141] (-2615.830) (-2617.018) -- 0:05:08 449500 -- [-2617.643] (-2623.943) (-2619.402) (-2616.208) * (-2616.757) (-2616.629) (-2618.696) [-2622.561] -- 0:05:08 450000 -- (-2615.293) (-2617.916) (-2622.697) [-2614.779] * [-2622.139] (-2616.912) (-2617.648) (-2626.724) -- 0:05:08 Average standard deviation of split frequencies: 0.005753 450500 -- (-2616.564) [-2625.113] (-2622.117) (-2614.669) * (-2617.568) (-2619.263) (-2620.196) [-2621.670] -- 0:05:07 451000 -- (-2622.523) [-2617.532] (-2621.253) (-2616.690) * [-2620.703] (-2611.258) (-2619.943) (-2625.473) -- 0:05:07 451500 -- [-2625.142] (-2624.481) (-2626.460) (-2618.350) * [-2623.166] (-2622.819) (-2615.033) (-2620.099) -- 0:05:07 452000 -- (-2621.493) (-2620.637) [-2619.682] (-2615.212) * (-2624.087) (-2617.381) [-2614.821] (-2625.239) -- 0:05:06 452500 -- (-2619.089) (-2627.036) [-2613.631] (-2622.227) * [-2622.445] (-2621.628) (-2622.311) (-2621.273) -- 0:05:06 453000 -- (-2616.825) (-2619.644) (-2625.287) [-2624.373] * (-2620.930) [-2624.932] (-2619.361) (-2621.273) -- 0:05:06 453500 -- [-2627.473] (-2622.095) (-2615.870) (-2615.583) * (-2629.229) [-2626.207] (-2624.300) (-2616.424) -- 0:05:06 454000 -- (-2617.693) (-2616.990) (-2620.991) [-2619.459] * (-2623.273) (-2627.837) (-2618.110) [-2615.227] -- 0:05:05 454500 -- (-2623.842) (-2620.931) [-2621.732] (-2619.552) * (-2620.294) [-2621.934] (-2626.979) (-2631.478) -- 0:05:06 455000 -- (-2621.538) (-2619.508) [-2616.249] (-2628.130) * [-2622.530] (-2617.676) (-2617.394) (-2627.799) -- 0:05:05 Average standard deviation of split frequencies: 0.005341 455500 -- (-2620.876) (-2620.676) [-2620.700] (-2625.376) * [-2618.138] (-2628.437) (-2620.874) (-2618.427) -- 0:05:04 456000 -- [-2614.629] (-2622.404) (-2624.140) (-2624.583) * (-2626.484) (-2619.273) (-2629.651) [-2620.051] -- 0:05:04 456500 -- (-2621.608) [-2615.822] (-2626.057) (-2630.402) * (-2623.536) (-2618.288) (-2624.120) [-2612.147] -- 0:05:04 457000 -- (-2616.492) [-2613.297] (-2616.415) (-2630.417) * [-2633.429] (-2616.618) (-2624.448) (-2619.067) -- 0:05:04 457500 -- [-2616.641] (-2617.128) (-2625.469) (-2624.465) * (-2623.618) (-2627.524) (-2621.087) [-2626.229] -- 0:05:03 458000 -- (-2626.358) (-2618.841) (-2623.220) [-2617.327] * [-2620.902] (-2619.777) (-2612.766) (-2639.853) -- 0:05:02 458500 -- (-2619.070) (-2624.527) (-2634.094) [-2623.902] * [-2626.853] (-2623.219) (-2626.874) (-2623.548) -- 0:05:03 459000 -- (-2618.527) (-2629.529) [-2618.954] (-2623.800) * (-2619.885) (-2619.612) [-2621.416] (-2617.771) -- 0:05:02 459500 -- (-2617.089) (-2619.635) [-2625.132] (-2629.571) * (-2615.797) [-2613.282] (-2634.225) (-2620.372) -- 0:05:02 460000 -- (-2621.345) (-2619.211) [-2621.193] (-2622.425) * (-2627.918) [-2615.546] (-2625.384) (-2617.131) -- 0:05:02 Average standard deviation of split frequencies: 0.005287 460500 -- [-2614.373] (-2630.899) (-2628.193) (-2627.398) * (-2623.859) [-2619.324] (-2630.611) (-2625.321) -- 0:05:02 461000 -- (-2614.814) [-2618.006] (-2616.353) (-2617.007) * (-2615.230) (-2618.397) [-2620.109] (-2620.539) -- 0:05:01 461500 -- (-2620.626) (-2624.619) (-2617.310) [-2617.669] * (-2621.867) (-2617.840) [-2623.192] (-2627.152) -- 0:05:01 462000 -- (-2620.501) (-2619.511) [-2619.083] (-2622.486) * [-2614.083] (-2625.005) (-2624.357) (-2619.623) -- 0:05:01 462500 -- (-2620.629) (-2616.314) [-2619.790] (-2614.351) * [-2618.388] (-2627.186) (-2624.016) (-2619.268) -- 0:05:01 463000 -- [-2618.182] (-2619.834) (-2625.487) (-2615.469) * (-2623.953) (-2625.185) (-2620.557) [-2614.879] -- 0:05:00 463500 -- [-2621.565] (-2618.428) (-2627.615) (-2625.205) * (-2617.087) (-2615.536) (-2623.468) [-2618.140] -- 0:05:00 464000 -- (-2618.212) [-2611.488] (-2628.778) (-2627.673) * (-2621.143) (-2621.886) (-2621.848) [-2618.929] -- 0:05:00 464500 -- [-2621.033] (-2627.644) (-2630.907) (-2618.345) * [-2617.137] (-2617.010) (-2618.317) (-2619.854) -- 0:04:59 465000 -- [-2620.959] (-2623.869) (-2614.352) (-2621.732) * (-2622.146) (-2618.493) [-2610.568] (-2621.411) -- 0:04:59 Average standard deviation of split frequencies: 0.005227 465500 -- (-2624.450) [-2617.799] (-2618.236) (-2619.967) * [-2618.425] (-2624.231) (-2620.327) (-2629.243) -- 0:04:59 466000 -- (-2622.916) (-2624.918) [-2619.712] (-2620.709) * [-2615.174] (-2617.963) (-2626.469) (-2621.585) -- 0:04:59 466500 -- [-2620.758] (-2624.319) (-2618.280) (-2629.671) * [-2616.886] (-2622.592) (-2621.666) (-2619.690) -- 0:04:58 467000 -- (-2618.745) (-2623.445) (-2620.566) [-2619.764] * (-2620.810) (-2618.137) (-2629.035) [-2623.068] -- 0:04:57 467500 -- (-2633.251) (-2621.586) [-2618.141] (-2621.819) * (-2622.263) (-2623.596) [-2615.149] (-2625.424) -- 0:04:58 468000 -- (-2623.814) (-2614.883) (-2628.173) [-2617.710] * (-2619.379) [-2618.923] (-2619.582) (-2619.709) -- 0:04:57 468500 -- (-2624.455) (-2619.116) (-2633.456) [-2615.481] * (-2625.465) (-2620.773) [-2622.288] (-2616.547) -- 0:04:57 469000 -- (-2631.127) (-2613.014) [-2623.990] (-2629.648) * (-2623.588) [-2608.374] (-2624.328) (-2616.853) -- 0:04:57 469500 -- (-2614.033) [-2618.411] (-2621.865) (-2632.426) * (-2613.288) [-2619.889] (-2615.239) (-2617.921) -- 0:04:57 470000 -- (-2618.749) (-2618.249) (-2621.259) [-2622.707] * (-2619.907) [-2620.085] (-2621.266) (-2629.892) -- 0:04:56 Average standard deviation of split frequencies: 0.005091 470500 -- [-2619.679] (-2615.959) (-2619.638) (-2622.545) * (-2611.966) (-2614.301) [-2620.912] (-2629.453) -- 0:04:55 471000 -- (-2623.085) (-2618.176) [-2614.029] (-2638.441) * [-2622.362] (-2624.968) (-2621.267) (-2612.352) -- 0:04:56 471500 -- (-2624.533) (-2621.650) (-2617.902) [-2627.684] * (-2630.496) (-2629.267) (-2632.238) [-2612.669] -- 0:04:55 472000 -- (-2621.287) [-2620.768] (-2621.806) (-2625.362) * [-2620.830] (-2625.142) (-2619.325) (-2614.075) -- 0:04:55 472500 -- (-2622.088) [-2624.609] (-2621.685) (-2621.831) * (-2613.252) [-2620.468] (-2621.191) (-2621.302) -- 0:04:55 473000 -- [-2615.047] (-2623.347) (-2621.410) (-2623.976) * [-2615.564] (-2630.914) (-2620.900) (-2613.325) -- 0:04:55 473500 -- (-2628.060) (-2628.245) (-2619.133) [-2616.099] * [-2616.779] (-2627.013) (-2618.788) (-2625.038) -- 0:04:54 474000 -- (-2619.739) (-2631.553) [-2622.802] (-2620.414) * (-2630.427) [-2613.545] (-2616.918) (-2618.469) -- 0:04:54 474500 -- [-2617.373] (-2625.808) (-2615.926) (-2623.576) * (-2628.335) [-2629.566] (-2621.970) (-2619.907) -- 0:04:54 475000 -- [-2617.274] (-2620.842) (-2615.462) (-2618.137) * (-2627.077) (-2615.480) [-2622.819] (-2625.843) -- 0:04:54 Average standard deviation of split frequencies: 0.004704 475500 -- [-2618.047] (-2623.416) (-2632.792) (-2631.837) * [-2617.859] (-2616.742) (-2619.230) (-2621.905) -- 0:04:53 476000 -- [-2619.302] (-2621.548) (-2623.356) (-2629.638) * (-2620.849) [-2613.770] (-2616.111) (-2616.807) -- 0:04:52 476500 -- (-2614.029) (-2618.463) [-2615.791] (-2628.221) * (-2635.188) (-2624.874) [-2626.235] (-2618.481) -- 0:04:53 477000 -- (-2620.332) [-2616.755] (-2615.662) (-2626.073) * (-2623.591) (-2619.495) (-2623.023) [-2620.692] -- 0:04:52 477500 -- (-2625.589) (-2616.630) [-2612.467] (-2619.984) * (-2633.315) [-2620.515] (-2624.846) (-2625.387) -- 0:04:52 478000 -- (-2619.197) (-2621.809) (-2627.437) [-2618.762] * (-2626.452) [-2618.192] (-2626.068) (-2622.841) -- 0:04:52 478500 -- (-2621.443) (-2615.554) (-2618.632) [-2619.146] * (-2623.527) (-2617.216) [-2620.403] (-2620.627) -- 0:04:52 479000 -- (-2612.643) (-2617.417) (-2618.710) [-2620.482] * (-2620.318) (-2616.976) (-2619.812) [-2618.340] -- 0:04:51 479500 -- (-2617.480) (-2623.751) [-2614.305] (-2631.709) * (-2623.010) [-2619.452] (-2621.865) (-2621.506) -- 0:04:50 480000 -- (-2623.678) [-2624.140] (-2612.810) (-2627.262) * (-2617.854) (-2619.850) (-2623.141) [-2617.931] -- 0:04:51 Average standard deviation of split frequencies: 0.005312 480500 -- (-2616.353) [-2620.142] (-2615.531) (-2618.527) * (-2624.631) [-2618.546] (-2624.054) (-2624.186) -- 0:04:50 481000 -- (-2622.676) (-2619.447) [-2615.904] (-2627.902) * (-2620.832) (-2617.186) [-2617.346] (-2623.514) -- 0:04:50 481500 -- (-2620.221) (-2612.984) (-2615.263) [-2618.471] * [-2612.444] (-2625.548) (-2631.220) (-2623.272) -- 0:04:50 482000 -- (-2626.606) (-2616.911) [-2623.185] (-2612.661) * [-2616.527] (-2619.222) (-2630.457) (-2622.623) -- 0:04:50 482500 -- (-2626.140) (-2624.860) [-2620.211] (-2615.168) * [-2621.501] (-2616.886) (-2618.971) (-2621.460) -- 0:04:49 483000 -- (-2620.566) (-2630.831) [-2613.566] (-2616.316) * [-2619.802] (-2619.561) (-2620.786) (-2618.480) -- 0:04:49 483500 -- (-2626.948) (-2636.300) (-2624.805) [-2619.846] * (-2618.995) (-2620.392) [-2621.921] (-2630.158) -- 0:04:49 484000 -- (-2619.223) (-2622.866) [-2616.105] (-2626.238) * (-2626.116) [-2622.059] (-2630.752) (-2619.087) -- 0:04:48 484500 -- [-2618.783] (-2628.356) (-2616.857) (-2621.650) * (-2619.003) [-2622.120] (-2620.743) (-2616.882) -- 0:04:48 485000 -- (-2614.500) (-2625.431) [-2616.097] (-2618.001) * (-2623.893) [-2614.796] (-2614.748) (-2624.233) -- 0:04:47 Average standard deviation of split frequencies: 0.005739 485500 -- [-2622.252] (-2627.761) (-2626.602) (-2622.029) * (-2635.989) [-2615.304] (-2625.715) (-2622.685) -- 0:04:48 486000 -- (-2623.486) (-2623.440) (-2618.959) [-2616.403] * (-2617.450) [-2617.752] (-2615.376) (-2619.469) -- 0:04:47 486500 -- [-2614.140] (-2620.870) (-2613.669) (-2621.474) * (-2617.461) [-2622.775] (-2620.176) (-2617.034) -- 0:04:47 487000 -- [-2617.731] (-2616.707) (-2620.684) (-2626.187) * [-2621.828] (-2623.017) (-2621.404) (-2626.714) -- 0:04:47 487500 -- [-2617.780] (-2624.001) (-2613.783) (-2631.163) * (-2616.922) (-2617.439) [-2620.774] (-2628.906) -- 0:04:47 488000 -- [-2620.883] (-2617.659) (-2623.778) (-2619.444) * (-2619.858) [-2612.141] (-2619.041) (-2618.995) -- 0:04:46 488500 -- (-2621.896) (-2620.262) [-2630.015] (-2632.492) * [-2620.203] (-2621.948) (-2619.687) (-2617.242) -- 0:04:45 489000 -- (-2621.319) (-2621.475) [-2614.171] (-2629.353) * (-2625.947) (-2617.506) [-2616.001] (-2622.106) -- 0:04:46 489500 -- (-2625.502) (-2619.998) (-2623.727) [-2620.017] * (-2619.285) (-2626.290) (-2625.555) [-2617.609] -- 0:04:45 490000 -- (-2620.942) (-2625.255) (-2633.934) [-2616.460] * (-2617.547) (-2624.221) [-2618.053] (-2617.497) -- 0:04:45 Average standard deviation of split frequencies: 0.006005 490500 -- (-2618.100) (-2617.587) [-2614.012] (-2618.898) * (-2615.486) (-2619.979) [-2618.289] (-2626.629) -- 0:04:44 491000 -- (-2622.364) [-2620.391] (-2626.206) (-2620.237) * (-2623.635) [-2622.445] (-2622.429) (-2616.881) -- 0:04:45 491500 -- [-2616.393] (-2627.290) (-2614.003) (-2627.390) * (-2618.211) (-2615.174) (-2623.960) [-2611.704] -- 0:04:44 492000 -- (-2616.320) (-2615.047) (-2625.032) [-2621.272] * (-2628.890) (-2614.735) [-2624.481] (-2617.444) -- 0:04:43 492500 -- (-2616.923) (-2622.379) [-2617.827] (-2619.165) * [-2616.829] (-2624.293) (-2618.697) (-2626.893) -- 0:04:44 493000 -- (-2629.508) (-2616.227) [-2622.681] (-2626.580) * (-2616.246) [-2617.983] (-2616.800) (-2630.265) -- 0:04:43 493500 -- (-2632.060) (-2623.316) [-2619.880] (-2616.038) * (-2617.943) [-2619.501] (-2616.681) (-2620.997) -- 0:04:43 494000 -- (-2634.019) (-2616.332) [-2619.731] (-2622.722) * [-2612.914] (-2624.774) (-2621.414) (-2622.586) -- 0:04:42 494500 -- (-2624.457) [-2619.731] (-2623.861) (-2620.584) * (-2616.236) [-2621.977] (-2613.350) (-2620.411) -- 0:04:43 495000 -- (-2619.508) [-2612.779] (-2627.898) (-2622.541) * (-2619.584) [-2617.338] (-2620.421) (-2616.351) -- 0:04:42 Average standard deviation of split frequencies: 0.006574 495500 -- (-2620.270) (-2620.256) [-2617.557] (-2626.729) * (-2644.708) [-2618.276] (-2628.251) (-2614.054) -- 0:04:42 496000 -- (-2617.566) [-2614.163] (-2622.807) (-2626.026) * (-2631.145) [-2617.798] (-2630.677) (-2617.744) -- 0:04:41 496500 -- [-2612.593] (-2615.938) (-2620.789) (-2621.950) * (-2623.113) (-2619.613) [-2618.372] (-2625.142) -- 0:04:41 497000 -- (-2637.519) [-2621.383] (-2619.435) (-2619.306) * (-2622.293) (-2626.022) (-2628.966) [-2616.872] -- 0:04:41 497500 -- (-2619.512) (-2620.353) [-2623.013] (-2625.419) * [-2621.187] (-2621.075) (-2623.564) (-2630.855) -- 0:04:40 498000 -- (-2618.896) [-2619.167] (-2622.214) (-2625.412) * (-2617.726) (-2632.234) (-2612.165) [-2617.251] -- 0:04:41 498500 -- [-2619.009] (-2625.045) (-2620.020) (-2616.891) * [-2621.792] (-2624.337) (-2629.102) (-2620.363) -- 0:04:40 499000 -- [-2620.070] (-2615.220) (-2620.701) (-2624.387) * [-2616.070] (-2630.839) (-2620.826) (-2624.698) -- 0:04:40 499500 -- [-2623.138] (-2611.900) (-2619.017) (-2631.713) * [-2618.562] (-2618.882) (-2619.835) (-2624.041) -- 0:04:39 500000 -- [-2622.837] (-2616.558) (-2617.873) (-2631.086) * [-2616.288] (-2619.066) (-2621.311) (-2624.903) -- 0:04:40 Average standard deviation of split frequencies: 0.007454 500500 -- (-2626.495) (-2618.000) [-2617.265] (-2615.450) * [-2617.183] (-2623.569) (-2617.641) (-2626.566) -- 0:04:39 501000 -- (-2616.815) (-2623.757) [-2615.346] (-2621.958) * [-2619.222] (-2621.849) (-2619.664) (-2615.498) -- 0:04:38 501500 -- (-2620.145) [-2610.513] (-2612.816) (-2623.827) * (-2618.083) (-2617.166) (-2625.256) [-2625.848] -- 0:04:39 502000 -- (-2617.156) [-2618.428] (-2616.481) (-2628.286) * (-2623.881) (-2616.492) [-2620.424] (-2632.713) -- 0:04:38 502500 -- (-2621.088) (-2627.593) (-2634.222) [-2621.939] * (-2627.905) [-2620.822] (-2622.695) (-2620.065) -- 0:04:38 503000 -- (-2615.222) (-2618.968) [-2619.158] (-2622.328) * [-2614.867] (-2618.062) (-2624.770) (-2618.088) -- 0:04:37 503500 -- (-2622.443) (-2629.300) [-2619.875] (-2622.475) * (-2620.013) [-2615.109] (-2619.918) (-2625.879) -- 0:04:38 504000 -- [-2617.318] (-2627.580) (-2623.643) (-2622.672) * (-2624.591) (-2617.226) [-2619.354] (-2623.954) -- 0:04:37 504500 -- [-2621.865] (-2620.485) (-2623.438) (-2619.014) * (-2626.233) (-2624.444) [-2619.206] (-2627.417) -- 0:04:36 505000 -- (-2619.681) (-2623.629) (-2616.829) [-2616.868] * [-2620.993] (-2622.399) (-2621.666) (-2627.377) -- 0:04:36 Average standard deviation of split frequencies: 0.007298 505500 -- (-2613.998) [-2614.904] (-2625.875) (-2623.087) * (-2623.853) [-2620.090] (-2628.221) (-2619.656) -- 0:04:36 506000 -- (-2615.504) (-2619.713) (-2630.987) [-2619.569] * (-2625.922) (-2622.144) (-2613.070) [-2628.971] -- 0:04:36 506500 -- (-2619.146) [-2608.944] (-2620.798) (-2620.528) * (-2621.433) [-2619.876] (-2615.095) (-2624.737) -- 0:04:35 507000 -- (-2620.700) (-2618.772) (-2622.506) [-2616.075] * (-2619.678) (-2617.754) (-2625.637) [-2620.410] -- 0:04:36 507500 -- [-2622.955] (-2623.795) (-2622.169) (-2619.643) * [-2616.382] (-2626.620) (-2620.795) (-2615.920) -- 0:04:35 508000 -- (-2629.123) [-2619.037] (-2626.838) (-2627.768) * (-2619.707) (-2625.368) [-2621.713] (-2616.236) -- 0:04:35 508500 -- [-2617.871] (-2615.996) (-2632.060) (-2624.305) * (-2623.736) [-2621.838] (-2619.671) (-2620.275) -- 0:04:34 509000 -- [-2615.854] (-2616.585) (-2622.444) (-2623.100) * (-2617.082) (-2619.190) (-2622.482) [-2617.499] -- 0:04:34 509500 -- (-2621.036) [-2617.644] (-2622.519) (-2617.127) * [-2625.364] (-2617.133) (-2624.452) (-2627.799) -- 0:04:34 510000 -- [-2616.612] (-2621.715) (-2624.357) (-2624.686) * [-2616.602] (-2617.634) (-2624.094) (-2624.537) -- 0:04:33 Average standard deviation of split frequencies: 0.008693 510500 -- (-2615.214) (-2625.785) (-2618.465) [-2621.398] * (-2620.090) (-2620.915) (-2624.082) [-2623.046] -- 0:04:34 511000 -- [-2613.625] (-2618.019) (-2636.899) (-2621.058) * (-2618.619) (-2619.859) [-2616.444] (-2618.631) -- 0:04:33 511500 -- (-2619.525) (-2624.804) [-2624.785] (-2619.070) * (-2622.035) (-2614.554) [-2622.431] (-2624.016) -- 0:04:33 512000 -- (-2636.320) [-2618.022] (-2617.615) (-2618.603) * (-2628.486) [-2619.636] (-2613.750) (-2621.880) -- 0:04:32 512500 -- [-2622.708] (-2628.963) (-2622.419) (-2626.473) * (-2625.741) [-2612.956] (-2620.979) (-2626.952) -- 0:04:33 513000 -- [-2621.726] (-2624.396) (-2613.377) (-2625.710) * (-2623.526) [-2617.841] (-2625.789) (-2625.059) -- 0:04:32 513500 -- [-2613.311] (-2622.051) (-2613.536) (-2624.193) * [-2615.354] (-2626.019) (-2622.639) (-2633.125) -- 0:04:31 514000 -- (-2621.821) (-2622.189) [-2617.118] (-2626.925) * (-2625.561) (-2619.539) (-2625.314) [-2623.064] -- 0:04:32 514500 -- (-2623.093) (-2620.310) (-2622.629) [-2623.686] * (-2623.608) [-2622.496] (-2622.189) (-2621.803) -- 0:04:31 515000 -- (-2617.864) (-2627.191) [-2624.362] (-2624.140) * (-2621.400) [-2613.699] (-2619.421) (-2618.121) -- 0:04:31 Average standard deviation of split frequencies: 0.007994 515500 -- (-2616.526) (-2617.628) (-2619.987) [-2619.579] * (-2628.929) (-2618.035) (-2623.979) [-2621.333] -- 0:04:30 516000 -- [-2617.221] (-2624.320) (-2617.295) (-2622.946) * (-2617.213) (-2619.055) (-2619.761) [-2616.303] -- 0:04:31 516500 -- (-2617.847) (-2624.889) [-2616.692] (-2630.633) * (-2615.073) (-2616.725) [-2622.736] (-2622.964) -- 0:04:30 517000 -- (-2623.179) (-2620.971) (-2626.720) [-2611.225] * [-2616.071] (-2617.321) (-2626.835) (-2616.525) -- 0:04:29 517500 -- (-2625.710) (-2620.770) (-2619.726) [-2621.456] * (-2618.097) (-2618.339) (-2627.601) [-2616.916] -- 0:04:30 518000 -- (-2618.620) (-2621.653) [-2615.438] (-2627.570) * (-2616.896) [-2616.973] (-2617.652) (-2628.047) -- 0:04:29 518500 -- [-2620.331] (-2620.867) (-2623.431) (-2624.393) * (-2623.963) (-2620.732) [-2616.515] (-2621.567) -- 0:04:29 519000 -- [-2617.464] (-2617.278) (-2629.016) (-2632.383) * [-2612.694] (-2617.083) (-2615.553) (-2622.621) -- 0:04:28 519500 -- [-2616.759] (-2620.341) (-2631.601) (-2624.947) * (-2622.383) (-2616.910) (-2621.430) [-2613.860] -- 0:04:29 520000 -- (-2627.171) (-2616.918) (-2618.826) [-2612.406] * (-2621.154) (-2618.201) (-2621.131) [-2616.706] -- 0:04:28 Average standard deviation of split frequencies: 0.007545 520500 -- (-2629.213) (-2618.266) (-2625.684) [-2615.814] * (-2614.710) [-2622.089] (-2622.148) (-2624.524) -- 0:04:28 521000 -- (-2623.906) [-2626.800] (-2616.031) (-2618.733) * (-2611.353) (-2621.484) [-2626.692] (-2627.769) -- 0:04:27 521500 -- (-2618.672) [-2614.706] (-2620.456) (-2615.696) * (-2619.343) [-2616.574] (-2619.857) (-2617.403) -- 0:04:27 522000 -- (-2621.187) (-2621.161) [-2623.293] (-2616.174) * [-2618.508] (-2624.476) (-2628.382) (-2624.542) -- 0:04:27 522500 -- (-2619.760) (-2631.709) (-2626.461) [-2624.058] * [-2616.980] (-2623.463) (-2630.618) (-2624.286) -- 0:04:26 523000 -- [-2621.160] (-2627.222) (-2627.475) (-2622.218) * (-2617.039) [-2614.581] (-2616.615) (-2624.165) -- 0:04:27 523500 -- (-2618.490) (-2624.950) (-2624.950) [-2614.294] * (-2621.987) (-2613.670) (-2617.537) [-2617.117] -- 0:04:26 524000 -- (-2619.698) [-2626.338] (-2618.720) (-2618.056) * (-2619.116) [-2618.356] (-2617.954) (-2620.257) -- 0:04:26 524500 -- (-2623.310) (-2618.761) (-2618.856) [-2624.270] * (-2623.150) (-2625.303) [-2617.851] (-2620.065) -- 0:04:25 525000 -- [-2620.171] (-2617.345) (-2623.634) (-2616.808) * [-2619.697] (-2629.523) (-2617.051) (-2612.241) -- 0:04:26 Average standard deviation of split frequencies: 0.007244 525500 -- (-2620.931) [-2624.951] (-2620.886) (-2621.859) * (-2628.601) (-2620.146) (-2626.416) [-2621.237] -- 0:04:25 526000 -- (-2629.054) [-2621.639] (-2627.662) (-2625.948) * (-2620.058) (-2620.349) (-2621.691) [-2620.519] -- 0:04:24 526500 -- (-2618.449) (-2615.758) [-2616.570] (-2619.896) * (-2613.902) (-2613.957) [-2612.790] (-2617.422) -- 0:04:24 527000 -- (-2620.182) (-2620.927) [-2618.795] (-2617.655) * (-2622.117) (-2622.676) [-2621.658] (-2619.802) -- 0:04:24 527500 -- (-2612.574) (-2623.961) (-2615.459) [-2618.776] * [-2619.211] (-2622.371) (-2623.582) (-2631.873) -- 0:04:24 528000 -- (-2619.984) (-2619.804) (-2622.163) [-2619.569] * (-2620.361) (-2625.970) [-2616.884] (-2626.688) -- 0:04:23 528500 -- (-2613.288) (-2620.790) (-2630.797) [-2617.587] * (-2613.690) (-2629.775) (-2626.184) [-2617.499] -- 0:04:24 529000 -- (-2625.777) (-2625.758) (-2627.558) [-2615.368] * (-2620.860) (-2630.033) [-2616.373] (-2623.112) -- 0:04:23 529500 -- [-2629.592] (-2612.209) (-2625.043) (-2621.146) * (-2624.357) (-2635.228) [-2619.354] (-2611.958) -- 0:04:23 530000 -- (-2626.852) [-2620.294] (-2616.000) (-2624.311) * (-2621.396) (-2647.280) (-2626.163) [-2627.318] -- 0:04:22 Average standard deviation of split frequencies: 0.007107 530500 -- [-2624.379] (-2614.127) (-2630.404) (-2622.694) * [-2622.995] (-2624.919) (-2624.531) (-2620.974) -- 0:04:22 531000 -- (-2622.314) [-2613.768] (-2622.023) (-2619.831) * (-2618.212) (-2631.154) (-2615.274) [-2622.193] -- 0:04:22 531500 -- (-2619.720) [-2616.045] (-2615.514) (-2620.748) * (-2616.113) [-2630.816] (-2618.076) (-2619.691) -- 0:04:21 532000 -- (-2627.123) (-2626.885) [-2622.507] (-2614.005) * [-2624.643] (-2628.440) (-2616.906) (-2620.558) -- 0:04:22 532500 -- (-2625.345) (-2617.528) [-2619.494] (-2623.113) * (-2619.375) (-2619.610) (-2619.823) [-2622.616] -- 0:04:21 533000 -- [-2614.578] (-2622.256) (-2636.500) (-2624.971) * (-2621.463) (-2626.170) (-2618.165) [-2628.827] -- 0:04:21 533500 -- (-2613.899) (-2626.073) (-2623.193) [-2617.831] * (-2622.289) [-2621.266] (-2617.654) (-2634.432) -- 0:04:20 534000 -- [-2619.161] (-2630.616) (-2626.762) (-2616.415) * [-2623.772] (-2616.707) (-2622.613) (-2621.045) -- 0:04:20 534500 -- (-2624.586) (-2632.457) (-2621.644) [-2615.909] * (-2617.806) [-2617.858] (-2610.543) (-2621.033) -- 0:04:20 535000 -- (-2623.122) (-2627.161) (-2623.113) [-2617.133] * (-2622.789) [-2617.691] (-2619.866) (-2622.044) -- 0:04:19 Average standard deviation of split frequencies: 0.007256 535500 -- (-2618.129) (-2624.725) (-2619.709) [-2617.451] * (-2619.813) (-2624.728) [-2616.728] (-2625.608) -- 0:04:19 536000 -- (-2620.579) [-2630.266] (-2619.086) (-2621.568) * (-2623.034) [-2622.995] (-2625.336) (-2630.405) -- 0:04:19 536500 -- (-2617.479) (-2621.883) [-2622.108] (-2624.521) * (-2615.541) (-2619.454) (-2624.389) [-2627.823] -- 0:04:19 537000 -- (-2624.916) [-2623.368] (-2623.165) (-2620.790) * (-2625.392) (-2617.230) (-2625.484) [-2629.659] -- 0:04:18 537500 -- (-2622.713) (-2629.277) (-2631.787) [-2614.667] * (-2628.887) (-2616.239) [-2614.193] (-2621.573) -- 0:04:19 538000 -- (-2618.537) [-2619.755] (-2623.246) (-2628.946) * (-2632.821) (-2621.279) [-2621.754] (-2627.106) -- 0:04:18 538500 -- (-2618.598) (-2619.427) (-2630.166) [-2624.882] * (-2627.508) [-2615.313] (-2611.759) (-2617.400) -- 0:04:17 539000 -- [-2627.417] (-2627.973) (-2630.203) (-2621.832) * (-2624.044) (-2617.883) [-2619.804] (-2616.652) -- 0:04:17 539500 -- (-2618.908) [-2622.070] (-2619.782) (-2633.231) * (-2621.114) (-2624.663) [-2622.109] (-2623.317) -- 0:04:17 540000 -- [-2620.648] (-2611.003) (-2622.837) (-2626.807) * (-2624.131) [-2628.627] (-2622.347) (-2622.726) -- 0:04:17 Average standard deviation of split frequencies: 0.007629 540500 -- (-2620.226) [-2620.289] (-2618.371) (-2621.837) * (-2623.185) (-2625.244) [-2618.437] (-2625.359) -- 0:04:16 541000 -- (-2618.039) [-2613.788] (-2627.696) (-2620.572) * (-2619.981) (-2624.760) (-2626.566) [-2623.826] -- 0:04:17 541500 -- (-2623.317) (-2627.070) (-2618.589) [-2620.183] * [-2628.069] (-2616.448) (-2628.920) (-2624.203) -- 0:04:16 542000 -- (-2623.133) [-2621.253] (-2626.749) (-2612.770) * (-2616.844) (-2613.989) (-2625.256) [-2618.379] -- 0:04:16 542500 -- (-2616.009) [-2621.722] (-2623.601) (-2613.221) * [-2620.509] (-2620.550) (-2622.982) (-2620.376) -- 0:04:15 543000 -- [-2621.189] (-2625.007) (-2621.364) (-2608.482) * (-2629.798) [-2615.914] (-2624.093) (-2617.205) -- 0:04:15 543500 -- [-2620.278] (-2624.589) (-2618.381) (-2614.272) * (-2619.292) (-2617.811) (-2628.706) [-2615.703] -- 0:04:15 544000 -- (-2627.866) (-2625.464) (-2628.097) [-2615.990] * (-2628.988) (-2614.943) (-2618.299) [-2619.372] -- 0:04:14 544500 -- (-2617.744) (-2628.963) [-2622.746] (-2627.194) * (-2629.832) (-2622.844) [-2619.164] (-2618.600) -- 0:04:14 545000 -- (-2622.730) (-2627.058) (-2620.393) [-2617.427] * (-2626.041) (-2615.012) (-2621.136) [-2621.556] -- 0:04:14 Average standard deviation of split frequencies: 0.008490 545500 -- (-2621.147) (-2617.611) (-2616.522) [-2612.712] * [-2633.056] (-2633.324) (-2624.439) (-2615.043) -- 0:04:14 546000 -- [-2616.596] (-2618.492) (-2619.415) (-2619.616) * (-2636.716) [-2623.034] (-2619.916) (-2618.468) -- 0:04:13 546500 -- (-2624.062) (-2619.562) (-2618.385) [-2624.199] * [-2614.281] (-2628.583) (-2629.689) (-2629.791) -- 0:04:13 547000 -- [-2624.862] (-2620.498) (-2616.214) (-2620.661) * (-2613.462) (-2621.760) [-2623.954] (-2622.307) -- 0:04:13 547500 -- [-2623.549] (-2622.212) (-2624.054) (-2618.043) * (-2617.456) (-2620.357) (-2626.796) [-2620.700] -- 0:04:12 548000 -- [-2615.901] (-2623.349) (-2627.227) (-2619.483) * (-2615.016) [-2622.117] (-2624.419) (-2623.611) -- 0:04:12 548500 -- [-2616.312] (-2615.035) (-2632.725) (-2615.914) * (-2628.713) (-2622.857) (-2625.586) [-2611.020] -- 0:04:12 549000 -- (-2619.000) (-2619.993) (-2621.439) [-2623.787] * (-2622.452) (-2625.422) [-2619.796] (-2626.316) -- 0:04:12 549500 -- (-2615.194) (-2618.356) [-2618.164] (-2627.212) * (-2629.637) (-2619.110) (-2617.924) [-2618.647] -- 0:04:11 550000 -- (-2622.292) (-2620.147) [-2626.908] (-2623.565) * (-2618.331) (-2620.935) (-2622.617) [-2618.079] -- 0:04:11 Average standard deviation of split frequencies: 0.008061 550500 -- [-2621.001] (-2629.325) (-2617.860) (-2620.532) * [-2619.021] (-2620.058) (-2620.261) (-2618.761) -- 0:04:11 551000 -- [-2629.607] (-2621.947) (-2620.493) (-2621.438) * (-2624.117) (-2619.161) (-2619.452) [-2615.862] -- 0:04:10 551500 -- (-2621.809) (-2628.630) [-2631.618] (-2625.971) * (-2624.215) (-2620.254) (-2622.957) [-2614.402] -- 0:04:10 552000 -- [-2615.887] (-2623.995) (-2625.200) (-2629.980) * [-2624.521] (-2621.869) (-2625.600) (-2615.202) -- 0:04:10 552500 -- (-2622.767) [-2615.181] (-2619.822) (-2621.771) * (-2620.784) (-2617.060) (-2614.923) [-2616.334] -- 0:04:10 553000 -- (-2614.549) (-2616.209) (-2616.122) [-2618.029] * (-2622.999) (-2618.128) [-2614.567] (-2617.876) -- 0:04:09 553500 -- [-2619.900] (-2618.033) (-2625.031) (-2614.598) * (-2616.727) (-2621.311) (-2620.940) [-2620.521] -- 0:04:10 554000 -- (-2620.259) (-2627.139) (-2618.731) [-2623.863] * [-2621.083] (-2621.637) (-2624.027) (-2636.972) -- 0:04:09 554500 -- (-2629.214) (-2620.836) (-2613.452) [-2617.676] * (-2624.654) (-2619.589) [-2614.440] (-2628.169) -- 0:04:09 555000 -- (-2625.939) [-2619.904] (-2617.052) (-2625.806) * (-2619.147) (-2621.975) [-2620.829] (-2629.945) -- 0:04:08 Average standard deviation of split frequencies: 0.008196 555500 -- (-2619.369) (-2619.213) [-2619.574] (-2623.641) * (-2628.174) (-2617.226) (-2624.663) [-2621.289] -- 0:04:08 556000 -- (-2621.896) [-2618.244] (-2622.209) (-2626.638) * (-2623.351) (-2630.648) [-2613.629] (-2624.308) -- 0:04:08 556500 -- (-2620.736) [-2617.165] (-2623.539) (-2616.776) * (-2617.300) (-2617.398) [-2621.644] (-2628.438) -- 0:04:07 557000 -- [-2620.009] (-2631.779) (-2626.117) (-2615.152) * [-2614.979] (-2628.996) (-2614.886) (-2623.761) -- 0:04:07 557500 -- (-2619.560) (-2623.297) (-2625.339) [-2622.667] * (-2623.498) (-2619.261) (-2618.336) [-2624.146] -- 0:04:07 558000 -- [-2621.879] (-2622.691) (-2625.107) (-2626.674) * (-2620.206) (-2638.223) (-2618.711) [-2612.898] -- 0:04:07 558500 -- (-2625.527) (-2619.125) [-2619.045] (-2620.128) * [-2618.418] (-2621.386) (-2616.697) (-2618.535) -- 0:04:06 559000 -- [-2625.312] (-2627.226) (-2624.719) (-2631.133) * (-2631.482) [-2619.936] (-2621.832) (-2616.465) -- 0:04:06 559500 -- (-2620.389) (-2632.172) (-2620.190) [-2621.715] * (-2620.877) (-2623.070) [-2617.707] (-2624.222) -- 0:04:06 560000 -- (-2625.286) (-2623.465) (-2615.495) [-2623.373] * (-2613.275) (-2624.089) (-2618.860) [-2621.176] -- 0:04:05 Average standard deviation of split frequencies: 0.008058 560500 -- (-2625.741) (-2619.008) [-2624.067] (-2617.664) * (-2624.984) (-2629.905) [-2621.232] (-2617.132) -- 0:04:05 561000 -- [-2610.330] (-2636.665) (-2618.182) (-2625.575) * (-2625.154) [-2625.198] (-2615.570) (-2620.830) -- 0:04:05 561500 -- (-2618.922) (-2623.246) [-2615.313] (-2621.310) * (-2617.389) (-2622.938) (-2618.217) [-2617.681] -- 0:04:05 562000 -- (-2629.873) [-2614.662] (-2620.843) (-2613.982) * (-2621.148) (-2627.797) [-2622.552] (-2625.234) -- 0:04:04 562500 -- (-2616.749) (-2624.877) (-2622.371) [-2617.157] * [-2614.498] (-2625.119) (-2620.209) (-2623.604) -- 0:04:04 563000 -- (-2620.522) (-2624.991) (-2618.434) [-2627.235] * (-2615.901) [-2625.818] (-2619.809) (-2616.647) -- 0:04:04 563500 -- [-2614.497] (-2621.441) (-2627.581) (-2620.811) * [-2612.900] (-2616.335) (-2617.283) (-2623.237) -- 0:04:04 564000 -- (-2629.071) (-2617.921) [-2615.234] (-2628.238) * (-2619.871) (-2624.013) (-2614.691) [-2624.782] -- 0:04:03 564500 -- (-2618.817) (-2629.064) [-2624.176] (-2619.299) * [-2619.207] (-2628.379) (-2618.118) (-2632.126) -- 0:04:03 565000 -- [-2614.343] (-2622.185) (-2624.878) (-2615.739) * (-2628.650) (-2615.921) (-2620.075) [-2620.773] -- 0:04:03 Average standard deviation of split frequencies: 0.008884 565500 -- [-2614.825] (-2617.765) (-2626.941) (-2616.918) * (-2622.809) (-2622.537) [-2611.366] (-2615.866) -- 0:04:02 566000 -- (-2621.602) [-2614.101] (-2629.444) (-2615.926) * (-2626.440) (-2624.519) [-2614.722] (-2619.456) -- 0:04:02 566500 -- (-2618.003) (-2621.994) (-2624.060) [-2617.140] * (-2620.733) (-2614.207) (-2621.447) [-2619.243] -- 0:04:02 567000 -- (-2622.373) (-2619.107) [-2612.823] (-2617.035) * (-2619.980) [-2615.573] (-2631.957) (-2623.763) -- 0:04:02 567500 -- (-2615.152) (-2622.407) (-2626.025) [-2617.091] * (-2617.813) [-2617.922] (-2629.557) (-2617.558) -- 0:04:01 568000 -- (-2621.091) (-2621.497) [-2617.138] (-2619.070) * (-2620.925) (-2613.941) (-2626.318) [-2620.261] -- 0:04:01 568500 -- (-2631.217) (-2618.328) (-2620.253) [-2611.670] * (-2616.677) [-2619.850] (-2632.049) (-2624.720) -- 0:04:01 569000 -- [-2614.957] (-2623.891) (-2621.367) (-2628.537) * (-2622.315) (-2631.139) (-2621.804) [-2623.291] -- 0:04:00 569500 -- (-2614.785) (-2622.409) (-2624.416) [-2624.709] * (-2623.658) [-2621.044] (-2623.120) (-2625.319) -- 0:04:00 570000 -- [-2613.944] (-2626.178) (-2625.761) (-2617.412) * (-2626.739) (-2620.873) (-2617.141) [-2613.807] -- 0:04:00 Average standard deviation of split frequencies: 0.008398 570500 -- (-2622.410) [-2614.148] (-2623.689) (-2624.181) * (-2614.119) (-2621.807) [-2613.086] (-2618.346) -- 0:04:00 571000 -- [-2618.429] (-2617.168) (-2620.480) (-2624.888) * (-2620.232) (-2627.066) (-2613.257) [-2615.565] -- 0:03:59 571500 -- (-2622.293) [-2616.372] (-2616.750) (-2622.588) * [-2624.713] (-2627.879) (-2627.537) (-2625.234) -- 0:03:59 572000 -- (-2631.782) [-2620.509] (-2624.152) (-2630.642) * [-2618.578] (-2623.468) (-2622.197) (-2614.291) -- 0:03:59 572500 -- (-2616.963) (-2617.557) (-2616.978) [-2617.312] * (-2617.829) (-2624.898) [-2616.876] (-2612.663) -- 0:03:58 573000 -- (-2615.949) [-2621.513] (-2618.185) (-2620.051) * (-2623.031) (-2627.340) (-2632.132) [-2619.771] -- 0:03:58 573500 -- (-2616.760) [-2611.087] (-2613.715) (-2618.652) * (-2624.122) (-2629.978) (-2620.136) [-2620.033] -- 0:03:58 574000 -- (-2622.693) (-2625.631) [-2624.132] (-2621.846) * [-2617.541] (-2631.212) (-2620.962) (-2624.922) -- 0:03:58 574500 -- [-2625.471] (-2617.551) (-2619.988) (-2619.069) * (-2617.764) (-2621.710) [-2616.560] (-2614.269) -- 0:03:57 575000 -- (-2619.007) (-2617.929) (-2625.678) [-2625.892] * (-2624.118) [-2618.495] (-2618.286) (-2613.750) -- 0:03:57 Average standard deviation of split frequencies: 0.007161 575500 -- (-2623.497) (-2620.579) [-2615.226] (-2622.221) * [-2623.252] (-2620.794) (-2613.779) (-2621.239) -- 0:03:57 576000 -- [-2616.462] (-2625.616) (-2629.126) (-2617.968) * (-2625.227) (-2621.857) (-2617.624) [-2619.816] -- 0:03:57 576500 -- [-2620.469] (-2631.116) (-2624.374) (-2619.468) * [-2621.776] (-2623.173) (-2624.151) (-2619.374) -- 0:03:56 577000 -- (-2622.343) (-2620.997) (-2620.281) [-2617.869] * (-2622.334) [-2621.284] (-2623.936) (-2617.167) -- 0:03:56 577500 -- (-2622.369) (-2615.137) [-2622.373] (-2628.293) * (-2621.232) (-2624.370) (-2617.498) [-2617.956] -- 0:03:56 578000 -- (-2629.491) (-2611.701) (-2625.294) [-2617.289] * (-2623.377) [-2618.355] (-2619.560) (-2622.472) -- 0:03:55 578500 -- [-2623.600] (-2636.127) (-2621.728) (-2625.189) * (-2626.924) [-2616.432] (-2623.766) (-2621.400) -- 0:03:55 579000 -- [-2622.146] (-2620.454) (-2632.930) (-2628.397) * [-2617.391] (-2622.150) (-2624.200) (-2615.317) -- 0:03:55 579500 -- (-2621.555) (-2619.606) [-2620.966] (-2631.602) * [-2617.280] (-2623.333) (-2627.563) (-2617.358) -- 0:03:55 580000 -- (-2627.054) (-2616.403) [-2616.510] (-2625.997) * (-2634.915) [-2616.512] (-2619.486) (-2623.152) -- 0:03:54 Average standard deviation of split frequencies: 0.006359 580500 -- (-2624.577) (-2621.559) (-2617.989) [-2615.818] * (-2620.699) (-2613.607) [-2616.105] (-2621.584) -- 0:03:54 581000 -- (-2624.815) [-2619.808] (-2619.832) (-2623.756) * (-2623.727) (-2625.723) [-2621.985] (-2612.894) -- 0:03:54 581500 -- (-2626.101) (-2619.051) [-2621.130] (-2621.100) * (-2615.540) (-2621.664) [-2612.829] (-2621.892) -- 0:03:53 582000 -- (-2614.425) [-2618.381] (-2631.849) (-2627.396) * (-2626.965) (-2624.543) [-2621.258] (-2618.513) -- 0:03:53 582500 -- (-2625.139) [-2617.001] (-2621.634) (-2616.617) * (-2618.561) [-2625.000] (-2627.809) (-2624.236) -- 0:03:53 583000 -- (-2625.543) (-2622.789) (-2621.141) [-2618.242] * (-2624.532) (-2614.062) (-2630.636) [-2618.656] -- 0:03:53 583500 -- (-2616.709) [-2624.437] (-2616.515) (-2623.065) * (-2624.461) (-2624.583) (-2623.549) [-2618.207] -- 0:03:52 584000 -- [-2621.781] (-2627.284) (-2618.533) (-2627.678) * (-2625.036) (-2621.566) (-2621.117) [-2618.749] -- 0:03:52 584500 -- [-2621.924] (-2624.353) (-2626.196) (-2627.008) * (-2623.761) (-2635.770) [-2617.193] (-2628.750) -- 0:03:52 585000 -- [-2620.078] (-2632.190) (-2623.335) (-2614.451) * (-2626.687) (-2636.582) [-2615.080] (-2613.854) -- 0:03:51 Average standard deviation of split frequencies: 0.006704 585500 -- (-2619.152) (-2620.489) (-2619.414) [-2617.945] * (-2620.715) (-2629.741) [-2615.632] (-2627.898) -- 0:03:51 586000 -- [-2615.048] (-2629.155) (-2620.757) (-2617.031) * (-2615.261) (-2628.099) [-2613.723] (-2622.662) -- 0:03:51 586500 -- [-2620.143] (-2625.725) (-2619.336) (-2616.961) * (-2617.461) [-2617.933] (-2615.552) (-2615.686) -- 0:03:51 587000 -- (-2618.124) [-2616.204] (-2623.569) (-2622.262) * (-2617.161) [-2625.457] (-2625.427) (-2622.415) -- 0:03:50 587500 -- [-2617.259] (-2614.327) (-2626.687) (-2626.380) * (-2626.704) [-2622.951] (-2615.885) (-2615.875) -- 0:03:50 588000 -- (-2615.711) (-2617.548) [-2620.757] (-2632.181) * (-2619.972) (-2622.472) [-2622.924] (-2616.755) -- 0:03:50 588500 -- (-2616.778) [-2618.107] (-2617.993) (-2626.765) * [-2615.993] (-2618.783) (-2619.145) (-2615.319) -- 0:03:50 589000 -- (-2624.158) (-2621.086) [-2624.302] (-2619.155) * [-2613.519] (-2620.295) (-2619.175) (-2622.074) -- 0:03:49 589500 -- [-2619.720] (-2621.003) (-2628.053) (-2627.132) * [-2617.987] (-2615.635) (-2620.661) (-2631.060) -- 0:03:49 590000 -- [-2627.491] (-2615.387) (-2622.053) (-2621.454) * [-2624.183] (-2615.042) (-2630.243) (-2629.053) -- 0:03:49 Average standard deviation of split frequencies: 0.007249 590500 -- (-2624.285) [-2614.337] (-2635.054) (-2628.566) * (-2613.564) [-2623.271] (-2628.434) (-2620.816) -- 0:03:48 591000 -- (-2620.619) (-2616.116) [-2613.119] (-2628.071) * (-2621.703) (-2615.617) (-2622.339) [-2620.268] -- 0:03:48 591500 -- (-2624.839) (-2623.040) [-2626.116] (-2620.105) * (-2629.653) [-2619.811] (-2615.065) (-2616.218) -- 0:03:48 592000 -- [-2621.302] (-2631.495) (-2619.524) (-2623.034) * [-2618.453] (-2618.909) (-2617.378) (-2623.630) -- 0:03:48 592500 -- (-2625.689) (-2627.573) [-2618.820] (-2620.341) * [-2615.159] (-2623.873) (-2623.971) (-2628.866) -- 0:03:47 593000 -- (-2619.744) (-2623.282) (-2615.995) [-2616.853] * [-2614.454] (-2620.239) (-2631.020) (-2616.811) -- 0:03:47 593500 -- (-2619.632) (-2624.508) [-2615.285] (-2623.706) * [-2617.701] (-2617.414) (-2621.423) (-2622.494) -- 0:03:47 594000 -- [-2616.940] (-2624.823) (-2616.015) (-2620.122) * [-2618.814] (-2618.401) (-2622.454) (-2624.537) -- 0:03:46 594500 -- (-2620.618) (-2622.822) [-2620.119] (-2624.228) * (-2613.863) [-2619.065] (-2621.830) (-2621.154) -- 0:03:46 595000 -- (-2616.119) (-2615.964) [-2618.337] (-2625.019) * (-2619.791) (-2623.210) (-2622.913) [-2622.953] -- 0:03:46 Average standard deviation of split frequencies: 0.006855 595500 -- (-2629.239) (-2621.966) [-2611.960] (-2621.375) * (-2629.685) (-2618.346) (-2620.848) [-2615.568] -- 0:03:46 596000 -- (-2623.378) (-2620.926) [-2615.628] (-2621.502) * (-2617.846) [-2617.575] (-2617.321) (-2622.105) -- 0:03:45 596500 -- (-2622.020) (-2626.643) [-2622.444] (-2626.352) * [-2636.000] (-2623.604) (-2625.582) (-2618.515) -- 0:03:45 597000 -- (-2622.160) (-2618.852) [-2613.555] (-2633.938) * (-2624.883) (-2618.048) (-2624.705) [-2617.761] -- 0:03:45 597500 -- (-2622.428) [-2613.204] (-2621.032) (-2619.576) * (-2620.214) (-2631.802) (-2625.861) [-2619.010] -- 0:03:44 598000 -- (-2627.236) (-2629.360) [-2616.547] (-2620.696) * (-2614.391) [-2617.623] (-2619.558) (-2619.091) -- 0:03:44 598500 -- [-2617.902] (-2618.794) (-2618.737) (-2633.045) * [-2622.921] (-2626.348) (-2624.663) (-2615.963) -- 0:03:44 599000 -- (-2629.095) (-2621.817) [-2611.813] (-2617.967) * (-2618.590) (-2620.166) [-2618.594] (-2636.250) -- 0:03:44 599500 -- [-2616.489] (-2622.019) (-2621.767) (-2632.858) * (-2620.470) (-2616.632) [-2621.232] (-2618.576) -- 0:03:43 600000 -- [-2622.305] (-2626.067) (-2626.325) (-2629.484) * (-2621.924) (-2629.845) (-2629.177) [-2613.840] -- 0:03:43 Average standard deviation of split frequencies: 0.006605 600500 -- [-2614.542] (-2620.830) (-2620.191) (-2639.185) * (-2615.463) (-2629.100) (-2625.198) [-2618.490] -- 0:03:43 601000 -- [-2623.983] (-2625.821) (-2620.110) (-2624.255) * (-2619.248) [-2616.836] (-2625.864) (-2617.842) -- 0:03:43 601500 -- [-2617.397] (-2619.363) (-2622.472) (-2626.193) * (-2619.302) (-2619.567) [-2616.410] (-2621.628) -- 0:03:42 602000 -- (-2625.030) (-2619.586) [-2614.566] (-2626.416) * (-2628.284) (-2618.166) (-2622.811) [-2622.301] -- 0:03:42 602500 -- (-2618.586) (-2621.230) [-2618.349] (-2631.092) * (-2621.886) [-2616.531] (-2616.134) (-2617.843) -- 0:03:42 603000 -- (-2619.396) (-2620.115) [-2618.169] (-2622.380) * (-2620.033) (-2623.691) [-2614.318] (-2618.472) -- 0:03:41 603500 -- (-2627.058) (-2620.615) [-2618.640] (-2622.566) * [-2616.940] (-2616.627) (-2621.560) (-2621.759) -- 0:03:41 604000 -- (-2629.160) [-2617.258] (-2615.372) (-2619.996) * (-2618.718) (-2617.825) (-2615.752) [-2611.059] -- 0:03:41 604500 -- (-2630.809) [-2631.000] (-2619.209) (-2629.090) * (-2619.437) (-2621.996) [-2616.377] (-2623.464) -- 0:03:41 605000 -- (-2628.834) [-2623.275] (-2622.184) (-2624.168) * (-2621.203) (-2625.380) (-2616.965) [-2614.821] -- 0:03:40 Average standard deviation of split frequencies: 0.006029 605500 -- (-2624.047) (-2631.310) (-2614.023) [-2620.987] * (-2615.761) (-2622.397) [-2613.403] (-2624.350) -- 0:03:40 606000 -- (-2626.058) [-2618.752] (-2616.005) (-2626.843) * (-2617.769) (-2621.102) (-2613.378) [-2625.172] -- 0:03:40 606500 -- [-2615.781] (-2620.631) (-2629.452) (-2621.772) * (-2622.804) (-2616.523) [-2620.915] (-2628.367) -- 0:03:39 607000 -- [-2617.396] (-2627.239) (-2622.008) (-2615.392) * (-2616.016) (-2618.366) [-2619.815] (-2626.594) -- 0:03:39 607500 -- (-2616.583) [-2616.441] (-2619.950) (-2618.955) * (-2630.892) (-2615.560) [-2620.251] (-2622.937) -- 0:03:39 608000 -- (-2620.316) (-2621.145) [-2615.958] (-2617.396) * (-2628.355) [-2619.375] (-2615.295) (-2624.381) -- 0:03:39 608500 -- [-2619.051] (-2621.403) (-2618.755) (-2631.581) * (-2618.115) (-2632.253) [-2619.471] (-2622.302) -- 0:03:38 609000 -- [-2621.389] (-2627.102) (-2619.817) (-2622.867) * (-2619.562) (-2615.721) (-2620.482) [-2622.482] -- 0:03:38 609500 -- [-2614.793] (-2617.746) (-2618.159) (-2626.029) * (-2630.415) (-2618.865) [-2613.512] (-2616.071) -- 0:03:38 610000 -- (-2615.340) [-2613.907] (-2622.890) (-2620.582) * (-2624.349) (-2624.801) [-2619.477] (-2614.191) -- 0:03:38 Average standard deviation of split frequencies: 0.006497 610500 -- (-2622.782) [-2615.006] (-2623.963) (-2616.973) * [-2623.622] (-2618.121) (-2630.314) (-2616.155) -- 0:03:37 611000 -- (-2617.409) [-2620.872] (-2612.261) (-2618.091) * (-2621.516) [-2613.636] (-2617.199) (-2618.790) -- 0:03:37 611500 -- (-2622.989) (-2623.063) (-2620.325) [-2625.482] * [-2622.594] (-2627.404) (-2617.704) (-2624.541) -- 0:03:37 612000 -- (-2634.733) [-2624.866] (-2619.066) (-2635.906) * (-2623.954) (-2631.481) [-2616.040] (-2616.937) -- 0:03:36 612500 -- (-2632.245) (-2623.572) (-2632.205) [-2619.803] * (-2623.367) (-2618.959) [-2620.863] (-2620.317) -- 0:03:36 613000 -- (-2618.553) (-2623.656) [-2614.809] (-2623.467) * [-2620.360] (-2623.060) (-2621.100) (-2616.700) -- 0:03:36 613500 -- [-2618.292] (-2617.443) (-2625.991) (-2625.864) * (-2624.423) [-2617.817] (-2619.242) (-2615.612) -- 0:03:36 614000 -- [-2619.132] (-2618.375) (-2621.630) (-2623.461) * (-2622.086) (-2625.052) [-2621.829] (-2616.752) -- 0:03:35 614500 -- (-2628.076) [-2618.807] (-2621.026) (-2620.532) * (-2620.945) (-2625.349) [-2617.676] (-2618.101) -- 0:03:35 615000 -- (-2616.527) (-2615.383) (-2620.332) [-2624.209] * [-2622.800] (-2615.595) (-2627.342) (-2618.301) -- 0:03:35 Average standard deviation of split frequencies: 0.006951 615500 -- [-2618.407] (-2617.186) (-2617.771) (-2625.754) * (-2629.917) (-2635.256) [-2620.418] (-2621.644) -- 0:03:34 616000 -- (-2618.219) (-2618.911) (-2618.889) [-2619.578] * (-2617.513) (-2621.973) (-2617.006) [-2621.335] -- 0:03:34 616500 -- (-2626.303) (-2616.999) [-2626.762] (-2620.960) * (-2624.170) (-2627.296) (-2623.353) [-2611.982] -- 0:03:34 617000 -- (-2620.800) [-2615.995] (-2617.599) (-2619.218) * (-2616.425) (-2618.505) (-2618.985) [-2618.927] -- 0:03:34 617500 -- (-2621.220) (-2620.816) (-2622.160) [-2617.645] * [-2616.318] (-2623.445) (-2622.280) (-2614.878) -- 0:03:33 618000 -- (-2630.342) (-2619.282) [-2620.285] (-2624.368) * (-2614.875) [-2618.918] (-2628.748) (-2630.264) -- 0:03:33 618500 -- (-2620.657) (-2629.876) [-2621.274] (-2631.946) * (-2617.223) (-2624.323) [-2623.059] (-2618.358) -- 0:03:33 619000 -- (-2629.421) [-2616.703] (-2622.586) (-2620.211) * (-2616.325) [-2625.975] (-2618.353) (-2622.782) -- 0:03:32 619500 -- (-2615.765) [-2621.894] (-2620.777) (-2624.992) * (-2626.158) [-2619.451] (-2621.664) (-2614.917) -- 0:03:32 620000 -- (-2624.855) (-2624.985) (-2629.729) [-2620.295] * (-2621.311) (-2618.082) (-2620.864) [-2616.495] -- 0:03:32 Average standard deviation of split frequencies: 0.006709 620500 -- [-2621.609] (-2620.886) (-2619.763) (-2621.519) * (-2622.635) [-2619.908] (-2621.573) (-2623.700) -- 0:03:32 621000 -- (-2618.912) (-2619.742) (-2623.861) [-2619.931] * (-2617.754) (-2622.984) [-2614.734] (-2619.117) -- 0:03:31 621500 -- (-2621.076) (-2621.415) [-2623.303] (-2620.764) * [-2621.234] (-2629.160) (-2612.587) (-2618.035) -- 0:03:31 622000 -- (-2627.239) [-2621.264] (-2621.453) (-2621.872) * (-2616.290) (-2619.370) (-2626.134) [-2617.653] -- 0:03:31 622500 -- [-2618.281] (-2618.908) (-2627.181) (-2627.303) * (-2624.440) (-2631.581) [-2614.813] (-2622.847) -- 0:03:31 623000 -- [-2626.102] (-2618.765) (-2622.961) (-2618.916) * (-2620.364) (-2628.648) (-2617.617) [-2619.278] -- 0:03:31 623500 -- [-2621.728] (-2617.759) (-2621.980) (-2628.111) * (-2614.693) (-2621.501) [-2621.109] (-2615.262) -- 0:03:30 624000 -- (-2619.695) (-2624.660) [-2623.424] (-2620.051) * [-2622.866] (-2620.824) (-2616.240) (-2627.958) -- 0:03:30 624500 -- (-2616.455) (-2628.245) (-2623.312) [-2621.015] * (-2624.095) (-2617.981) [-2615.486] (-2628.175) -- 0:03:30 625000 -- (-2624.515) (-2621.421) (-2621.556) [-2621.265] * (-2625.043) [-2615.694] (-2620.596) (-2615.385) -- 0:03:29 Average standard deviation of split frequencies: 0.006652 625500 -- [-2616.879] (-2631.656) (-2628.107) (-2617.523) * (-2624.303) (-2615.658) [-2619.163] (-2618.258) -- 0:03:29 626000 -- (-2619.510) (-2621.083) [-2613.850] (-2621.786) * (-2616.797) (-2620.025) (-2616.697) [-2609.955] -- 0:03:29 626500 -- [-2618.435] (-2636.044) (-2621.964) (-2631.993) * (-2628.387) (-2626.442) (-2629.730) [-2620.107] -- 0:03:29 627000 -- [-2613.668] (-2624.749) (-2625.170) (-2633.223) * (-2624.975) (-2618.794) (-2621.256) [-2621.920] -- 0:03:28 627500 -- [-2614.584] (-2617.499) (-2622.942) (-2625.964) * [-2617.046] (-2614.893) (-2621.194) (-2619.317) -- 0:03:28 628000 -- (-2618.909) (-2624.678) [-2621.875] (-2620.710) * (-2621.171) (-2626.459) (-2620.561) [-2616.128] -- 0:03:28 628500 -- [-2618.261] (-2616.581) (-2633.708) (-2626.406) * (-2626.781) [-2613.968] (-2614.661) (-2616.382) -- 0:03:28 629000 -- [-2619.092] (-2625.155) (-2621.662) (-2628.562) * (-2618.247) (-2611.172) (-2620.891) [-2621.057] -- 0:03:27 629500 -- (-2623.018) (-2621.482) [-2617.902] (-2616.576) * (-2618.772) (-2625.999) [-2623.545] (-2622.176) -- 0:03:27 630000 -- (-2624.667) (-2620.725) (-2621.728) [-2621.091] * (-2620.565) (-2617.857) [-2617.401] (-2622.255) -- 0:03:27 Average standard deviation of split frequencies: 0.006790 630500 -- (-2617.723) (-2626.918) [-2617.236] (-2615.256) * [-2619.211] (-2632.888) (-2625.367) (-2621.325) -- 0:03:26 631000 -- [-2616.658] (-2624.873) (-2621.840) (-2627.780) * [-2626.100] (-2622.147) (-2617.554) (-2621.537) -- 0:03:26 631500 -- (-2619.946) [-2618.061] (-2624.209) (-2617.829) * (-2624.952) (-2627.024) [-2616.275] (-2622.821) -- 0:03:26 632000 -- (-2622.772) (-2630.420) [-2613.152] (-2616.617) * (-2624.917) (-2628.051) [-2621.675] (-2619.259) -- 0:03:26 632500 -- (-2618.990) (-2627.417) [-2627.787] (-2622.175) * (-2630.010) [-2618.319] (-2632.600) (-2636.019) -- 0:03:25 633000 -- [-2621.579] (-2634.146) (-2616.777) (-2623.927) * (-2624.554) (-2620.469) (-2628.879) [-2628.380] -- 0:03:25 633500 -- (-2622.104) (-2634.518) (-2621.180) [-2624.995] * (-2626.969) [-2623.666] (-2628.961) (-2627.546) -- 0:03:25 634000 -- (-2627.503) [-2617.693] (-2617.149) (-2622.476) * (-2616.691) [-2618.291] (-2619.990) (-2622.822) -- 0:03:24 634500 -- (-2617.209) [-2617.378] (-2614.557) (-2617.445) * (-2620.737) (-2623.418) (-2627.444) [-2620.331] -- 0:03:24 635000 -- (-2612.674) (-2620.298) (-2624.102) [-2613.692] * [-2615.647] (-2619.723) (-2624.966) (-2620.176) -- 0:03:24 Average standard deviation of split frequencies: 0.006177 635500 -- [-2620.393] (-2632.139) (-2620.090) (-2618.968) * (-2617.718) (-2628.057) (-2611.940) [-2621.512] -- 0:03:24 636000 -- [-2618.230] (-2625.667) (-2618.073) (-2616.201) * [-2615.750] (-2627.641) (-2623.400) (-2615.816) -- 0:03:23 636500 -- (-2629.011) (-2621.997) (-2625.096) [-2625.420] * (-2619.182) [-2631.033] (-2611.547) (-2617.564) -- 0:03:23 637000 -- (-2626.561) (-2625.636) (-2618.328) [-2616.080] * (-2621.146) (-2615.044) [-2613.407] (-2623.917) -- 0:03:23 637500 -- (-2620.580) (-2622.944) (-2624.052) [-2620.385] * (-2621.483) (-2620.916) [-2615.848] (-2617.859) -- 0:03:22 638000 -- (-2631.599) (-2621.865) (-2611.407) [-2612.747] * (-2614.667) [-2620.620] (-2614.314) (-2619.822) -- 0:03:22 638500 -- (-2623.119) [-2626.111] (-2616.375) (-2631.262) * (-2623.062) (-2622.495) [-2618.705] (-2617.546) -- 0:03:22 639000 -- (-2633.532) (-2619.335) [-2617.901] (-2625.058) * (-2613.491) (-2620.078) [-2623.906] (-2625.817) -- 0:03:22 639500 -- [-2617.081] (-2625.775) (-2619.785) (-2617.519) * (-2615.702) [-2618.709] (-2626.855) (-2611.414) -- 0:03:21 640000 -- (-2619.400) (-2620.463) (-2625.662) [-2618.818] * [-2619.024] (-2615.256) (-2622.147) (-2625.369) -- 0:03:21 Average standard deviation of split frequencies: 0.005457 640500 -- (-2615.681) [-2619.435] (-2624.186) (-2616.905) * (-2623.653) [-2612.579] (-2622.992) (-2636.608) -- 0:03:21 641000 -- (-2625.291) (-2615.461) (-2619.576) [-2618.381] * (-2622.321) (-2623.257) (-2635.775) [-2627.290] -- 0:03:21 641500 -- (-2623.748) (-2620.730) [-2621.718] (-2623.870) * (-2624.411) (-2620.762) [-2617.938] (-2620.745) -- 0:03:20 642000 -- (-2622.845) (-2624.003) [-2617.439] (-2620.251) * (-2624.726) (-2616.117) [-2619.034] (-2619.117) -- 0:03:20 642500 -- (-2628.813) (-2625.210) (-2613.952) [-2621.117] * [-2625.334] (-2620.756) (-2627.503) (-2617.549) -- 0:03:20 643000 -- [-2629.854] (-2620.061) (-2623.794) (-2626.537) * (-2620.107) [-2615.560] (-2617.551) (-2627.184) -- 0:03:19 643500 -- [-2621.981] (-2624.751) (-2628.537) (-2620.365) * (-2628.903) (-2620.648) (-2621.020) [-2620.089] -- 0:03:19 644000 -- (-2616.411) [-2626.315] (-2620.896) (-2629.225) * (-2633.094) [-2611.459] (-2622.643) (-2613.015) -- 0:03:19 644500 -- (-2620.388) [-2616.325] (-2626.225) (-2624.338) * (-2629.426) (-2614.906) [-2615.501] (-2614.116) -- 0:03:19 645000 -- (-2616.931) [-2616.667] (-2625.552) (-2617.025) * (-2618.849) (-2617.988) (-2618.205) [-2617.411] -- 0:03:18 Average standard deviation of split frequencies: 0.005534 645500 -- (-2614.910) (-2622.676) (-2619.534) [-2623.768] * (-2620.380) [-2625.121] (-2621.689) (-2618.104) -- 0:03:18 646000 -- (-2622.849) [-2615.048] (-2621.360) (-2625.168) * (-2611.896) (-2625.184) [-2618.960] (-2621.827) -- 0:03:18 646500 -- (-2627.045) (-2627.646) (-2621.725) [-2623.840] * [-2616.713] (-2633.326) (-2621.724) (-2619.138) -- 0:03:17 647000 -- (-2628.433) [-2619.480] (-2625.710) (-2629.000) * (-2623.009) (-2624.707) [-2614.852] (-2625.150) -- 0:03:17 647500 -- (-2625.393) [-2617.471] (-2626.737) (-2621.166) * [-2619.158] (-2617.857) (-2616.200) (-2616.271) -- 0:03:17 648000 -- (-2623.362) [-2616.588] (-2622.089) (-2623.020) * [-2614.787] (-2623.181) (-2616.784) (-2621.627) -- 0:03:17 648500 -- [-2620.667] (-2628.999) (-2625.400) (-2620.334) * (-2616.837) (-2643.687) (-2623.807) [-2623.320] -- 0:03:16 649000 -- (-2616.992) (-2618.515) (-2622.512) [-2617.580] * [-2615.282] (-2621.695) (-2613.760) (-2614.953) -- 0:03:16 649500 -- (-2617.861) [-2617.276] (-2618.859) (-2623.829) * [-2621.944] (-2621.486) (-2617.911) (-2626.140) -- 0:03:16 650000 -- [-2618.481] (-2619.913) (-2621.449) (-2615.213) * (-2624.971) [-2622.265] (-2617.340) (-2613.249) -- 0:03:15 Average standard deviation of split frequencies: 0.005192 650500 -- (-2619.979) [-2613.179] (-2632.724) (-2617.046) * (-2621.728) [-2617.381] (-2626.158) (-2618.405) -- 0:03:15 651000 -- (-2622.831) [-2613.603] (-2630.567) (-2627.193) * (-2621.412) [-2624.946] (-2620.503) (-2616.877) -- 0:03:15 651500 -- [-2618.915] (-2627.834) (-2619.530) (-2623.455) * (-2616.920) [-2624.423] (-2622.985) (-2623.800) -- 0:03:15 652000 -- [-2618.477] (-2623.300) (-2616.838) (-2624.989) * (-2615.322) (-2619.587) [-2620.829] (-2616.306) -- 0:03:14 652500 -- (-2621.601) (-2617.864) [-2616.685] (-2618.710) * (-2622.911) (-2625.604) (-2620.851) [-2619.857] -- 0:03:14 653000 -- (-2619.230) (-2619.185) [-2614.012] (-2619.784) * (-2622.086) [-2619.107] (-2627.259) (-2616.060) -- 0:03:14 653500 -- (-2620.396) (-2617.754) (-2625.942) [-2618.015] * (-2628.844) (-2622.145) (-2623.214) [-2618.584] -- 0:03:14 654000 -- (-2621.381) (-2617.290) [-2617.526] (-2624.705) * (-2619.670) [-2622.321] (-2621.493) (-2621.451) -- 0:03:13 654500 -- (-2620.052) [-2626.212] (-2631.853) (-2624.667) * (-2624.849) (-2617.973) [-2620.187] (-2619.285) -- 0:03:13 655000 -- (-2615.578) (-2621.126) [-2621.750] (-2622.154) * (-2621.800) (-2620.644) (-2635.571) [-2617.384] -- 0:03:13 Average standard deviation of split frequencies: 0.005809 655500 -- [-2617.073] (-2626.220) (-2616.023) (-2625.545) * [-2618.292] (-2625.041) (-2633.847) (-2615.462) -- 0:03:12 656000 -- (-2625.678) (-2627.411) [-2616.296] (-2615.247) * (-2618.793) (-2616.137) (-2639.158) [-2621.263] -- 0:03:12 656500 -- (-2618.250) (-2629.086) [-2631.319] (-2623.037) * (-2621.352) (-2620.705) (-2638.006) [-2614.271] -- 0:03:12 657000 -- (-2619.482) (-2629.629) [-2620.714] (-2619.834) * (-2627.682) (-2619.613) (-2625.213) [-2618.885] -- 0:03:12 657500 -- [-2617.840] (-2625.446) (-2622.335) (-2616.377) * (-2623.275) (-2618.106) [-2620.239] (-2633.144) -- 0:03:11 658000 -- (-2620.495) (-2622.952) (-2629.276) [-2612.326] * (-2624.661) (-2616.755) (-2631.548) [-2618.612] -- 0:03:11 658500 -- (-2620.112) (-2624.197) (-2636.428) [-2619.948] * [-2623.813] (-2620.243) (-2625.547) (-2616.846) -- 0:03:11 659000 -- (-2620.418) (-2632.914) [-2621.735] (-2619.306) * (-2618.883) (-2620.492) (-2623.402) [-2613.717] -- 0:03:10 659500 -- [-2622.008] (-2620.735) (-2624.567) (-2620.071) * (-2618.859) (-2618.242) (-2627.372) [-2620.261] -- 0:03:10 660000 -- (-2629.401) [-2624.545] (-2619.787) (-2618.050) * (-2617.498) [-2617.832] (-2621.397) (-2624.312) -- 0:03:10 Average standard deviation of split frequencies: 0.005708 660500 -- (-2630.155) (-2625.213) (-2637.780) [-2619.123] * [-2614.311] (-2611.335) (-2628.141) (-2618.183) -- 0:03:10 661000 -- (-2622.801) [-2616.382] (-2626.326) (-2619.460) * [-2619.393] (-2625.903) (-2619.150) (-2622.564) -- 0:03:09 661500 -- (-2630.833) (-2613.321) (-2624.468) [-2614.896] * [-2618.257] (-2622.578) (-2629.083) (-2623.420) -- 0:03:09 662000 -- [-2622.733] (-2615.922) (-2623.147) (-2626.559) * [-2622.714] (-2617.592) (-2624.612) (-2626.798) -- 0:03:09 662500 -- [-2620.503] (-2621.008) (-2626.302) (-2620.180) * [-2619.666] (-2628.752) (-2622.399) (-2625.773) -- 0:03:08 663000 -- [-2615.706] (-2615.556) (-2621.450) (-2618.623) * (-2621.624) (-2631.179) [-2624.460] (-2626.808) -- 0:03:08 663500 -- [-2618.404] (-2627.933) (-2616.467) (-2618.421) * (-2614.973) (-2620.116) [-2617.859] (-2622.045) -- 0:03:08 664000 -- (-2620.164) (-2617.098) (-2623.934) [-2616.762] * [-2617.464] (-2616.425) (-2628.207) (-2626.051) -- 0:03:08 664500 -- (-2629.532) (-2614.745) [-2615.995] (-2614.675) * (-2617.921) (-2618.296) [-2618.701] (-2629.460) -- 0:03:07 665000 -- (-2622.762) [-2616.595] (-2625.558) (-2623.503) * (-2616.378) [-2616.956] (-2621.428) (-2626.875) -- 0:03:07 Average standard deviation of split frequencies: 0.006075 665500 -- (-2617.496) [-2628.706] (-2618.614) (-2621.691) * (-2616.482) [-2613.036] (-2619.079) (-2628.820) -- 0:03:07 666000 -- (-2614.061) (-2626.752) (-2618.946) [-2622.113] * (-2615.610) [-2636.258] (-2625.016) (-2629.334) -- 0:03:07 666500 -- (-2625.698) (-2619.862) (-2620.597) [-2625.140] * [-2623.700] (-2618.730) (-2625.355) (-2625.688) -- 0:03:06 667000 -- (-2622.784) (-2631.188) [-2620.100] (-2614.782) * (-2620.412) [-2622.416] (-2626.114) (-2622.640) -- 0:03:06 667500 -- (-2618.201) (-2614.727) (-2619.812) [-2616.027] * (-2614.971) [-2617.207] (-2623.023) (-2617.956) -- 0:03:06 668000 -- [-2613.990] (-2618.567) (-2623.794) (-2629.210) * (-2627.843) (-2619.372) (-2630.311) [-2626.010] -- 0:03:05 668500 -- (-2622.485) (-2621.711) (-2620.603) [-2615.052] * (-2620.265) [-2612.519] (-2628.770) (-2622.128) -- 0:03:05 669000 -- (-2623.436) (-2614.133) (-2625.004) [-2615.794] * (-2614.044) (-2615.166) (-2616.961) [-2614.992] -- 0:03:05 669500 -- (-2620.252) [-2617.614] (-2628.931) (-2623.785) * (-2620.704) (-2630.490) (-2618.653) [-2616.521] -- 0:03:05 670000 -- (-2622.983) (-2615.235) [-2615.150] (-2621.631) * (-2625.847) (-2616.620) [-2614.649] (-2617.924) -- 0:03:04 Average standard deviation of split frequencies: 0.005740 670500 -- (-2618.141) (-2617.798) [-2620.155] (-2630.734) * (-2623.203) (-2625.205) [-2619.206] (-2615.885) -- 0:03:04 671000 -- (-2628.003) [-2615.787] (-2620.652) (-2612.729) * (-2623.681) (-2618.432) (-2618.232) [-2626.974] -- 0:03:04 671500 -- (-2623.939) (-2624.315) (-2620.085) [-2614.501] * (-2619.693) [-2611.902] (-2621.606) (-2620.638) -- 0:03:03 672000 -- (-2617.014) (-2628.136) [-2617.250] (-2616.489) * (-2615.380) (-2617.878) (-2621.831) [-2616.715] -- 0:03:03 672500 -- (-2629.097) (-2617.476) (-2627.022) [-2622.031] * (-2619.044) [-2617.077] (-2621.870) (-2627.189) -- 0:03:03 673000 -- (-2623.426) [-2620.078] (-2625.674) (-2624.270) * (-2624.077) [-2617.644] (-2616.683) (-2622.710) -- 0:03:03 673500 -- (-2620.538) (-2630.955) [-2620.282] (-2633.093) * (-2633.415) (-2625.130) [-2618.599] (-2625.270) -- 0:03:02 674000 -- [-2619.510] (-2619.714) (-2614.950) (-2617.923) * (-2623.107) [-2621.668] (-2625.682) (-2621.154) -- 0:03:02 674500 -- (-2622.646) (-2625.695) (-2627.270) [-2621.694] * (-2627.052) [-2613.002] (-2620.884) (-2623.651) -- 0:03:02 675000 -- (-2627.742) (-2627.034) (-2627.930) [-2620.596] * (-2619.651) (-2616.964) [-2618.753] (-2625.967) -- 0:03:01 Average standard deviation of split frequencies: 0.005463 675500 -- (-2619.024) (-2625.311) [-2624.237] (-2621.291) * [-2613.132] (-2621.455) (-2619.533) (-2625.687) -- 0:03:01 676000 -- (-2613.071) (-2619.418) (-2625.437) [-2614.440] * (-2616.875) [-2620.819] (-2613.641) (-2631.873) -- 0:03:01 676500 -- (-2622.293) (-2623.418) (-2628.594) [-2629.343] * (-2619.434) (-2626.399) (-2619.247) [-2615.535] -- 0:03:01 677000 -- (-2615.220) (-2620.833) [-2623.037] (-2626.824) * (-2620.522) (-2623.486) (-2617.979) [-2622.945] -- 0:03:00 677500 -- (-2629.665) (-2618.480) (-2615.559) [-2621.557] * (-2630.711) (-2628.179) [-2614.805] (-2623.576) -- 0:03:00 678000 -- (-2626.603) [-2615.644] (-2628.242) (-2623.050) * (-2626.643) (-2622.343) (-2626.580) [-2625.405] -- 0:02:59 678500 -- (-2636.111) [-2624.561] (-2618.084) (-2614.771) * [-2616.701] (-2645.372) (-2621.824) (-2622.934) -- 0:03:00 679000 -- (-2618.623) (-2625.610) (-2616.679) [-2619.323] * [-2619.520] (-2621.082) (-2624.793) (-2622.687) -- 0:02:59 679500 -- [-2617.878] (-2621.848) (-2623.191) (-2618.813) * (-2624.531) (-2625.851) [-2626.859] (-2617.634) -- 0:02:59 680000 -- (-2629.330) [-2614.217] (-2627.733) (-2624.420) * (-2620.100) (-2630.233) [-2613.942] (-2620.612) -- 0:02:59 Average standard deviation of split frequencies: 0.005425 680500 -- (-2621.355) (-2622.184) [-2624.832] (-2616.194) * (-2620.237) (-2627.447) [-2617.634] (-2625.844) -- 0:02:58 681000 -- (-2620.683) [-2616.534] (-2624.098) (-2619.681) * (-2623.901) (-2625.004) (-2613.521) [-2616.918] -- 0:02:58 681500 -- (-2615.770) (-2628.764) (-2634.746) [-2618.122] * [-2623.325] (-2621.870) (-2614.323) (-2616.891) -- 0:02:58 682000 -- (-2632.375) (-2632.776) [-2626.620] (-2618.741) * (-2622.721) (-2618.382) [-2615.282] (-2618.110) -- 0:02:58 682500 -- (-2624.262) (-2622.116) (-2625.501) [-2617.301] * (-2628.201) (-2626.327) (-2616.406) [-2621.262] -- 0:02:57 683000 -- (-2628.224) (-2619.376) (-2634.488) [-2616.035] * (-2622.743) [-2617.047] (-2623.237) (-2625.610) -- 0:02:57 683500 -- (-2628.915) (-2618.672) [-2616.195] (-2617.565) * (-2628.592) (-2622.956) [-2617.050] (-2621.580) -- 0:02:56 684000 -- (-2625.473) (-2619.702) (-2612.893) [-2616.656] * [-2624.898] (-2626.455) (-2634.817) (-2617.739) -- 0:02:56 684500 -- (-2620.117) (-2626.356) (-2625.316) [-2612.849] * [-2620.250] (-2623.618) (-2628.476) (-2617.782) -- 0:02:56 685000 -- (-2622.578) [-2614.025] (-2618.040) (-2619.094) * [-2617.650] (-2619.318) (-2622.217) (-2615.471) -- 0:02:56 Average standard deviation of split frequencies: 0.005097 685500 -- (-2620.342) (-2616.671) (-2614.796) [-2620.265] * [-2613.607] (-2617.104) (-2617.703) (-2625.595) -- 0:02:56 686000 -- [-2614.369] (-2623.078) (-2621.614) (-2619.165) * [-2618.735] (-2615.586) (-2618.403) (-2629.937) -- 0:02:55 686500 -- [-2619.368] (-2618.474) (-2619.314) (-2621.677) * [-2617.961] (-2627.554) (-2620.775) (-2624.545) -- 0:02:55 687000 -- (-2625.457) (-2627.026) (-2614.105) [-2621.463] * [-2614.855] (-2622.575) (-2621.295) (-2617.024) -- 0:02:54 687500 -- (-2616.727) (-2625.600) (-2624.364) [-2614.700] * (-2614.977) (-2625.173) (-2624.829) [-2612.631] -- 0:02:54 688000 -- (-2622.937) [-2623.582] (-2621.748) (-2622.640) * (-2623.278) [-2622.254] (-2626.584) (-2625.746) -- 0:02:54 688500 -- (-2618.625) (-2623.583) [-2609.521] (-2616.059) * [-2617.413] (-2621.962) (-2618.591) (-2614.170) -- 0:02:54 689000 -- (-2623.681) (-2612.656) [-2613.414] (-2619.225) * (-2621.251) (-2617.659) [-2617.942] (-2624.440) -- 0:02:53 689500 -- (-2616.031) (-2622.366) [-2615.447] (-2619.411) * [-2624.046] (-2621.423) (-2623.769) (-2617.877) -- 0:02:53 690000 -- [-2617.331] (-2620.079) (-2616.565) (-2631.283) * [-2616.829] (-2622.160) (-2618.569) (-2620.423) -- 0:02:53 Average standard deviation of split frequencies: 0.004266 690500 -- (-2613.796) [-2616.129] (-2616.535) (-2644.597) * (-2619.863) (-2619.631) (-2615.488) [-2623.473] -- 0:02:53 691000 -- (-2622.986) (-2619.904) [-2613.545] (-2626.166) * [-2615.223] (-2619.999) (-2621.684) (-2622.749) -- 0:02:53 691500 -- (-2619.673) (-2615.928) [-2616.142] (-2629.251) * [-2614.511] (-2624.936) (-2627.941) (-2621.771) -- 0:02:52 692000 -- [-2614.220] (-2615.707) (-2619.998) (-2618.442) * (-2621.630) (-2621.430) (-2621.043) [-2616.307] -- 0:02:52 692500 -- (-2616.521) (-2619.756) [-2619.882] (-2616.743) * (-2620.230) [-2619.293] (-2626.465) (-2624.025) -- 0:02:51 693000 -- [-2617.867] (-2622.486) (-2619.875) (-2618.645) * (-2618.978) (-2619.972) (-2626.060) [-2617.697] -- 0:02:51 693500 -- [-2618.836] (-2624.563) (-2632.309) (-2619.983) * (-2618.115) [-2619.000] (-2623.022) (-2617.679) -- 0:02:51 694000 -- (-2621.381) (-2623.166) (-2623.548) [-2615.102] * (-2616.030) [-2628.071] (-2632.449) (-2629.240) -- 0:02:51 694500 -- (-2617.674) [-2620.079] (-2622.420) (-2619.197) * (-2615.622) (-2623.130) [-2620.490] (-2629.194) -- 0:02:51 695000 -- [-2618.391] (-2625.017) (-2624.022) (-2621.141) * [-2616.388] (-2616.149) (-2617.197) (-2617.591) -- 0:02:50 Average standard deviation of split frequencies: 0.004064 695500 -- [-2626.048] (-2621.228) (-2617.695) (-2629.224) * [-2619.892] (-2617.146) (-2618.050) (-2632.285) -- 0:02:50 696000 -- [-2619.787] (-2619.884) (-2618.811) (-2617.871) * (-2620.880) (-2623.725) (-2615.280) [-2626.772] -- 0:02:49 696500 -- (-2618.025) (-2619.938) (-2617.041) [-2616.696] * (-2625.769) [-2619.393] (-2619.199) (-2623.237) -- 0:02:49 697000 -- (-2618.406) (-2631.756) [-2615.910] (-2628.576) * (-2620.992) (-2623.324) [-2619.547] (-2632.409) -- 0:02:49 697500 -- (-2618.942) [-2619.484] (-2621.933) (-2623.774) * (-2619.251) (-2611.628) [-2628.368] (-2629.587) -- 0:02:49 698000 -- (-2614.464) (-2624.708) (-2617.187) [-2618.398] * (-2624.415) [-2619.134] (-2627.953) (-2618.243) -- 0:02:49 698500 -- [-2611.179] (-2623.107) (-2628.942) (-2621.889) * [-2620.712] (-2621.108) (-2623.508) (-2621.300) -- 0:02:48 699000 -- (-2621.267) [-2612.745] (-2622.612) (-2619.236) * (-2621.675) (-2620.167) [-2613.978] (-2621.533) -- 0:02:48 699500 -- (-2624.502) (-2618.806) (-2618.062) [-2621.175] * (-2626.952) (-2623.338) [-2614.088] (-2620.410) -- 0:02:47 700000 -- (-2625.726) [-2617.368] (-2618.980) (-2620.266) * (-2625.871) (-2619.022) [-2621.948] (-2624.576) -- 0:02:47 Average standard deviation of split frequencies: 0.004149 700500 -- (-2619.854) [-2617.570] (-2622.325) (-2626.969) * (-2623.778) [-2612.816] (-2622.768) (-2635.007) -- 0:02:47 701000 -- (-2615.402) [-2623.845] (-2617.200) (-2622.087) * (-2629.799) (-2621.792) (-2619.326) [-2622.014] -- 0:02:47 701500 -- (-2629.212) [-2620.392] (-2619.182) (-2626.964) * (-2622.547) (-2624.736) [-2614.340] (-2616.168) -- 0:02:46 702000 -- (-2632.018) [-2616.308] (-2618.764) (-2632.229) * (-2622.425) (-2623.841) (-2625.540) [-2624.703] -- 0:02:46 702500 -- [-2619.295] (-2624.685) (-2618.940) (-2619.866) * [-2624.279] (-2624.332) (-2620.187) (-2619.387) -- 0:02:46 703000 -- (-2623.946) (-2619.795) (-2624.498) [-2628.388] * (-2622.388) (-2622.359) (-2621.486) [-2614.596] -- 0:02:46 703500 -- (-2620.438) [-2617.544] (-2619.900) (-2620.793) * (-2622.144) (-2615.640) [-2619.330] (-2617.160) -- 0:02:46 704000 -- (-2620.864) (-2626.308) [-2625.377] (-2616.242) * (-2619.310) [-2614.750] (-2622.514) (-2626.551) -- 0:02:45 704500 -- (-2622.493) [-2618.705] (-2620.020) (-2615.764) * (-2622.934) (-2615.748) (-2619.421) [-2618.602] -- 0:02:45 705000 -- (-2619.132) (-2623.748) (-2618.762) [-2619.171] * (-2620.783) [-2618.849] (-2622.021) (-2614.188) -- 0:02:44 Average standard deviation of split frequencies: 0.004062 705500 -- [-2621.534] (-2627.663) (-2620.834) (-2614.823) * (-2620.680) [-2615.520] (-2629.919) (-2623.273) -- 0:02:44 706000 -- [-2620.142] (-2626.295) (-2615.985) (-2626.820) * [-2619.518] (-2625.045) (-2637.160) (-2617.341) -- 0:02:44 706500 -- (-2623.123) [-2617.344] (-2626.364) (-2621.068) * (-2620.499) (-2618.885) (-2631.502) [-2620.136] -- 0:02:44 707000 -- (-2630.196) [-2621.834] (-2624.527) (-2627.858) * (-2622.984) [-2617.448] (-2620.143) (-2621.977) -- 0:02:44 707500 -- (-2624.049) (-2621.795) (-2617.302) [-2621.819] * (-2633.080) (-2621.661) (-2627.631) [-2617.333] -- 0:02:43 708000 -- [-2620.844] (-2630.997) (-2615.416) (-2622.662) * (-2629.629) [-2612.869] (-2627.982) (-2625.975) -- 0:02:43 708500 -- [-2617.566] (-2622.789) (-2621.175) (-2620.903) * (-2627.285) [-2620.231] (-2624.265) (-2632.086) -- 0:02:42 709000 -- (-2620.833) [-2618.633] (-2621.348) (-2621.345) * (-2621.190) [-2617.632] (-2623.145) (-2624.447) -- 0:02:42 709500 -- [-2619.758] (-2632.232) (-2624.181) (-2616.164) * (-2623.694) (-2619.911) (-2618.158) [-2618.574] -- 0:02:42 710000 -- (-2613.715) (-2634.565) (-2619.983) [-2619.824] * (-2628.565) [-2616.418] (-2618.887) (-2621.838) -- 0:02:42 Average standard deviation of split frequencies: 0.004533 710500 -- [-2620.966] (-2625.469) (-2622.205) (-2614.963) * (-2632.080) (-2617.474) [-2620.052] (-2619.196) -- 0:02:41 711000 -- [-2616.885] (-2634.303) (-2618.150) (-2618.955) * (-2621.659) [-2617.299] (-2622.124) (-2628.238) -- 0:02:41 711500 -- [-2615.573] (-2620.092) (-2620.874) (-2618.440) * (-2616.983) (-2617.357) (-2617.826) [-2615.872] -- 0:02:41 712000 -- (-2613.994) [-2617.193] (-2618.380) (-2616.514) * (-2620.793) [-2620.539] (-2615.924) (-2623.021) -- 0:02:40 712500 -- (-2622.682) [-2622.826] (-2628.600) (-2618.290) * (-2615.681) (-2622.676) [-2622.429] (-2616.904) -- 0:02:40 713000 -- (-2628.443) (-2622.380) [-2621.401] (-2618.877) * (-2628.126) [-2621.571] (-2623.582) (-2614.891) -- 0:02:40 713500 -- (-2616.746) (-2622.039) [-2619.594] (-2618.395) * [-2617.116] (-2616.093) (-2624.860) (-2618.280) -- 0:02:40 714000 -- [-2621.763] (-2616.661) (-2620.608) (-2629.886) * (-2626.148) [-2614.518] (-2622.712) (-2616.710) -- 0:02:39 714500 -- (-2624.899) (-2620.106) (-2616.565) [-2616.653] * (-2616.917) (-2621.449) [-2614.095] (-2613.100) -- 0:02:39 715000 -- [-2622.789] (-2614.027) (-2621.327) (-2624.650) * (-2626.989) [-2616.353] (-2616.576) (-2613.355) -- 0:02:39 Average standard deviation of split frequencies: 0.004060 715500 -- (-2618.354) [-2613.619] (-2625.084) (-2613.253) * [-2621.005] (-2624.474) (-2617.449) (-2626.096) -- 0:02:39 716000 -- (-2623.796) [-2622.714] (-2619.127) (-2622.130) * [-2618.506] (-2620.905) (-2616.533) (-2617.681) -- 0:02:38 716500 -- (-2632.762) [-2614.802] (-2624.613) (-2624.405) * (-2622.645) (-2627.177) (-2620.039) [-2617.097] -- 0:02:38 717000 -- (-2621.748) (-2627.414) [-2619.166] (-2617.152) * (-2616.565) [-2617.680] (-2621.802) (-2628.576) -- 0:02:38 717500 -- (-2621.244) [-2621.363] (-2627.893) (-2611.216) * [-2616.915] (-2634.186) (-2624.152) (-2616.114) -- 0:02:37 718000 -- (-2636.046) (-2620.741) (-2615.310) [-2614.726] * (-2620.825) (-2622.900) [-2619.013] (-2622.710) -- 0:02:37 718500 -- (-2623.339) (-2624.090) (-2620.720) [-2614.940] * (-2626.205) (-2617.200) [-2622.936] (-2619.023) -- 0:02:37 719000 -- (-2623.587) (-2622.751) (-2619.652) [-2616.252] * (-2618.979) (-2619.380) [-2617.456] (-2617.409) -- 0:02:37 719500 -- [-2615.920] (-2619.976) (-2620.925) (-2626.112) * [-2618.965] (-2617.915) (-2621.856) (-2614.768) -- 0:02:36 720000 -- (-2620.616) (-2624.092) (-2630.851) [-2616.695] * (-2621.264) (-2620.281) (-2615.867) [-2623.557] -- 0:02:36 Average standard deviation of split frequencies: 0.003925 720500 -- (-2619.039) (-2624.153) [-2623.463] (-2621.730) * (-2615.168) (-2615.589) [-2614.424] (-2630.274) -- 0:02:36 721000 -- (-2619.157) (-2616.318) (-2615.504) [-2617.896] * (-2623.517) [-2618.110] (-2619.833) (-2620.764) -- 0:02:35 721500 -- (-2623.691) [-2620.618] (-2621.748) (-2621.863) * [-2622.580] (-2618.959) (-2616.359) (-2622.976) -- 0:02:35 722000 -- (-2632.610) (-2622.728) (-2616.193) [-2624.350] * (-2626.633) [-2615.705] (-2619.039) (-2618.914) -- 0:02:35 722500 -- (-2618.465) (-2626.605) (-2618.378) [-2622.240] * (-2619.754) [-2619.069] (-2621.564) (-2622.763) -- 0:02:35 723000 -- (-2627.266) (-2615.596) [-2620.190] (-2624.036) * (-2615.255) (-2620.325) [-2621.611] (-2613.926) -- 0:02:34 723500 -- (-2626.687) [-2622.541] (-2620.809) (-2618.704) * (-2613.555) [-2611.169] (-2618.070) (-2619.650) -- 0:02:34 724000 -- (-2625.943) [-2619.747] (-2617.434) (-2624.291) * (-2621.810) [-2624.827] (-2618.543) (-2620.961) -- 0:02:34 724500 -- (-2619.106) (-2621.403) [-2614.855] (-2623.907) * [-2620.737] (-2622.822) (-2623.772) (-2613.577) -- 0:02:34 725000 -- [-2618.041] (-2620.507) (-2627.738) (-2618.057) * (-2618.692) (-2628.371) [-2619.709] (-2616.285) -- 0:02:33 Average standard deviation of split frequencies: 0.003788 725500 -- (-2617.488) (-2627.451) (-2627.065) [-2624.371] * [-2615.783] (-2619.498) (-2619.611) (-2619.535) -- 0:02:33 726000 -- (-2615.238) (-2617.709) [-2625.593] (-2622.935) * (-2614.865) [-2620.168] (-2626.526) (-2622.005) -- 0:02:33 726500 -- (-2619.020) (-2623.951) (-2624.862) [-2620.352] * [-2619.395] (-2626.633) (-2623.809) (-2630.168) -- 0:02:32 727000 -- (-2615.885) (-2625.542) [-2622.967] (-2619.795) * (-2617.791) (-2627.032) (-2619.904) [-2616.688] -- 0:02:32 727500 -- (-2617.877) [-2618.156] (-2628.479) (-2615.547) * (-2625.813) [-2616.996] (-2625.143) (-2621.162) -- 0:02:32 728000 -- (-2616.687) [-2617.292] (-2624.481) (-2621.106) * [-2624.713] (-2625.411) (-2625.244) (-2623.950) -- 0:02:32 728500 -- (-2623.407) (-2618.363) (-2622.548) [-2617.223] * (-2622.266) [-2618.017] (-2625.983) (-2624.297) -- 0:02:31 729000 -- (-2621.263) (-2614.965) (-2620.211) [-2617.360] * (-2620.124) (-2624.175) (-2627.329) [-2622.583] -- 0:02:31 729500 -- (-2622.701) (-2620.222) (-2625.175) [-2623.288] * (-2629.384) [-2617.072] (-2619.579) (-2625.600) -- 0:02:31 730000 -- (-2622.489) (-2626.433) [-2621.282] (-2616.727) * (-2626.973) (-2620.800) (-2618.933) [-2613.559] -- 0:02:30 Average standard deviation of split frequencies: 0.004032 730500 -- (-2619.783) [-2615.858] (-2616.883) (-2629.658) * (-2620.442) (-2622.775) (-2620.478) [-2616.609] -- 0:02:30 731000 -- (-2615.372) (-2625.513) (-2614.901) [-2623.827] * [-2616.726] (-2621.568) (-2625.504) (-2619.689) -- 0:02:30 731500 -- (-2611.833) (-2620.894) [-2623.775] (-2623.624) * (-2616.469) [-2626.265] (-2629.348) (-2626.769) -- 0:02:30 732000 -- (-2623.556) [-2621.205] (-2614.673) (-2624.656) * (-2625.571) (-2629.507) [-2624.541] (-2619.684) -- 0:02:29 732500 -- (-2620.618) (-2617.993) (-2616.469) [-2618.527] * [-2618.611] (-2625.151) (-2627.380) (-2626.715) -- 0:02:29 733000 -- (-2623.792) (-2619.844) (-2618.692) [-2619.533] * (-2623.377) (-2624.147) (-2623.371) [-2622.633] -- 0:02:29 733500 -- [-2615.814] (-2624.707) (-2611.972) (-2633.584) * (-2628.937) (-2618.207) [-2616.842] (-2619.487) -- 0:02:28 734000 -- (-2615.029) [-2615.685] (-2615.358) (-2622.336) * (-2620.650) (-2625.581) (-2617.461) [-2615.595] -- 0:02:28 734500 -- (-2617.221) (-2615.935) (-2635.868) [-2620.096] * (-2638.979) (-2619.506) (-2616.297) [-2611.403] -- 0:02:28 735000 -- [-2617.167] (-2627.659) (-2618.519) (-2623.871) * (-2622.852) (-2619.248) [-2619.681] (-2620.227) -- 0:02:28 Average standard deviation of split frequencies: 0.004163 735500 -- (-2622.957) (-2619.136) [-2622.795] (-2614.622) * [-2624.736] (-2616.734) (-2617.373) (-2622.023) -- 0:02:27 736000 -- (-2630.387) [-2626.991] (-2621.442) (-2630.129) * (-2616.316) [-2623.420] (-2624.319) (-2620.070) -- 0:02:27 736500 -- (-2621.019) (-2622.687) (-2619.008) [-2614.266] * (-2615.623) (-2619.993) (-2617.173) [-2617.688] -- 0:02:27 737000 -- (-2616.838) (-2626.692) (-2622.931) [-2616.966] * (-2624.069) (-2629.611) [-2617.902] (-2618.259) -- 0:02:27 737500 -- (-2627.177) (-2621.158) (-2623.187) [-2618.460] * (-2618.141) (-2624.624) (-2623.912) [-2621.312] -- 0:02:26 738000 -- [-2616.052] (-2625.441) (-2615.356) (-2612.043) * (-2620.483) [-2619.401] (-2626.312) (-2625.625) -- 0:02:26 738500 -- (-2627.568) (-2626.779) [-2620.496] (-2616.891) * (-2613.096) [-2615.094] (-2633.613) (-2629.187) -- 0:02:26 739000 -- [-2620.624] (-2621.973) (-2618.098) (-2624.350) * (-2620.892) (-2625.373) [-2621.160] (-2620.882) -- 0:02:25 739500 -- (-2611.486) (-2620.629) [-2620.447] (-2624.753) * (-2628.574) (-2617.811) [-2617.291] (-2615.562) -- 0:02:25 740000 -- (-2613.563) (-2617.734) [-2612.174] (-2621.626) * (-2625.315) (-2620.544) (-2618.054) [-2625.281] -- 0:02:25 Average standard deviation of split frequencies: 0.004031 740500 -- (-2618.582) (-2620.554) (-2625.986) [-2617.738] * (-2619.256) (-2613.663) (-2615.784) [-2622.352] -- 0:02:25 741000 -- (-2614.862) (-2616.461) [-2614.014] (-2611.960) * (-2617.055) (-2615.402) (-2615.760) [-2623.766] -- 0:02:24 741500 -- (-2625.752) [-2615.888] (-2624.841) (-2619.362) * (-2622.081) [-2612.498] (-2617.604) (-2628.079) -- 0:02:24 742000 -- (-2621.335) (-2609.728) (-2623.828) [-2623.944] * (-2625.906) (-2619.437) [-2613.658] (-2617.367) -- 0:02:24 742500 -- [-2619.853] (-2621.359) (-2620.803) (-2622.399) * (-2621.549) (-2624.474) (-2618.211) [-2621.775] -- 0:02:23 743000 -- (-2625.697) (-2626.914) [-2620.178] (-2618.346) * (-2618.985) (-2625.727) [-2614.487] (-2616.426) -- 0:02:23 743500 -- (-2621.995) (-2618.526) [-2624.103] (-2620.969) * (-2614.940) [-2620.018] (-2622.331) (-2625.913) -- 0:02:23 744000 -- (-2625.193) (-2625.904) [-2620.580] (-2617.547) * (-2613.717) (-2622.462) [-2622.477] (-2625.205) -- 0:02:23 744500 -- (-2624.216) (-2633.071) (-2631.277) [-2617.298] * [-2616.895] (-2621.559) (-2617.969) (-2623.272) -- 0:02:22 745000 -- (-2627.165) (-2614.038) [-2620.065] (-2621.569) * [-2622.296] (-2624.564) (-2628.933) (-2621.252) -- 0:02:22 Average standard deviation of split frequencies: 0.004318 745500 -- (-2619.544) [-2617.803] (-2633.134) (-2625.777) * (-2620.030) (-2620.146) [-2615.528] (-2624.058) -- 0:02:22 746000 -- (-2624.040) [-2627.697] (-2614.880) (-2620.042) * (-2622.837) (-2615.339) [-2620.698] (-2615.879) -- 0:02:21 746500 -- [-2624.670] (-2620.275) (-2620.050) (-2620.965) * [-2620.377] (-2612.050) (-2624.489) (-2616.965) -- 0:02:21 747000 -- (-2624.348) (-2617.072) [-2615.206] (-2633.392) * (-2616.723) (-2619.030) (-2618.416) [-2617.919] -- 0:02:21 747500 -- (-2618.247) (-2624.480) [-2623.279] (-2627.909) * (-2622.507) (-2618.126) [-2616.890] (-2620.543) -- 0:02:21 748000 -- (-2629.620) (-2635.450) [-2615.177] (-2614.334) * (-2619.783) (-2617.993) (-2623.324) [-2611.910] -- 0:02:20 748500 -- (-2623.985) [-2623.400] (-2619.515) (-2615.819) * (-2620.963) (-2614.401) (-2623.129) [-2611.702] -- 0:02:20 749000 -- (-2619.101) (-2617.767) (-2626.617) [-2617.489] * (-2619.729) (-2627.058) (-2623.912) [-2612.261] -- 0:02:20 749500 -- (-2622.250) (-2613.813) [-2618.609] (-2621.097) * (-2618.628) [-2621.723] (-2619.533) (-2618.391) -- 0:02:20 750000 -- (-2614.350) [-2613.166] (-2622.637) (-2617.049) * (-2622.137) (-2618.777) (-2628.836) [-2620.042] -- 0:02:19 Average standard deviation of split frequencies: 0.004501 750500 -- (-2626.417) [-2610.815] (-2625.667) (-2621.859) * (-2621.127) (-2621.201) [-2629.126] (-2619.548) -- 0:02:19 751000 -- (-2622.059) (-2623.110) (-2618.814) [-2622.785] * (-2621.176) (-2619.924) (-2624.240) [-2619.970] -- 0:02:19 751500 -- [-2613.263] (-2621.714) (-2620.357) (-2628.510) * [-2622.662] (-2615.402) (-2617.313) (-2626.141) -- 0:02:18 752000 -- (-2620.377) (-2617.881) (-2619.098) [-2615.220] * (-2626.016) [-2615.318] (-2618.980) (-2619.992) -- 0:02:18 752500 -- [-2624.627] (-2629.738) (-2624.937) (-2627.733) * (-2617.935) (-2622.310) (-2618.246) [-2617.813] -- 0:02:18 753000 -- (-2613.124) (-2622.169) [-2622.699] (-2618.433) * [-2615.965] (-2615.270) (-2622.488) (-2624.498) -- 0:02:18 753500 -- (-2614.245) [-2621.354] (-2618.826) (-2618.814) * (-2619.837) (-2627.108) (-2620.027) [-2619.025] -- 0:02:17 754000 -- [-2612.633] (-2615.132) (-2633.293) (-2612.556) * [-2622.153] (-2618.865) (-2624.283) (-2618.729) -- 0:02:17 754500 -- [-2612.233] (-2618.399) (-2628.370) (-2617.233) * (-2618.688) (-2614.262) (-2633.040) [-2623.977] -- 0:02:17 755000 -- (-2618.309) (-2616.772) [-2627.197] (-2625.814) * (-2622.334) (-2625.375) (-2622.103) [-2620.350] -- 0:02:16 Average standard deviation of split frequencies: 0.004261 755500 -- [-2616.661] (-2623.611) (-2635.387) (-2624.542) * (-2621.662) (-2626.055) (-2621.028) [-2624.115] -- 0:02:16 756000 -- [-2612.139] (-2620.509) (-2625.703) (-2624.768) * (-2615.586) (-2615.273) (-2620.457) [-2619.298] -- 0:02:16 756500 -- (-2628.776) (-2626.201) [-2619.472] (-2625.841) * [-2619.285] (-2624.287) (-2629.189) (-2623.667) -- 0:02:16 757000 -- (-2625.158) [-2631.872] (-2626.801) (-2616.907) * (-2630.652) [-2622.130] (-2620.354) (-2617.256) -- 0:02:15 757500 -- (-2617.537) (-2613.551) [-2613.465] (-2621.864) * (-2623.912) (-2621.751) [-2620.185] (-2622.188) -- 0:02:15 758000 -- (-2620.689) (-2616.796) (-2616.591) [-2625.976] * (-2621.183) [-2619.801] (-2631.508) (-2624.491) -- 0:02:15 758500 -- (-2624.258) [-2616.257] (-2622.466) (-2624.419) * [-2617.154] (-2621.533) (-2628.139) (-2630.263) -- 0:02:14 759000 -- (-2621.794) [-2612.809] (-2628.313) (-2630.978) * (-2618.300) [-2620.503] (-2629.095) (-2624.458) -- 0:02:14 759500 -- [-2616.849] (-2624.963) (-2630.107) (-2627.518) * (-2614.739) (-2614.081) (-2631.157) [-2629.638] -- 0:02:14 760000 -- (-2620.566) (-2622.757) [-2624.381] (-2624.231) * (-2630.313) (-2619.017) (-2625.819) [-2620.526] -- 0:02:14 Average standard deviation of split frequencies: 0.005268 760500 -- (-2619.067) (-2620.432) [-2623.532] (-2625.615) * (-2635.851) (-2620.125) (-2628.341) [-2617.871] -- 0:02:13 761000 -- [-2617.388] (-2637.810) (-2618.590) (-2623.968) * (-2628.857) (-2620.124) (-2617.096) [-2629.990] -- 0:02:13 761500 -- (-2618.461) [-2629.039] (-2618.676) (-2616.176) * (-2632.124) (-2617.037) (-2616.275) [-2621.273] -- 0:02:13 762000 -- (-2623.594) (-2623.375) [-2618.418] (-2622.674) * (-2623.191) (-2618.673) [-2610.682] (-2619.921) -- 0:02:13 762500 -- [-2618.719] (-2628.134) (-2617.575) (-2618.618) * (-2632.705) (-2625.341) [-2619.714] (-2620.387) -- 0:02:12 763000 -- (-2624.671) (-2620.337) [-2612.830] (-2619.309) * (-2623.854) (-2619.080) [-2618.962] (-2621.303) -- 0:02:12 763500 -- [-2616.714] (-2614.883) (-2623.543) (-2616.088) * (-2626.246) (-2625.170) (-2626.704) [-2618.423] -- 0:02:11 764000 -- [-2614.617] (-2624.579) (-2617.602) (-2621.638) * [-2612.532] (-2635.191) (-2621.237) (-2623.867) -- 0:02:11 764500 -- (-2623.458) (-2625.948) [-2618.313] (-2627.766) * (-2618.375) [-2615.189] (-2622.044) (-2624.058) -- 0:02:11 765000 -- (-2628.755) (-2622.501) (-2616.541) [-2620.604] * (-2615.556) (-2617.468) [-2621.666] (-2623.856) -- 0:02:11 Average standard deviation of split frequencies: 0.005436 765500 -- (-2622.602) (-2619.581) [-2613.335] (-2626.148) * (-2630.581) (-2622.339) [-2616.652] (-2623.454) -- 0:02:11 766000 -- [-2622.343] (-2619.448) (-2624.488) (-2624.148) * (-2621.056) (-2630.587) [-2617.676] (-2618.775) -- 0:02:10 766500 -- (-2628.299) (-2624.001) [-2616.367] (-2624.795) * [-2612.184] (-2618.879) (-2612.878) (-2629.097) -- 0:02:10 767000 -- (-2627.485) (-2613.518) [-2617.705] (-2618.611) * (-2619.688) (-2617.086) (-2617.426) [-2615.376] -- 0:02:10 767500 -- (-2624.779) (-2616.163) [-2624.017] (-2625.451) * (-2614.956) (-2625.224) [-2612.196] (-2622.434) -- 0:02:09 768000 -- (-2625.547) (-2610.412) (-2643.725) [-2616.793] * (-2623.769) [-2623.131] (-2617.502) (-2624.044) -- 0:02:09 768500 -- (-2624.386) (-2619.479) [-2622.784] (-2618.088) * (-2622.859) (-2626.951) [-2616.066] (-2621.696) -- 0:02:09 769000 -- (-2616.519) (-2620.700) [-2622.371] (-2617.625) * (-2624.367) (-2622.072) (-2623.780) [-2616.470] -- 0:02:09 769500 -- (-2618.426) (-2612.939) (-2623.196) [-2616.245] * (-2618.751) (-2619.045) (-2623.275) [-2613.498] -- 0:02:08 770000 -- (-2621.041) (-2616.590) [-2614.536] (-2623.258) * [-2614.969] (-2626.373) (-2615.222) (-2627.759) -- 0:02:08 Average standard deviation of split frequencies: 0.005607 770500 -- (-2618.526) (-2620.567) (-2634.468) [-2618.218] * (-2629.129) [-2620.183] (-2619.795) (-2622.488) -- 0:02:08 771000 -- (-2623.313) (-2626.360) (-2632.767) [-2615.079] * (-2621.513) (-2622.234) [-2615.218] (-2617.236) -- 0:02:08 771500 -- (-2618.205) (-2619.607) [-2614.420] (-2616.932) * (-2620.516) (-2625.212) (-2614.473) [-2621.255] -- 0:02:07 772000 -- (-2617.868) (-2630.716) [-2622.152] (-2620.269) * (-2620.443) [-2613.416] (-2625.431) (-2621.877) -- 0:02:07 772500 -- (-2624.167) (-2625.542) [-2620.450] (-2619.937) * (-2619.509) (-2628.177) [-2622.215] (-2628.044) -- 0:02:06 773000 -- (-2619.637) (-2631.486) (-2627.705) [-2619.356] * (-2624.817) [-2618.989] (-2619.992) (-2632.595) -- 0:02:06 773500 -- (-2622.052) [-2622.342] (-2626.395) (-2618.453) * (-2627.477) [-2618.952] (-2620.307) (-2628.084) -- 0:02:06 774000 -- (-2627.639) (-2617.432) (-2624.760) [-2620.254] * (-2635.058) (-2622.233) [-2615.977] (-2621.386) -- 0:02:06 774500 -- (-2614.061) [-2618.567] (-2618.212) (-2622.511) * [-2623.789] (-2618.125) (-2620.039) (-2621.448) -- 0:02:06 775000 -- (-2621.081) [-2619.052] (-2621.158) (-2627.969) * (-2631.097) [-2614.150] (-2624.117) (-2617.970) -- 0:02:05 Average standard deviation of split frequencies: 0.006277 775500 -- (-2616.075) (-2618.092) [-2620.707] (-2626.684) * [-2619.629] (-2623.123) (-2624.172) (-2617.174) -- 0:02:05 776000 -- (-2626.044) (-2624.716) [-2620.934] (-2625.204) * (-2628.518) (-2617.738) (-2626.874) [-2624.373] -- 0:02:04 776500 -- (-2621.113) (-2621.396) [-2615.512] (-2629.814) * (-2626.368) (-2620.995) [-2623.101] (-2629.705) -- 0:02:04 777000 -- [-2623.036] (-2620.631) (-2615.934) (-2629.119) * [-2616.502] (-2638.458) (-2625.152) (-2622.238) -- 0:02:04 777500 -- [-2625.787] (-2629.017) (-2624.548) (-2631.097) * (-2619.881) (-2619.464) [-2618.497] (-2625.243) -- 0:02:04 778000 -- (-2622.526) (-2617.484) [-2615.857] (-2629.663) * (-2620.701) [-2615.947] (-2621.547) (-2618.553) -- 0:02:03 778500 -- (-2624.240) [-2621.936] (-2622.407) (-2631.046) * (-2626.808) [-2615.055] (-2620.703) (-2626.334) -- 0:02:03 779000 -- [-2620.107] (-2627.842) (-2614.569) (-2616.642) * (-2620.660) [-2618.938] (-2619.204) (-2616.558) -- 0:02:03 779500 -- (-2620.137) [-2622.537] (-2628.116) (-2613.630) * (-2615.587) (-2629.972) [-2625.739] (-2622.149) -- 0:02:03 780000 -- (-2618.900) (-2627.729) [-2623.135] (-2619.950) * (-2618.819) (-2627.511) (-2629.768) [-2614.540] -- 0:02:02 Average standard deviation of split frequencies: 0.005988 780500 -- (-2618.998) (-2622.589) (-2619.981) [-2626.790] * (-2618.091) (-2638.917) (-2622.781) [-2616.823] -- 0:02:02 781000 -- [-2615.232] (-2613.648) (-2619.237) (-2625.283) * (-2615.373) [-2629.123] (-2630.526) (-2619.548) -- 0:02:02 781500 -- (-2633.890) [-2618.752] (-2615.278) (-2615.006) * (-2630.769) (-2619.095) [-2627.017] (-2620.250) -- 0:02:01 782000 -- (-2621.795) (-2618.165) (-2624.434) [-2621.302] * (-2636.588) (-2626.032) [-2617.831] (-2611.568) -- 0:02:01 782500 -- (-2618.029) (-2616.165) [-2623.086] (-2622.924) * [-2622.377] (-2623.930) (-2621.362) (-2619.031) -- 0:02:01 783000 -- (-2616.552) [-2613.728] (-2619.151) (-2623.480) * (-2620.313) [-2614.649] (-2625.141) (-2622.548) -- 0:02:01 783500 -- [-2614.987] (-2624.036) (-2621.992) (-2613.940) * (-2627.778) [-2619.924] (-2624.592) (-2630.009) -- 0:02:01 784000 -- (-2619.649) [-2625.202] (-2630.057) (-2627.355) * (-2624.556) (-2622.224) (-2613.385) [-2618.150] -- 0:02:00 784500 -- (-2616.927) (-2620.888) (-2622.057) [-2617.944] * (-2626.639) (-2620.430) (-2630.752) [-2618.677] -- 0:02:00 785000 -- (-2615.979) (-2621.861) (-2627.272) [-2615.962] * [-2629.786] (-2620.499) (-2619.762) (-2618.946) -- 0:01:59 Average standard deviation of split frequencies: 0.006047 785500 -- (-2615.407) (-2628.253) (-2629.841) [-2621.581] * (-2620.769) (-2622.497) [-2621.830] (-2623.807) -- 0:01:59 786000 -- (-2621.098) (-2615.159) (-2629.548) [-2618.369] * [-2615.772] (-2625.128) (-2629.596) (-2619.332) -- 0:01:59 786500 -- (-2624.030) (-2630.443) (-2628.820) [-2618.240] * (-2626.305) (-2619.453) (-2632.312) [-2615.962] -- 0:01:59 787000 -- (-2621.414) (-2625.553) (-2621.266) [-2618.540] * (-2622.194) [-2617.609] (-2623.975) (-2635.697) -- 0:01:58 787500 -- [-2621.735] (-2619.387) (-2622.292) (-2615.179) * (-2613.448) (-2622.683) (-2625.689) [-2621.818] -- 0:01:58 788000 -- (-2618.293) (-2632.165) [-2619.861] (-2620.667) * (-2621.159) [-2620.641] (-2620.769) (-2621.054) -- 0:01:58 788500 -- (-2623.445) [-2618.909] (-2625.301) (-2622.933) * (-2623.955) (-2613.499) [-2624.883] (-2617.865) -- 0:01:58 789000 -- (-2621.013) (-2620.287) [-2615.708] (-2624.093) * (-2624.240) [-2622.219] (-2627.022) (-2617.981) -- 0:01:57 789500 -- (-2622.969) (-2622.554) (-2627.177) [-2623.303] * (-2617.445) (-2617.216) (-2634.645) [-2618.132] -- 0:01:57 790000 -- (-2627.963) (-2616.893) (-2626.658) [-2622.439] * (-2622.464) (-2621.260) (-2632.688) [-2615.470] -- 0:01:57 Average standard deviation of split frequencies: 0.006658 790500 -- (-2619.509) (-2620.871) [-2620.843] (-2625.164) * [-2617.975] (-2628.144) (-2630.274) (-2616.177) -- 0:01:56 791000 -- (-2623.640) (-2620.926) (-2619.732) [-2621.668] * (-2621.467) (-2621.234) (-2618.212) [-2620.554] -- 0:01:56 791500 -- [-2624.414] (-2622.070) (-2616.210) (-2621.662) * (-2620.730) (-2619.919) (-2612.117) [-2613.663] -- 0:01:56 792000 -- [-2621.992] (-2623.261) (-2624.670) (-2627.173) * [-2611.951] (-2623.577) (-2619.797) (-2623.533) -- 0:01:56 792500 -- [-2620.783] (-2621.711) (-2622.094) (-2612.974) * [-2621.029] (-2622.339) (-2631.514) (-2625.972) -- 0:01:55 793000 -- (-2616.962) (-2627.537) (-2618.203) [-2617.927] * (-2617.942) (-2621.277) (-2621.326) [-2626.722] -- 0:01:55 793500 -- [-2612.365] (-2618.295) (-2623.298) (-2617.414) * (-2615.883) (-2624.626) (-2621.075) [-2622.821] -- 0:01:55 794000 -- [-2623.135] (-2620.734) (-2622.905) (-2619.782) * (-2625.174) (-2620.703) [-2619.714] (-2625.209) -- 0:01:54 794500 -- (-2624.105) (-2615.296) [-2620.274] (-2630.248) * (-2619.831) (-2620.071) [-2618.415] (-2622.039) -- 0:01:54 795000 -- (-2617.134) [-2620.337] (-2627.968) (-2624.893) * (-2624.203) [-2617.867] (-2623.445) (-2618.551) -- 0:01:54 Average standard deviation of split frequencies: 0.006514 795500 -- [-2614.276] (-2621.480) (-2619.031) (-2621.691) * [-2618.482] (-2622.773) (-2622.631) (-2619.528) -- 0:01:54 796000 -- [-2622.493] (-2621.011) (-2627.913) (-2616.883) * (-2633.017) [-2626.331] (-2632.983) (-2624.596) -- 0:01:53 796500 -- (-2617.885) (-2614.671) (-2622.707) [-2626.180] * (-2629.962) (-2619.460) [-2621.583] (-2620.797) -- 0:01:53 797000 -- (-2614.773) [-2614.080] (-2616.972) (-2619.194) * (-2616.165) [-2614.961] (-2620.416) (-2619.462) -- 0:01:53 797500 -- (-2621.523) (-2612.616) (-2620.681) [-2618.942] * [-2622.586] (-2617.917) (-2626.292) (-2629.322) -- 0:01:52 798000 -- (-2624.055) [-2615.033] (-2624.014) (-2611.816) * (-2614.047) [-2625.617] (-2615.287) (-2627.343) -- 0:01:52 798500 -- (-2629.449) (-2619.663) [-2618.154] (-2617.553) * (-2628.070) (-2623.801) [-2614.154] (-2628.211) -- 0:01:52 799000 -- (-2622.215) (-2616.340) (-2625.630) [-2625.808] * [-2627.663] (-2620.013) (-2617.845) (-2628.133) -- 0:01:52 799500 -- (-2625.424) [-2618.259] (-2619.780) (-2619.671) * (-2626.501) (-2627.806) [-2622.598] (-2624.469) -- 0:01:51 800000 -- (-2627.796) (-2619.942) [-2618.358] (-2620.348) * [-2620.769] (-2623.539) (-2621.287) (-2619.635) -- 0:01:51 Average standard deviation of split frequencies: 0.006869 800500 -- (-2617.486) (-2621.658) [-2621.652] (-2630.129) * [-2618.487] (-2618.373) (-2619.089) (-2615.888) -- 0:01:51 801000 -- (-2616.777) (-2629.889) (-2632.129) [-2617.767] * (-2622.005) (-2614.832) (-2623.612) [-2620.952] -- 0:01:51 801500 -- [-2614.834] (-2617.783) (-2620.043) (-2615.713) * (-2619.449) [-2617.488] (-2622.264) (-2611.127) -- 0:01:50 802000 -- (-2619.389) [-2623.484] (-2621.296) (-2618.651) * (-2619.510) [-2619.328] (-2621.358) (-2623.696) -- 0:01:50 802500 -- (-2626.543) (-2619.409) (-2627.673) [-2617.981] * (-2615.883) [-2614.769] (-2623.325) (-2617.176) -- 0:01:50 803000 -- (-2625.249) [-2621.282] (-2620.976) (-2614.295) * (-2621.960) (-2620.273) (-2622.161) [-2615.191] -- 0:01:49 803500 -- [-2615.754] (-2621.861) (-2616.885) (-2622.032) * (-2617.078) (-2621.797) (-2623.451) [-2618.140] -- 0:01:49 804000 -- (-2621.899) (-2624.362) [-2613.367] (-2625.763) * (-2631.669) (-2622.012) (-2617.065) [-2624.867] -- 0:01:49 804500 -- (-2624.715) (-2617.115) [-2617.990] (-2624.131) * (-2621.233) (-2618.982) (-2623.693) [-2622.079] -- 0:01:49 805000 -- (-2628.611) (-2619.887) [-2627.144] (-2626.714) * (-2623.108) (-2624.155) (-2623.845) [-2618.610] -- 0:01:48 Average standard deviation of split frequencies: 0.006921 805500 -- (-2629.436) (-2621.960) (-2617.060) [-2618.278] * (-2615.668) [-2614.034] (-2620.555) (-2626.719) -- 0:01:48 806000 -- (-2618.788) (-2621.794) [-2618.093] (-2621.237) * (-2621.022) [-2618.086] (-2623.921) (-2623.082) -- 0:01:48 806500 -- (-2621.029) (-2618.291) [-2615.089] (-2624.732) * (-2618.966) (-2628.940) [-2613.205] (-2621.090) -- 0:01:47 807000 -- (-2614.216) (-2624.466) (-2624.213) [-2616.423] * (-2624.987) (-2618.570) (-2617.031) [-2620.510] -- 0:01:47 807500 -- (-2627.969) [-2621.603] (-2628.946) (-2627.570) * (-2628.139) [-2624.536] (-2622.527) (-2631.096) -- 0:01:47 808000 -- (-2612.105) [-2619.310] (-2618.185) (-2618.481) * (-2620.003) [-2616.248] (-2622.229) (-2627.241) -- 0:01:47 808500 -- [-2621.077] (-2614.900) (-2631.315) (-2619.471) * (-2619.923) [-2616.001] (-2633.564) (-2628.242) -- 0:01:46 809000 -- (-2618.246) (-2617.537) (-2623.700) [-2614.861] * [-2617.862] (-2624.779) (-2624.907) (-2621.295) -- 0:01:46 809500 -- (-2623.775) (-2616.008) (-2631.350) [-2612.575] * (-2626.765) [-2616.011] (-2620.585) (-2624.639) -- 0:01:46 810000 -- [-2612.640] (-2624.152) (-2624.278) (-2619.386) * [-2624.063] (-2628.801) (-2621.451) (-2616.508) -- 0:01:46 Average standard deviation of split frequencies: 0.006590 810500 -- (-2615.466) (-2621.205) [-2617.161] (-2623.113) * (-2623.788) (-2624.687) [-2621.627] (-2613.573) -- 0:01:45 811000 -- [-2615.983] (-2622.763) (-2615.655) (-2622.682) * (-2628.616) (-2624.588) (-2618.467) [-2622.979] -- 0:01:45 811500 -- (-2615.912) [-2614.819] (-2627.442) (-2625.176) * [-2615.260] (-2626.986) (-2616.795) (-2621.716) -- 0:01:45 812000 -- [-2618.124] (-2617.747) (-2620.992) (-2615.952) * (-2615.282) [-2619.199] (-2627.965) (-2624.291) -- 0:01:44 812500 -- [-2614.433] (-2617.027) (-2615.462) (-2629.497) * [-2614.646] (-2619.940) (-2623.485) (-2627.945) -- 0:01:44 813000 -- [-2615.758] (-2611.765) (-2617.319) (-2623.298) * (-2631.731) [-2624.869] (-2624.986) (-2623.631) -- 0:01:44 813500 -- [-2617.453] (-2620.606) (-2617.062) (-2620.583) * (-2617.034) (-2618.374) (-2629.102) [-2623.549] -- 0:01:44 814000 -- (-2623.636) (-2620.625) (-2620.091) [-2615.297] * (-2622.041) (-2614.665) (-2621.944) [-2620.131] -- 0:01:43 814500 -- (-2623.327) (-2628.100) [-2624.543] (-2618.157) * (-2629.636) (-2619.823) [-2614.493] (-2627.275) -- 0:01:43 815000 -- (-2625.900) (-2617.869) (-2625.992) [-2618.566] * (-2619.193) [-2612.604] (-2616.149) (-2623.109) -- 0:01:43 Average standard deviation of split frequencies: 0.006307 815500 -- (-2626.059) [-2620.182] (-2636.639) (-2616.023) * (-2616.924) [-2619.389] (-2614.670) (-2639.234) -- 0:01:42 816000 -- (-2623.557) [-2617.095] (-2630.310) (-2622.122) * [-2615.851] (-2612.474) (-2620.684) (-2629.261) -- 0:01:42 816500 -- (-2620.851) (-2629.379) [-2617.316] (-2616.349) * (-2619.621) [-2620.373] (-2627.579) (-2621.989) -- 0:01:42 817000 -- (-2617.784) [-2616.300] (-2624.966) (-2621.522) * [-2626.037] (-2622.670) (-2622.549) (-2623.906) -- 0:01:42 817500 -- [-2631.859] (-2619.976) (-2619.197) (-2621.095) * [-2622.688] (-2618.184) (-2624.007) (-2620.105) -- 0:01:41 818000 -- (-2628.688) (-2619.994) (-2628.954) [-2615.952] * [-2616.048] (-2632.656) (-2620.352) (-2627.339) -- 0:01:41 818500 -- [-2619.534] (-2625.110) (-2618.509) (-2621.101) * [-2620.616] (-2624.042) (-2623.708) (-2620.058) -- 0:01:41 819000 -- (-2616.492) (-2614.942) (-2620.845) [-2614.857] * (-2626.299) [-2615.408] (-2640.690) (-2626.155) -- 0:01:40 819500 -- (-2620.344) (-2628.909) (-2621.526) [-2617.081] * (-2621.330) (-2621.132) (-2615.304) [-2615.369] -- 0:01:40 820000 -- (-2612.211) (-2628.365) (-2622.975) [-2617.072] * (-2619.417) (-2622.451) (-2615.004) [-2612.572] -- 0:01:40 Average standard deviation of split frequencies: 0.006558 820500 -- (-2620.309) (-2627.797) [-2627.214] (-2626.737) * (-2624.177) (-2615.759) (-2622.327) [-2612.604] -- 0:01:40 821000 -- [-2620.944] (-2625.681) (-2616.417) (-2628.566) * [-2614.031] (-2618.475) (-2619.501) (-2619.084) -- 0:01:39 821500 -- [-2614.096] (-2620.749) (-2629.144) (-2626.245) * (-2622.970) (-2626.389) (-2620.301) [-2621.178] -- 0:01:39 822000 -- (-2623.603) (-2621.701) [-2615.419] (-2615.746) * (-2614.446) (-2633.123) [-2622.215] (-2613.046) -- 0:01:39 822500 -- (-2626.335) [-2623.493] (-2615.160) (-2631.459) * [-2622.935] (-2624.811) (-2624.042) (-2623.636) -- 0:01:39 823000 -- (-2623.956) (-2623.947) (-2627.548) [-2612.621] * (-2622.762) [-2619.226] (-2618.215) (-2613.856) -- 0:01:38 823500 -- (-2619.217) (-2629.310) (-2632.577) [-2624.946] * (-2619.946) (-2618.939) (-2620.847) [-2625.457] -- 0:01:38 824000 -- (-2620.487) (-2620.469) [-2621.581] (-2625.739) * (-2620.591) (-2616.189) [-2623.036] (-2631.135) -- 0:01:38 824500 -- (-2620.460) (-2618.654) (-2634.048) [-2618.729] * (-2622.214) (-2617.583) (-2619.869) [-2618.867] -- 0:01:37 825000 -- [-2617.146] (-2618.700) (-2641.400) (-2621.469) * (-2636.433) (-2623.132) [-2621.438] (-2620.111) -- 0:01:37 Average standard deviation of split frequencies: 0.006183 825500 -- (-2621.923) (-2621.494) [-2618.783] (-2616.575) * (-2631.532) (-2633.015) (-2623.570) [-2613.642] -- 0:01:37 826000 -- (-2624.720) (-2622.411) (-2621.932) [-2620.031] * (-2621.016) (-2626.851) (-2616.330) [-2622.304] -- 0:01:37 826500 -- (-2626.885) [-2617.280] (-2619.553) (-2630.503) * (-2617.107) (-2625.784) [-2619.966] (-2617.894) -- 0:01:36 827000 -- [-2625.751] (-2613.217) (-2626.496) (-2622.967) * (-2619.319) (-2620.419) [-2618.411] (-2624.266) -- 0:01:36 827500 -- (-2623.153) (-2622.660) [-2622.202] (-2625.540) * [-2615.003] (-2620.298) (-2625.451) (-2628.661) -- 0:01:36 828000 -- [-2624.345] (-2619.309) (-2620.945) (-2626.257) * [-2613.255] (-2615.935) (-2629.405) (-2619.433) -- 0:01:35 828500 -- (-2621.222) [-2618.384] (-2623.746) (-2627.230) * (-2616.000) (-2621.857) (-2621.493) [-2621.633] -- 0:01:35 829000 -- (-2625.777) [-2614.626] (-2619.383) (-2618.600) * (-2612.187) (-2627.446) (-2613.553) [-2613.117] -- 0:01:35 829500 -- (-2624.765) (-2618.989) [-2619.554] (-2614.946) * (-2629.751) (-2620.397) [-2617.329] (-2620.145) -- 0:01:35 830000 -- (-2622.295) (-2627.093) [-2616.771] (-2614.584) * (-2623.214) (-2613.834) [-2616.314] (-2619.976) -- 0:01:34 Average standard deviation of split frequencies: 0.006479 830500 -- (-2621.839) (-2611.377) [-2620.881] (-2615.172) * (-2623.637) [-2619.780] (-2617.168) (-2620.575) -- 0:01:34 831000 -- (-2619.290) (-2623.946) [-2612.389] (-2627.884) * (-2617.295) (-2630.099) (-2623.851) [-2624.136] -- 0:01:34 831500 -- (-2618.904) (-2622.505) (-2620.121) [-2623.435] * (-2618.876) (-2616.711) (-2617.523) [-2614.443] -- 0:01:34 832000 -- (-2628.258) (-2616.108) (-2632.187) [-2611.867] * (-2612.814) (-2619.915) [-2617.517] (-2628.555) -- 0:01:33 832500 -- (-2620.887) (-2628.879) (-2617.383) [-2617.116] * (-2618.275) (-2619.330) [-2613.877] (-2631.474) -- 0:01:33 833000 -- [-2619.503] (-2625.158) (-2623.756) (-2627.532) * (-2619.789) (-2623.116) (-2619.590) [-2617.925] -- 0:01:33 833500 -- (-2619.959) (-2616.505) (-2619.597) [-2623.758] * (-2619.842) [-2623.545] (-2617.020) (-2622.430) -- 0:01:32 834000 -- [-2619.795] (-2620.765) (-2622.535) (-2621.232) * [-2614.885] (-2623.359) (-2620.904) (-2620.689) -- 0:01:32 834500 -- (-2617.391) [-2621.550] (-2621.809) (-2620.285) * [-2632.304] (-2625.496) (-2620.452) (-2629.920) -- 0:01:32 835000 -- (-2616.190) [-2619.716] (-2621.295) (-2619.355) * (-2623.578) (-2622.147) (-2625.570) [-2617.178] -- 0:01:32 Average standard deviation of split frequencies: 0.006250 835500 -- [-2613.262] (-2628.053) (-2620.506) (-2615.438) * (-2620.642) [-2616.385] (-2615.234) (-2613.232) -- 0:01:31 836000 -- (-2616.238) [-2620.628] (-2619.056) (-2614.484) * [-2622.353] (-2626.425) (-2617.110) (-2620.178) -- 0:01:31 836500 -- [-2616.809] (-2619.670) (-2625.476) (-2613.989) * (-2618.918) (-2627.945) [-2615.994] (-2631.436) -- 0:01:31 837000 -- (-2614.818) [-2619.993] (-2624.325) (-2622.271) * (-2619.513) [-2625.472] (-2618.415) (-2622.904) -- 0:01:30 837500 -- (-2617.982) (-2620.464) [-2623.255] (-2622.356) * (-2621.475) (-2620.580) (-2620.217) [-2615.364] -- 0:01:30 838000 -- (-2619.911) (-2625.888) [-2618.914] (-2619.527) * (-2621.270) (-2621.760) [-2616.141] (-2624.539) -- 0:01:30 838500 -- (-2620.818) [-2614.927] (-2628.134) (-2628.768) * (-2617.688) (-2618.115) [-2612.495] (-2620.082) -- 0:01:30 839000 -- (-2619.773) (-2620.435) (-2625.380) [-2616.591] * [-2622.512] (-2628.023) (-2615.783) (-2628.591) -- 0:01:29 839500 -- [-2617.899] (-2624.044) (-2619.032) (-2616.551) * (-2620.412) (-2621.318) [-2618.558] (-2636.937) -- 0:01:29 840000 -- (-2624.022) (-2628.003) (-2630.494) [-2619.490] * [-2613.393] (-2618.539) (-2622.572) (-2617.408) -- 0:01:29 Average standard deviation of split frequencies: 0.007383 840500 -- (-2619.617) (-2643.863) (-2618.129) [-2631.210] * [-2616.846] (-2618.058) (-2618.302) (-2614.956) -- 0:01:29 841000 -- [-2625.137] (-2621.196) (-2616.354) (-2638.633) * [-2612.467] (-2619.969) (-2610.599) (-2614.131) -- 0:01:28 841500 -- [-2619.689] (-2616.712) (-2621.763) (-2617.208) * [-2622.222] (-2620.652) (-2615.679) (-2617.221) -- 0:01:28 842000 -- (-2625.884) (-2620.495) [-2620.080] (-2620.313) * (-2620.747) (-2621.955) (-2624.224) [-2620.355] -- 0:01:28 842500 -- (-2625.278) [-2615.793] (-2631.256) (-2622.658) * (-2618.242) [-2616.637] (-2624.016) (-2620.070) -- 0:01:27 843000 -- (-2620.245) (-2617.191) (-2614.022) [-2621.211] * [-2616.850] (-2617.798) (-2625.938) (-2626.741) -- 0:01:27 843500 -- (-2621.710) (-2615.009) [-2617.999] (-2628.270) * (-2618.270) [-2620.621] (-2628.074) (-2611.617) -- 0:01:27 844000 -- (-2614.314) (-2628.997) [-2616.280] (-2619.366) * (-2625.805) (-2619.098) (-2621.065) [-2621.894] -- 0:01:27 844500 -- (-2621.940) (-2630.999) (-2615.447) [-2617.696] * (-2618.619) (-2627.844) (-2619.805) [-2617.717] -- 0:01:26 845000 -- (-2616.309) [-2620.906] (-2621.865) (-2619.390) * (-2619.226) (-2626.813) [-2625.445] (-2623.564) -- 0:01:26 Average standard deviation of split frequencies: 0.007662 845500 -- [-2618.790] (-2625.990) (-2614.334) (-2620.200) * (-2619.207) (-2622.548) [-2621.652] (-2623.880) -- 0:01:26 846000 -- (-2616.994) (-2627.705) [-2622.907] (-2623.347) * (-2618.019) [-2616.353] (-2615.784) (-2612.985) -- 0:01:25 846500 -- (-2626.842) (-2615.525) [-2616.248] (-2620.409) * (-2623.110) [-2616.045] (-2626.105) (-2613.927) -- 0:01:25 847000 -- (-2623.634) [-2618.456] (-2617.549) (-2622.255) * (-2614.964) (-2616.397) [-2622.056] (-2620.633) -- 0:01:25 847500 -- (-2630.162) [-2620.263] (-2625.518) (-2630.334) * [-2616.744] (-2619.709) (-2624.412) (-2617.061) -- 0:01:25 848000 -- (-2623.855) (-2622.348) [-2616.789] (-2638.613) * [-2618.320] (-2617.865) (-2622.118) (-2619.882) -- 0:01:24 848500 -- (-2618.575) (-2621.895) [-2617.458] (-2619.576) * (-2616.798) (-2620.658) [-2616.044] (-2622.396) -- 0:01:24 849000 -- [-2620.769] (-2618.620) (-2620.173) (-2619.557) * (-2621.792) [-2617.191] (-2616.743) (-2635.978) -- 0:01:24 849500 -- (-2623.886) (-2624.386) (-2618.693) [-2621.652] * (-2623.056) [-2615.525] (-2618.589) (-2626.596) -- 0:01:23 850000 -- (-2622.037) [-2619.849] (-2617.842) (-2617.448) * [-2626.291] (-2623.274) (-2612.085) (-2617.209) -- 0:01:23 Average standard deviation of split frequencies: 0.007804 850500 -- (-2618.589) (-2627.794) (-2620.134) [-2614.275] * (-2621.075) (-2619.899) [-2619.336] (-2621.272) -- 0:01:23 851000 -- [-2614.060] (-2621.714) (-2615.033) (-2628.240) * [-2615.103] (-2622.400) (-2616.116) (-2626.023) -- 0:01:23 851500 -- (-2627.087) [-2614.730] (-2616.294) (-2622.035) * [-2622.857] (-2622.670) (-2619.578) (-2617.238) -- 0:01:22 852000 -- [-2620.981] (-2626.535) (-2619.994) (-2623.975) * (-2621.974) (-2619.891) (-2618.277) [-2615.550] -- 0:01:22 852500 -- (-2616.675) (-2615.658) (-2614.612) [-2622.663] * (-2617.808) (-2618.564) (-2624.311) [-2619.776] -- 0:01:22 853000 -- (-2617.616) [-2619.642] (-2621.930) (-2625.935) * (-2621.373) [-2613.884] (-2620.105) (-2619.408) -- 0:01:22 853500 -- (-2618.270) (-2620.825) [-2612.448] (-2622.712) * [-2615.821] (-2620.646) (-2623.569) (-2619.681) -- 0:01:21 854000 -- (-2619.911) [-2615.457] (-2620.905) (-2628.852) * [-2616.164] (-2627.963) (-2623.323) (-2614.681) -- 0:01:21 854500 -- (-2619.144) [-2619.042] (-2621.132) (-2628.822) * (-2624.586) (-2615.971) (-2619.843) [-2613.582] -- 0:01:21 855000 -- (-2619.492) [-2617.101] (-2623.068) (-2627.013) * [-2618.124] (-2623.763) (-2621.061) (-2616.811) -- 0:01:20 Average standard deviation of split frequencies: 0.007893 855500 -- (-2625.287) [-2620.007] (-2626.884) (-2618.173) * [-2618.482] (-2628.274) (-2630.517) (-2622.060) -- 0:01:20 856000 -- (-2646.084) [-2614.778] (-2620.756) (-2624.102) * (-2619.871) (-2619.956) [-2617.103] (-2633.354) -- 0:01:20 856500 -- (-2627.071) [-2621.092] (-2618.494) (-2622.838) * (-2618.913) (-2622.683) [-2616.220] (-2634.442) -- 0:01:20 857000 -- (-2631.262) [-2623.149] (-2618.914) (-2619.759) * (-2613.830) (-2617.742) [-2615.445] (-2618.143) -- 0:01:19 857500 -- (-2625.851) (-2622.438) [-2612.675] (-2625.770) * (-2619.411) [-2617.624] (-2622.559) (-2626.439) -- 0:01:19 858000 -- [-2627.197] (-2624.867) (-2617.639) (-2626.290) * (-2624.884) [-2615.855] (-2622.559) (-2626.833) -- 0:01:19 858500 -- (-2622.200) (-2618.088) (-2616.402) [-2614.637] * (-2616.882) (-2627.503) [-2617.543] (-2625.634) -- 0:01:18 859000 -- (-2622.328) (-2620.255) (-2619.052) [-2623.062] * (-2622.986) (-2624.055) (-2624.119) [-2625.755] -- 0:01:18 859500 -- (-2615.707) [-2616.936] (-2629.218) (-2617.340) * (-2617.641) (-2620.997) [-2615.740] (-2623.239) -- 0:01:18 860000 -- [-2620.532] (-2627.098) (-2623.864) (-2617.292) * (-2618.350) (-2622.698) (-2622.616) [-2619.753] -- 0:01:18 Average standard deviation of split frequencies: 0.007851 860500 -- (-2623.091) [-2615.388] (-2619.887) (-2620.720) * [-2616.193] (-2622.017) (-2615.724) (-2619.497) -- 0:01:17 861000 -- (-2620.554) (-2627.599) (-2626.339) [-2617.399] * [-2618.173] (-2630.852) (-2619.169) (-2623.956) -- 0:01:17 861500 -- (-2629.974) (-2626.001) (-2629.960) [-2616.301] * [-2615.135] (-2624.063) (-2621.653) (-2623.057) -- 0:01:17 862000 -- [-2613.295] (-2618.676) (-2624.652) (-2619.325) * (-2632.827) [-2619.741] (-2616.356) (-2618.624) -- 0:01:17 862500 -- (-2618.395) (-2626.080) (-2617.884) [-2619.723] * (-2618.563) (-2625.181) (-2620.263) [-2620.480] -- 0:01:16 863000 -- [-2618.496] (-2626.354) (-2621.243) (-2612.679) * (-2622.378) [-2623.394] (-2629.549) (-2617.438) -- 0:01:16 863500 -- (-2619.941) [-2621.225] (-2628.563) (-2615.607) * (-2617.406) [-2613.732] (-2618.141) (-2621.514) -- 0:01:16 864000 -- (-2621.873) [-2615.244] (-2622.315) (-2619.512) * [-2617.867] (-2618.724) (-2623.259) (-2628.620) -- 0:01:15 864500 -- (-2612.589) [-2610.032] (-2623.325) (-2631.035) * (-2619.982) [-2616.972] (-2615.727) (-2623.790) -- 0:01:15 865000 -- (-2621.740) (-2619.574) (-2621.060) [-2625.541] * (-2616.764) [-2618.780] (-2613.986) (-2629.732) -- 0:01:15 Average standard deviation of split frequencies: 0.007712 865500 -- (-2612.412) (-2624.376) (-2622.394) [-2616.818] * [-2621.620] (-2616.780) (-2619.164) (-2629.037) -- 0:01:15 866000 -- (-2623.265) [-2614.745] (-2622.921) (-2634.310) * (-2620.728) [-2618.535] (-2616.125) (-2625.054) -- 0:01:14 866500 -- (-2616.695) (-2617.342) [-2615.603] (-2635.250) * (-2619.436) [-2614.753] (-2615.167) (-2623.581) -- 0:01:14 867000 -- [-2613.660] (-2628.099) (-2617.871) (-2622.271) * (-2617.703) (-2619.204) [-2617.651] (-2617.996) -- 0:01:14 867500 -- (-2615.939) (-2639.588) (-2624.348) [-2614.319] * (-2617.438) [-2609.855] (-2618.568) (-2625.981) -- 0:01:13 868000 -- (-2621.775) (-2617.293) (-2628.266) [-2615.370] * [-2619.243] (-2625.466) (-2620.455) (-2624.575) -- 0:01:13 868500 -- (-2616.199) (-2617.574) (-2615.903) [-2617.919] * (-2619.958) (-2620.917) (-2630.284) [-2616.595] -- 0:01:13 869000 -- (-2621.328) (-2617.263) [-2614.646] (-2631.933) * (-2619.208) (-2633.765) (-2620.080) [-2618.426] -- 0:01:13 869500 -- (-2625.575) [-2618.370] (-2620.052) (-2630.057) * (-2614.387) (-2627.908) [-2623.062] (-2615.699) -- 0:01:12 870000 -- (-2618.938) (-2615.805) (-2620.317) [-2615.954] * (-2624.498) [-2619.365] (-2625.529) (-2618.037) -- 0:01:12 Average standard deviation of split frequencies: 0.007354 870500 -- [-2618.493] (-2628.998) (-2623.426) (-2615.955) * (-2623.233) (-2619.093) (-2633.318) [-2624.114] -- 0:01:12 871000 -- (-2622.969) (-2634.687) [-2619.711] (-2617.447) * (-2616.653) [-2619.221] (-2622.683) (-2623.604) -- 0:01:11 871500 -- (-2633.305) (-2622.229) (-2624.894) [-2616.221] * (-2626.927) (-2622.840) [-2618.135] (-2620.580) -- 0:01:11 872000 -- (-2626.168) (-2628.935) [-2615.366] (-2621.311) * [-2620.232] (-2627.220) (-2629.919) (-2625.915) -- 0:01:11 872500 -- (-2619.560) [-2625.604] (-2618.240) (-2633.365) * (-2618.429) (-2631.662) (-2615.676) [-2617.607] -- 0:01:11 873000 -- (-2626.699) (-2626.509) (-2621.973) [-2622.104] * (-2619.214) [-2624.432] (-2620.767) (-2628.743) -- 0:01:10 873500 -- (-2619.234) (-2623.480) (-2616.921) [-2614.743] * (-2620.828) (-2615.024) [-2627.047] (-2627.890) -- 0:01:10 874000 -- (-2621.043) (-2621.167) [-2618.094] (-2625.927) * (-2621.308) [-2623.111] (-2617.693) (-2621.410) -- 0:01:10 874500 -- [-2614.487] (-2637.650) (-2623.245) (-2627.595) * (-2617.226) (-2622.812) (-2621.183) [-2610.948] -- 0:01:10 875000 -- [-2618.473] (-2618.342) (-2625.880) (-2627.874) * (-2622.800) [-2625.016] (-2616.670) (-2623.593) -- 0:01:09 Average standard deviation of split frequencies: 0.006906 875500 -- [-2621.124] (-2629.371) (-2622.896) (-2626.775) * (-2620.228) (-2615.708) (-2617.593) [-2616.035] -- 0:01:09 876000 -- (-2625.500) (-2628.767) [-2615.840] (-2634.108) * (-2625.858) [-2617.469] (-2616.684) (-2621.257) -- 0:01:09 876500 -- [-2615.706] (-2629.434) (-2616.130) (-2626.610) * (-2627.076) (-2614.064) [-2613.117] (-2622.471) -- 0:01:08 877000 -- (-2616.412) [-2636.200] (-2631.898) (-2630.408) * (-2627.570) [-2617.268] (-2624.159) (-2619.150) -- 0:01:08 877500 -- (-2620.076) (-2617.806) (-2616.705) [-2622.051] * (-2617.670) (-2617.290) [-2619.045] (-2623.010) -- 0:01:08 878000 -- (-2630.526) (-2618.021) (-2612.972) [-2619.154] * (-2622.375) (-2621.347) (-2613.881) [-2619.266] -- 0:01:08 878500 -- (-2632.951) (-2624.963) [-2623.165] (-2617.340) * [-2619.527] (-2629.054) (-2623.515) (-2618.847) -- 0:01:07 879000 -- [-2615.880] (-2620.547) (-2627.754) (-2617.789) * (-2622.952) (-2628.674) [-2615.080] (-2618.068) -- 0:01:07 879500 -- [-2616.775] (-2620.059) (-2624.701) (-2626.143) * (-2613.189) (-2626.830) (-2617.378) [-2618.787] -- 0:01:07 880000 -- (-2615.821) (-2614.516) (-2631.695) [-2626.208] * (-2617.133) (-2620.873) [-2618.651] (-2623.761) -- 0:01:06 Average standard deviation of split frequencies: 0.006513 880500 -- (-2624.530) (-2624.520) [-2619.535] (-2624.060) * [-2624.523] (-2618.007) (-2623.924) (-2614.455) -- 0:01:06 881000 -- (-2627.325) [-2620.935] (-2631.558) (-2627.081) * (-2620.148) (-2629.903) (-2628.525) [-2615.488] -- 0:01:06 881500 -- (-2623.460) (-2621.350) [-2618.772] (-2621.844) * [-2620.475] (-2637.333) (-2622.112) (-2618.488) -- 0:01:06 882000 -- (-2624.065) (-2621.838) (-2617.063) [-2618.932] * [-2619.399] (-2628.121) (-2634.737) (-2610.864) -- 0:01:05 882500 -- (-2620.577) (-2618.414) [-2615.380] (-2618.656) * (-2621.191) [-2620.123] (-2620.996) (-2611.538) -- 0:01:05 883000 -- (-2632.419) (-2619.132) (-2626.435) [-2615.266] * (-2621.683) (-2617.000) (-2624.647) [-2619.400] -- 0:01:05 883500 -- [-2625.564] (-2618.987) (-2628.307) (-2621.924) * (-2620.153) (-2633.682) [-2616.828] (-2627.868) -- 0:01:05 884000 -- (-2621.310) (-2621.684) [-2618.197] (-2625.748) * (-2624.271) [-2622.018] (-2621.632) (-2626.688) -- 0:01:04 884500 -- (-2626.061) (-2627.951) (-2620.329) [-2615.320] * (-2621.133) [-2616.468] (-2629.115) (-2624.247) -- 0:01:04 885000 -- [-2615.299] (-2624.090) (-2621.389) (-2616.319) * [-2615.702] (-2625.183) (-2637.968) (-2622.765) -- 0:01:04 Average standard deviation of split frequencies: 0.006074 885500 -- (-2616.332) (-2620.681) [-2617.630] (-2620.458) * [-2622.439] (-2623.112) (-2630.669) (-2621.076) -- 0:01:03 886000 -- (-2623.557) (-2624.548) [-2619.552] (-2621.262) * (-2620.416) [-2616.985] (-2624.466) (-2620.697) -- 0:01:03 886500 -- [-2620.787] (-2617.928) (-2618.219) (-2620.196) * [-2621.873] (-2620.030) (-2626.444) (-2623.979) -- 0:01:03 887000 -- [-2616.088] (-2622.808) (-2616.634) (-2619.154) * [-2613.642] (-2619.173) (-2627.182) (-2624.402) -- 0:01:03 887500 -- (-2626.686) (-2620.879) (-2618.074) [-2616.099] * (-2624.805) (-2620.058) (-2619.163) [-2614.378] -- 0:01:02 888000 -- (-2621.976) [-2624.945] (-2617.719) (-2624.641) * [-2616.019] (-2619.540) (-2620.708) (-2622.027) -- 0:01:02 888500 -- [-2616.365] (-2618.781) (-2626.701) (-2624.841) * (-2624.287) (-2611.779) [-2615.487] (-2620.223) -- 0:01:02 889000 -- [-2612.750] (-2624.951) (-2617.024) (-2620.055) * (-2623.449) (-2621.613) (-2626.398) [-2620.207] -- 0:01:01 889500 -- (-2617.459) (-2617.471) [-2616.464] (-2627.740) * (-2616.497) (-2627.054) (-2613.598) [-2622.117] -- 0:01:01 890000 -- [-2622.038] (-2622.099) (-2623.755) (-2616.247) * (-2620.425) (-2630.612) [-2612.129] (-2621.264) -- 0:01:01 Average standard deviation of split frequencies: 0.005866 890500 -- (-2628.467) (-2617.735) [-2620.637] (-2620.142) * (-2621.567) (-2621.042) (-2621.673) [-2620.581] -- 0:01:01 891000 -- (-2626.152) [-2616.451] (-2616.422) (-2616.669) * [-2617.746] (-2617.583) (-2631.250) (-2614.868) -- 0:01:00 891500 -- (-2620.052) [-2615.877] (-2625.858) (-2621.284) * [-2613.902] (-2620.447) (-2621.294) (-2622.038) -- 0:01:00 892000 -- (-2623.560) (-2620.111) (-2620.819) [-2615.838] * [-2626.337] (-2624.103) (-2624.220) (-2629.741) -- 0:01:00 892500 -- (-2622.239) (-2630.736) (-2616.005) [-2613.307] * [-2618.738] (-2620.260) (-2625.202) (-2617.306) -- 0:00:59 893000 -- (-2632.731) [-2625.134] (-2618.883) (-2614.003) * (-2619.411) [-2622.129] (-2614.427) (-2616.834) -- 0:00:59 893500 -- (-2621.776) (-2631.485) [-2621.200] (-2626.640) * (-2620.617) (-2629.624) [-2617.225] (-2621.351) -- 0:00:59 894000 -- [-2615.420] (-2623.441) (-2622.596) (-2625.339) * [-2621.396] (-2618.825) (-2627.168) (-2622.200) -- 0:00:59 894500 -- [-2615.884] (-2621.530) (-2630.314) (-2616.126) * (-2627.497) (-2621.423) [-2619.148] (-2616.035) -- 0:00:58 895000 -- (-2620.776) (-2618.822) (-2616.141) [-2619.503] * (-2620.762) (-2620.097) (-2622.653) [-2614.137] -- 0:00:58 Average standard deviation of split frequencies: 0.005700 895500 -- [-2625.159] (-2635.232) (-2615.242) (-2616.250) * (-2622.114) (-2629.996) [-2618.834] (-2617.060) -- 0:00:58 896000 -- [-2618.135] (-2631.156) (-2618.849) (-2628.922) * (-2625.804) [-2619.683] (-2626.003) (-2630.927) -- 0:00:58 896500 -- (-2619.688) [-2614.507] (-2617.968) (-2625.888) * (-2629.605) (-2627.358) [-2619.131] (-2630.169) -- 0:00:57 897000 -- (-2623.997) (-2623.044) (-2620.192) [-2624.887] * (-2619.425) (-2623.637) [-2622.162] (-2627.227) -- 0:00:57 897500 -- (-2626.673) (-2623.192) [-2616.560] (-2634.952) * [-2622.589] (-2619.896) (-2623.197) (-2623.017) -- 0:00:57 898000 -- (-2625.187) (-2623.412) [-2617.254] (-2633.754) * (-2626.898) [-2616.045] (-2617.566) (-2618.249) -- 0:00:56 898500 -- (-2619.246) [-2632.197] (-2616.559) (-2623.905) * (-2626.876) (-2620.987) (-2617.174) [-2625.451] -- 0:00:56 899000 -- (-2623.689) (-2628.728) (-2616.601) [-2627.981] * (-2628.776) (-2617.072) (-2618.335) [-2629.821] -- 0:00:56 899500 -- (-2616.606) (-2626.666) [-2625.327] (-2621.814) * (-2617.210) [-2624.747] (-2612.600) (-2622.461) -- 0:00:56 900000 -- (-2622.934) (-2621.630) (-2627.083) [-2618.732] * [-2620.134] (-2627.728) (-2619.231) (-2628.698) -- 0:00:55 Average standard deviation of split frequencies: 0.006106 900500 -- [-2627.391] (-2616.137) (-2618.015) (-2620.126) * (-2618.512) (-2616.122) (-2621.306) [-2614.904] -- 0:00:55 901000 -- (-2615.023) (-2616.605) (-2623.529) [-2622.237] * (-2617.851) [-2620.078] (-2623.848) (-2621.251) -- 0:00:55 901500 -- (-2617.769) (-2619.215) [-2623.471] (-2624.426) * (-2616.776) (-2631.219) [-2627.874] (-2617.301) -- 0:00:54 902000 -- (-2619.403) [-2622.326] (-2621.839) (-2620.327) * (-2629.788) [-2617.344] (-2619.443) (-2619.014) -- 0:00:54 902500 -- [-2615.911] (-2616.870) (-2615.576) (-2622.266) * [-2614.448] (-2617.634) (-2618.186) (-2615.596) -- 0:00:54 903000 -- (-2620.735) (-2632.403) [-2617.000] (-2629.043) * (-2622.814) (-2619.731) [-2619.548] (-2631.764) -- 0:00:54 903500 -- [-2621.084] (-2622.892) (-2619.962) (-2621.826) * [-2618.564] (-2622.786) (-2620.972) (-2627.734) -- 0:00:53 904000 -- (-2640.358) (-2627.201) [-2617.504] (-2618.810) * (-2626.185) [-2616.313] (-2620.455) (-2626.798) -- 0:00:53 904500 -- (-2615.430) (-2622.781) (-2623.389) [-2616.033] * (-2623.991) (-2618.127) (-2623.497) [-2620.985] -- 0:00:53 905000 -- (-2615.919) (-2628.422) [-2620.140] (-2618.608) * (-2621.130) (-2621.489) [-2617.081] (-2621.463) -- 0:00:53 Average standard deviation of split frequencies: 0.006027 905500 -- (-2614.415) (-2623.717) [-2622.736] (-2616.443) * [-2617.286] (-2613.479) (-2627.631) (-2616.797) -- 0:00:52 906000 -- [-2614.930] (-2621.662) (-2624.963) (-2625.850) * (-2620.319) [-2613.561] (-2618.777) (-2624.097) -- 0:00:52 906500 -- (-2621.422) [-2614.596] (-2619.435) (-2623.181) * [-2618.534] (-2616.902) (-2622.196) (-2621.313) -- 0:00:52 907000 -- [-2617.053] (-2623.428) (-2628.647) (-2624.873) * (-2619.954) (-2620.404) (-2623.636) [-2612.457] -- 0:00:51 907500 -- (-2628.354) [-2626.590] (-2624.266) (-2624.885) * (-2622.544) (-2626.670) [-2618.133] (-2615.489) -- 0:00:51 908000 -- (-2621.280) (-2624.655) (-2623.553) [-2617.404] * (-2619.410) (-2621.113) (-2617.231) [-2620.495] -- 0:00:51 908500 -- [-2617.439] (-2624.903) (-2625.008) (-2628.984) * [-2621.309] (-2619.366) (-2619.286) (-2624.222) -- 0:00:51 909000 -- (-2616.302) (-2624.909) [-2614.474] (-2633.422) * (-2620.756) [-2615.649] (-2619.056) (-2622.916) -- 0:00:50 909500 -- (-2617.282) (-2625.874) (-2625.163) [-2623.590] * (-2624.287) (-2622.979) (-2615.412) [-2622.695] -- 0:00:50 910000 -- (-2611.405) (-2617.906) (-2619.231) [-2619.398] * [-2618.954] (-2617.144) (-2628.919) (-2627.021) -- 0:00:50 Average standard deviation of split frequencies: 0.005435 910500 -- (-2619.100) (-2625.207) [-2624.262] (-2629.490) * (-2617.705) [-2618.147] (-2631.856) (-2616.263) -- 0:00:49 911000 -- (-2617.366) (-2622.955) (-2624.549) [-2621.984] * (-2626.126) (-2624.259) (-2624.326) [-2626.793] -- 0:00:49 911500 -- (-2619.701) (-2619.651) (-2626.623) [-2612.459] * (-2618.822) (-2621.192) [-2619.074] (-2627.018) -- 0:00:49 912000 -- [-2614.379] (-2618.998) (-2623.510) (-2618.184) * (-2620.792) (-2619.295) (-2623.882) [-2617.474] -- 0:00:49 912500 -- (-2615.064) [-2619.503] (-2621.874) (-2622.320) * (-2623.623) (-2622.831) [-2620.717] (-2623.171) -- 0:00:48 913000 -- (-2619.310) (-2618.572) [-2628.454] (-2619.336) * (-2618.885) [-2622.005] (-2616.585) (-2619.423) -- 0:00:48 913500 -- (-2628.918) (-2616.325) [-2616.715] (-2618.833) * [-2613.085] (-2622.052) (-2619.391) (-2623.091) -- 0:00:48 914000 -- [-2634.524] (-2627.376) (-2615.186) (-2616.242) * (-2615.581) (-2618.401) [-2616.526] (-2625.311) -- 0:00:47 914500 -- (-2618.947) (-2625.082) [-2619.056] (-2615.280) * (-2616.765) (-2622.877) [-2617.030] (-2619.386) -- 0:00:47 915000 -- (-2620.316) [-2625.265] (-2630.873) (-2620.523) * (-2629.424) (-2618.495) (-2621.487) [-2620.730] -- 0:00:47 Average standard deviation of split frequencies: 0.005404 915500 -- (-2626.664) [-2622.494] (-2625.765) (-2616.880) * (-2616.315) (-2620.260) [-2617.782] (-2618.249) -- 0:00:47 916000 -- (-2631.163) [-2621.908] (-2619.818) (-2633.152) * (-2617.464) (-2620.586) (-2628.814) [-2618.267] -- 0:00:46 916500 -- (-2619.413) (-2622.838) [-2618.694] (-2624.555) * [-2616.931] (-2620.664) (-2630.492) (-2631.987) -- 0:00:46 917000 -- (-2629.376) [-2629.470] (-2615.308) (-2627.521) * (-2619.651) (-2617.282) [-2621.167] (-2618.556) -- 0:00:46 917500 -- [-2623.028] (-2623.971) (-2627.020) (-2622.167) * (-2617.289) (-2621.090) [-2616.803] (-2615.305) -- 0:00:46 918000 -- (-2626.537) (-2625.651) [-2614.979] (-2618.416) * (-2614.223) [-2623.744] (-2635.982) (-2615.554) -- 0:00:45 918500 -- (-2615.191) (-2626.063) [-2618.540] (-2619.058) * (-2625.208) [-2618.776] (-2624.306) (-2621.021) -- 0:00:45 919000 -- (-2620.978) [-2619.013] (-2632.234) (-2623.777) * (-2630.622) [-2615.429] (-2622.447) (-2623.667) -- 0:00:45 919500 -- (-2620.113) (-2624.888) [-2622.986] (-2620.673) * [-2622.860] (-2624.029) (-2612.080) (-2626.644) -- 0:00:44 920000 -- [-2616.280] (-2623.129) (-2635.810) (-2619.658) * (-2626.162) (-2621.074) [-2618.825] (-2630.354) -- 0:00:44 Average standard deviation of split frequencies: 0.005462 920500 -- (-2617.549) (-2615.360) [-2616.952] (-2635.077) * (-2625.117) [-2621.240] (-2615.412) (-2616.904) -- 0:00:44 921000 -- [-2617.667] (-2622.640) (-2628.297) (-2623.291) * (-2639.161) (-2616.806) (-2627.919) [-2619.410] -- 0:00:44 921500 -- (-2615.274) [-2613.365] (-2623.845) (-2624.418) * (-2632.502) [-2613.470] (-2621.048) (-2621.424) -- 0:00:43 922000 -- (-2618.316) (-2626.420) (-2618.423) [-2620.761] * (-2626.106) (-2623.182) [-2629.087] (-2624.456) -- 0:00:43 922500 -- (-2620.234) [-2618.611] (-2622.567) (-2623.919) * [-2622.368] (-2622.437) (-2616.707) (-2621.890) -- 0:00:43 923000 -- (-2623.153) (-2618.963) (-2617.846) [-2616.531] * (-2618.460) [-2620.730] (-2622.880) (-2620.792) -- 0:00:42 923500 -- (-2626.979) (-2622.482) [-2624.191] (-2623.693) * (-2616.647) (-2618.792) (-2616.862) [-2614.455] -- 0:00:42 924000 -- [-2618.911] (-2630.758) (-2629.950) (-2620.453) * (-2624.602) [-2615.281] (-2624.159) (-2623.508) -- 0:00:42 924500 -- (-2619.994) (-2620.846) (-2630.400) [-2620.699] * (-2622.217) (-2617.979) [-2615.331] (-2622.380) -- 0:00:42 925000 -- (-2627.384) (-2624.773) [-2620.460] (-2620.526) * (-2621.559) [-2620.122] (-2619.565) (-2617.957) -- 0:00:41 Average standard deviation of split frequencies: 0.005218 925500 -- (-2628.216) [-2624.327] (-2618.319) (-2621.875) * (-2615.338) (-2616.993) (-2623.897) [-2618.410] -- 0:00:41 926000 -- (-2615.733) (-2625.583) (-2618.327) [-2610.719] * (-2616.298) (-2615.538) (-2627.596) [-2620.542] -- 0:00:41 926500 -- [-2617.340] (-2628.804) (-2626.442) (-2623.155) * (-2617.165) (-2620.845) [-2621.761] (-2617.549) -- 0:00:41 927000 -- [-2614.231] (-2620.047) (-2614.964) (-2620.316) * (-2626.569) (-2623.714) (-2618.383) [-2626.094] -- 0:00:40 927500 -- (-2622.309) (-2619.647) [-2623.129] (-2621.452) * (-2621.620) (-2620.255) [-2620.391] (-2629.304) -- 0:00:40 928000 -- (-2622.150) (-2618.681) [-2618.335] (-2622.065) * [-2621.453] (-2622.046) (-2623.466) (-2631.086) -- 0:00:40 928500 -- (-2620.357) (-2624.875) [-2622.063] (-2618.857) * (-2621.057) [-2619.188] (-2623.677) (-2630.212) -- 0:00:39 929000 -- [-2620.334] (-2618.655) (-2626.772) (-2620.661) * (-2629.066) (-2621.517) (-2625.578) [-2623.537] -- 0:00:39 929500 -- (-2616.780) [-2620.571] (-2616.706) (-2628.512) * [-2621.700] (-2619.370) (-2622.534) (-2633.415) -- 0:00:39 930000 -- (-2620.251) (-2618.322) [-2620.465] (-2617.799) * (-2613.768) (-2621.291) [-2618.190] (-2623.680) -- 0:00:39 Average standard deviation of split frequencies: 0.005276 930500 -- (-2616.968) (-2617.857) (-2617.225) [-2621.656] * (-2625.407) (-2615.821) [-2618.625] (-2617.935) -- 0:00:38 931000 -- (-2617.081) [-2617.040] (-2621.715) (-2621.953) * (-2628.767) [-2622.227] (-2625.843) (-2621.884) -- 0:00:38 931500 -- (-2624.912) (-2620.395) [-2620.903] (-2618.943) * (-2627.015) [-2612.791] (-2619.847) (-2631.305) -- 0:00:38 932000 -- (-2616.670) (-2621.792) [-2613.559] (-2614.167) * (-2622.603) [-2631.357] (-2627.004) (-2617.590) -- 0:00:37 932500 -- (-2630.738) (-2621.047) [-2615.096] (-2618.910) * (-2619.236) (-2630.313) [-2622.566] (-2612.713) -- 0:00:37 933000 -- (-2619.795) (-2620.819) [-2619.667] (-2624.791) * [-2619.198] (-2627.906) (-2627.398) (-2631.848) -- 0:00:37 933500 -- (-2616.430) [-2615.113] (-2615.500) (-2616.268) * (-2622.872) (-2621.458) (-2614.959) [-2609.727] -- 0:00:37 934000 -- [-2621.057] (-2627.151) (-2610.732) (-2619.503) * (-2625.272) [-2621.799] (-2627.873) (-2618.102) -- 0:00:36 934500 -- (-2627.696) (-2624.900) (-2621.315) [-2615.616] * (-2619.967) (-2629.745) (-2624.533) [-2617.256] -- 0:00:36 935000 -- (-2619.583) [-2627.446] (-2623.503) (-2624.150) * (-2614.770) (-2623.579) (-2633.096) [-2618.851] -- 0:00:36 Average standard deviation of split frequencies: 0.004952 935500 -- [-2619.247] (-2627.765) (-2630.078) (-2620.347) * (-2623.792) (-2618.372) (-2618.465) [-2621.989] -- 0:00:35 936000 -- (-2620.748) (-2619.858) (-2624.256) [-2615.358] * (-2623.126) (-2617.012) [-2624.726] (-2621.600) -- 0:00:35 936500 -- (-2622.474) [-2616.894] (-2627.512) (-2627.878) * (-2632.329) (-2621.104) [-2616.447] (-2617.994) -- 0:00:35 937000 -- (-2629.051) [-2623.897] (-2617.753) (-2618.967) * (-2631.377) (-2621.139) [-2620.479] (-2615.498) -- 0:00:35 937500 -- (-2626.619) [-2619.363] (-2624.450) (-2619.018) * (-2616.336) [-2620.573] (-2626.242) (-2635.584) -- 0:00:34 938000 -- (-2625.147) [-2617.260] (-2625.627) (-2616.071) * (-2631.459) [-2615.788] (-2629.983) (-2624.994) -- 0:00:34 938500 -- (-2617.867) [-2616.862] (-2621.001) (-2619.816) * (-2620.515) [-2617.094] (-2621.361) (-2619.707) -- 0:00:34 939000 -- (-2625.247) (-2625.613) [-2623.574] (-2628.891) * (-2625.862) (-2615.475) [-2614.752] (-2621.226) -- 0:00:34 939500 -- [-2622.404] (-2633.479) (-2626.476) (-2625.735) * (-2622.031) (-2616.939) (-2617.997) [-2618.710] -- 0:00:33 940000 -- (-2615.271) [-2621.157] (-2617.250) (-2626.472) * (-2619.487) (-2618.115) (-2623.552) [-2618.520] -- 0:00:33 Average standard deviation of split frequencies: 0.005095 940500 -- [-2614.455] (-2625.080) (-2617.973) (-2634.851) * (-2622.913) (-2627.599) [-2620.954] (-2618.500) -- 0:00:33 941000 -- (-2618.126) [-2621.244] (-2620.235) (-2619.065) * (-2620.998) (-2621.405) [-2625.598] (-2619.528) -- 0:00:32 941500 -- (-2616.846) (-2627.347) (-2621.167) [-2618.742] * [-2617.554] (-2624.258) (-2620.595) (-2628.695) -- 0:00:32 942000 -- [-2619.038] (-2624.526) (-2626.933) (-2617.130) * [-2619.431] (-2617.154) (-2625.479) (-2631.092) -- 0:00:32 942500 -- (-2620.600) (-2623.488) (-2616.399) [-2615.607] * (-2615.201) [-2626.176] (-2627.644) (-2621.878) -- 0:00:32 943000 -- [-2613.161] (-2618.756) (-2625.968) (-2636.195) * (-2630.852) (-2621.060) [-2624.046] (-2625.545) -- 0:00:31 943500 -- (-2621.716) [-2616.983] (-2627.730) (-2628.086) * (-2624.278) [-2620.752] (-2624.145) (-2627.112) -- 0:00:31 944000 -- [-2621.918] (-2627.874) (-2625.610) (-2628.117) * (-2625.200) [-2616.164] (-2619.549) (-2624.996) -- 0:00:31 944500 -- [-2622.753] (-2614.039) (-2624.522) (-2630.302) * (-2629.979) [-2620.581] (-2613.564) (-2617.949) -- 0:00:30 945000 -- (-2616.861) (-2620.201) [-2613.636] (-2627.226) * [-2618.421] (-2630.024) (-2617.798) (-2617.036) -- 0:00:30 Average standard deviation of split frequencies: 0.004942 945500 -- (-2622.344) (-2619.221) (-2620.563) [-2617.065] * (-2621.607) [-2623.596] (-2626.882) (-2626.274) -- 0:00:30 946000 -- (-2623.761) (-2619.824) (-2623.804) [-2619.671] * (-2628.451) (-2623.549) [-2619.090] (-2618.696) -- 0:00:30 946500 -- [-2617.110] (-2628.169) (-2618.188) (-2622.148) * (-2619.759) [-2619.646] (-2621.202) (-2617.223) -- 0:00:29 947000 -- [-2617.999] (-2618.115) (-2632.635) (-2619.671) * [-2617.291] (-2620.580) (-2622.401) (-2620.553) -- 0:00:29 947500 -- (-2621.598) (-2613.905) (-2638.340) [-2619.115] * (-2616.331) [-2616.666] (-2634.287) (-2620.622) -- 0:00:29 948000 -- (-2628.311) (-2621.347) [-2623.551] (-2620.134) * [-2615.337] (-2626.405) (-2630.824) (-2621.777) -- 0:00:29 948500 -- (-2626.018) (-2617.777) (-2618.269) [-2625.696] * [-2621.478] (-2626.851) (-2622.461) (-2630.314) -- 0:00:28 949000 -- [-2622.540] (-2614.291) (-2622.506) (-2616.231) * (-2614.934) (-2622.914) (-2622.299) [-2615.653] -- 0:00:28 949500 -- (-2620.374) (-2622.176) (-2618.172) [-2614.105] * [-2617.150] (-2625.020) (-2625.005) (-2617.350) -- 0:00:28 950000 -- [-2617.039] (-2616.312) (-2622.417) (-2628.878) * [-2618.121] (-2622.443) (-2626.632) (-2621.883) -- 0:00:27 Average standard deviation of split frequencies: 0.004752 950500 -- (-2620.651) [-2612.481] (-2620.150) (-2624.223) * (-2619.888) (-2624.172) (-2619.405) [-2619.944] -- 0:00:27 951000 -- [-2613.185] (-2618.689) (-2622.104) (-2625.189) * (-2624.051) (-2621.622) [-2616.055] (-2618.552) -- 0:00:27 951500 -- [-2616.343] (-2616.809) (-2617.024) (-2623.992) * (-2623.265) (-2625.432) (-2627.646) [-2625.947] -- 0:00:27 952000 -- (-2620.204) (-2630.633) [-2618.836] (-2616.009) * (-2626.692) (-2619.201) [-2618.148] (-2616.378) -- 0:00:26 952500 -- (-2629.008) (-2617.318) [-2618.066] (-2623.230) * (-2616.767) (-2626.125) [-2615.204] (-2617.317) -- 0:00:26 953000 -- (-2620.248) (-2616.794) (-2622.608) [-2616.200] * (-2622.053) (-2615.759) (-2613.401) [-2618.039] -- 0:00:26 953500 -- (-2624.219) [-2619.528] (-2616.569) (-2617.521) * (-2620.257) (-2625.491) [-2612.254] (-2628.533) -- 0:00:25 954000 -- (-2626.029) [-2616.792] (-2623.481) (-2618.651) * (-2620.351) (-2613.442) [-2613.943] (-2624.316) -- 0:00:25 954500 -- (-2615.651) (-2622.700) [-2614.599] (-2618.072) * (-2626.667) (-2625.668) (-2628.866) [-2616.980] -- 0:00:25 955000 -- (-2615.259) (-2627.304) (-2625.410) [-2616.918] * (-2624.122) [-2619.845] (-2627.745) (-2627.303) -- 0:00:25 Average standard deviation of split frequencies: 0.004767 955500 -- (-2629.497) [-2619.782] (-2622.764) (-2619.239) * (-2619.386) (-2613.883) [-2617.954] (-2619.778) -- 0:00:24 956000 -- (-2617.926) (-2619.257) [-2623.038] (-2623.470) * (-2617.572) (-2621.401) [-2624.693] (-2627.217) -- 0:00:24 956500 -- [-2613.366] (-2617.706) (-2618.821) (-2621.783) * (-2629.632) [-2613.950] (-2629.215) (-2617.068) -- 0:00:24 957000 -- (-2621.629) (-2619.492) [-2611.565] (-2615.988) * (-2616.885) (-2617.995) [-2620.710] (-2614.291) -- 0:00:23 957500 -- (-2629.374) (-2621.287) [-2612.297] (-2619.675) * [-2614.101] (-2626.944) (-2615.485) (-2621.021) -- 0:00:23 958000 -- (-2627.040) (-2625.515) [-2618.298] (-2617.435) * (-2624.733) (-2630.923) (-2622.472) [-2623.017] -- 0:00:23 958500 -- (-2627.700) [-2618.377] (-2623.910) (-2620.333) * (-2618.761) (-2619.784) (-2620.170) [-2616.713] -- 0:00:23 959000 -- (-2622.541) [-2615.339] (-2618.164) (-2622.131) * [-2621.449] (-2615.392) (-2620.167) (-2619.583) -- 0:00:22 959500 -- (-2622.796) (-2624.414) (-2618.718) [-2617.458] * (-2626.686) [-2622.520] (-2617.839) (-2623.676) -- 0:00:22 960000 -- (-2621.754) (-2620.603) (-2615.396) [-2622.835] * (-2622.302) (-2625.125) [-2622.705] (-2618.019) -- 0:00:22 Average standard deviation of split frequencies: 0.004907 960500 -- (-2626.816) [-2626.536] (-2618.183) (-2618.679) * (-2629.016) (-2624.851) (-2627.118) [-2621.750] -- 0:00:22 961000 -- [-2619.713] (-2639.084) (-2616.680) (-2622.774) * (-2616.616) (-2625.120) (-2622.262) [-2614.476] -- 0:00:21 961500 -- [-2622.741] (-2628.341) (-2621.400) (-2618.926) * (-2625.920) (-2623.942) (-2617.825) [-2620.474] -- 0:00:21 962000 -- (-2621.410) (-2632.092) [-2624.682] (-2615.881) * (-2616.790) (-2628.406) [-2612.545] (-2624.990) -- 0:00:21 962500 -- (-2627.370) (-2630.736) [-2614.851] (-2614.727) * (-2617.566) [-2614.989] (-2617.708) (-2626.143) -- 0:00:20 963000 -- (-2623.682) (-2622.821) [-2616.680] (-2624.538) * [-2623.803] (-2626.376) (-2618.518) (-2623.385) -- 0:00:20 963500 -- (-2629.710) (-2622.496) (-2626.224) [-2623.603] * (-2620.213) (-2622.758) [-2613.741] (-2620.947) -- 0:00:20 964000 -- (-2618.630) (-2616.642) (-2616.181) [-2617.652] * (-2614.940) (-2623.320) [-2621.433] (-2622.251) -- 0:00:20 964500 -- [-2620.575] (-2619.689) (-2620.897) (-2618.464) * (-2620.149) [-2616.932] (-2617.252) (-2622.232) -- 0:00:19 965000 -- (-2624.174) (-2620.980) [-2614.597] (-2619.170) * (-2622.048) (-2617.330) [-2616.151] (-2620.555) -- 0:00:19 Average standard deviation of split frequencies: 0.005612 965500 -- (-2622.354) (-2630.573) (-2620.639) [-2630.922] * (-2619.985) (-2616.451) (-2622.429) [-2613.424] -- 0:00:19 966000 -- (-2617.710) (-2622.051) [-2624.239] (-2620.714) * (-2635.633) [-2626.431] (-2617.471) (-2628.008) -- 0:00:18 966500 -- (-2613.436) [-2623.326] (-2625.219) (-2626.739) * (-2619.429) (-2620.180) [-2615.902] (-2626.809) -- 0:00:18 967000 -- (-2624.380) [-2618.672] (-2618.293) (-2625.884) * [-2628.559] (-2624.009) (-2619.984) (-2620.180) -- 0:00:18 967500 -- (-2611.655) [-2617.693] (-2617.642) (-2622.491) * (-2625.165) (-2627.562) [-2622.334] (-2617.838) -- 0:00:18 968000 -- (-2633.959) (-2624.489) [-2616.396] (-2625.347) * (-2636.271) [-2624.697] (-2628.019) (-2623.269) -- 0:00:17 968500 -- (-2634.930) (-2623.978) (-2614.580) [-2622.137] * (-2621.916) (-2616.206) (-2620.054) [-2619.108] -- 0:00:17 969000 -- (-2626.067) (-2626.548) (-2624.565) [-2618.685] * [-2619.296] (-2618.754) (-2626.973) (-2620.715) -- 0:00:17 969500 -- [-2621.421] (-2629.071) (-2620.314) (-2620.044) * (-2621.948) (-2616.091) [-2622.609] (-2630.491) -- 0:00:17 970000 -- (-2632.030) [-2619.701] (-2624.876) (-2616.759) * (-2621.906) (-2627.938) (-2623.072) [-2625.242] -- 0:00:16 Average standard deviation of split frequencies: 0.005949 970500 -- (-2619.296) [-2619.561] (-2619.855) (-2631.268) * (-2623.221) [-2622.567] (-2626.533) (-2630.997) -- 0:00:16 971000 -- (-2632.752) (-2624.443) [-2622.110] (-2632.355) * [-2621.168] (-2626.188) (-2617.447) (-2622.119) -- 0:00:16 971500 -- [-2623.891] (-2616.572) (-2624.867) (-2619.202) * [-2615.420] (-2617.619) (-2620.287) (-2618.513) -- 0:00:15 972000 -- (-2620.741) [-2613.695] (-2619.652) (-2620.671) * (-2621.638) (-2619.402) [-2626.523] (-2614.117) -- 0:00:15 972500 -- [-2621.715] (-2619.422) (-2621.290) (-2626.672) * [-2619.172] (-2619.923) (-2615.097) (-2622.753) -- 0:00:15 973000 -- (-2622.573) (-2618.696) (-2629.974) [-2615.611] * (-2614.244) (-2624.621) [-2620.832] (-2617.318) -- 0:00:15 973500 -- (-2625.414) [-2624.306] (-2625.297) (-2611.743) * (-2623.770) (-2629.918) (-2623.382) [-2625.293] -- 0:00:14 974000 -- [-2627.036] (-2628.857) (-2626.577) (-2616.780) * (-2627.624) (-2631.441) (-2615.493) [-2615.502] -- 0:00:14 974500 -- (-2618.886) [-2623.970] (-2631.258) (-2617.240) * (-2628.613) (-2632.526) (-2623.871) [-2617.823] -- 0:00:14 975000 -- (-2623.225) (-2619.006) (-2624.527) [-2614.482] * (-2615.569) (-2624.179) [-2613.067] (-2618.369) -- 0:00:13 Average standard deviation of split frequencies: 0.006480 975500 -- (-2623.519) (-2619.228) [-2619.178] (-2615.142) * (-2626.518) (-2620.221) [-2612.972] (-2627.001) -- 0:00:13 976000 -- [-2621.930] (-2615.709) (-2621.216) (-2628.784) * (-2612.111) (-2621.790) [-2618.937] (-2624.251) -- 0:00:13 976500 -- (-2617.287) (-2621.983) [-2613.974] (-2610.661) * [-2616.439] (-2613.776) (-2619.928) (-2619.115) -- 0:00:13 977000 -- (-2622.054) [-2616.567] (-2623.853) (-2615.344) * (-2613.053) [-2616.413] (-2619.863) (-2617.121) -- 0:00:12 977500 -- (-2618.360) (-2615.476) [-2622.675] (-2624.924) * [-2620.821] (-2634.754) (-2623.183) (-2619.132) -- 0:00:12 978000 -- (-2618.836) [-2624.708] (-2634.667) (-2622.624) * (-2624.961) (-2621.810) (-2626.357) [-2616.353] -- 0:00:12 978500 -- (-2628.193) (-2625.028) [-2615.813] (-2625.809) * (-2626.083) [-2617.732] (-2619.421) (-2612.217) -- 0:00:11 979000 -- (-2619.324) (-2630.714) [-2620.500] (-2622.085) * (-2620.257) (-2624.954) (-2627.040) [-2619.495] -- 0:00:11 979500 -- (-2622.821) [-2617.411] (-2631.890) (-2633.444) * [-2615.437] (-2618.576) (-2625.806) (-2621.073) -- 0:00:11 980000 -- (-2623.456) [-2623.373] (-2623.701) (-2631.534) * [-2617.483] (-2619.282) (-2616.241) (-2625.898) -- 0:00:11 Average standard deviation of split frequencies: 0.006129 980500 -- (-2617.058) (-2627.309) [-2622.104] (-2620.979) * (-2630.264) (-2619.876) (-2624.747) [-2620.493] -- 0:00:10 981000 -- (-2625.719) [-2627.739] (-2612.532) (-2621.773) * (-2628.879) [-2621.071] (-2622.696) (-2618.767) -- 0:00:10 981500 -- (-2622.501) (-2623.514) (-2625.729) [-2615.864] * (-2624.017) (-2618.818) (-2617.486) [-2622.625] -- 0:00:10 982000 -- (-2627.696) (-2621.801) (-2618.449) [-2618.571] * (-2624.879) (-2620.864) (-2628.487) [-2621.742] -- 0:00:10 982500 -- (-2620.176) (-2623.781) [-2622.379] (-2626.097) * (-2624.407) (-2619.496) (-2626.056) [-2617.293] -- 0:00:09 983000 -- (-2614.850) (-2622.428) (-2621.664) [-2614.924] * [-2617.059] (-2610.535) (-2621.012) (-2613.716) -- 0:00:09 983500 -- [-2617.213] (-2617.180) (-2615.478) (-2631.232) * (-2614.765) [-2613.395] (-2620.320) (-2627.549) -- 0:00:09 984000 -- [-2627.254] (-2623.770) (-2616.521) (-2622.676) * (-2626.161) (-2625.229) [-2614.153] (-2616.708) -- 0:00:08 984500 -- (-2627.507) (-2622.903) (-2613.029) [-2623.752] * (-2615.698) (-2627.242) (-2628.391) [-2620.155] -- 0:00:08 985000 -- (-2619.174) [-2618.910] (-2619.997) (-2621.169) * (-2621.840) [-2614.304] (-2629.333) (-2612.510) -- 0:00:08 Average standard deviation of split frequencies: 0.006375 985500 -- (-2622.504) (-2622.005) [-2620.685] (-2621.130) * (-2621.065) [-2612.254] (-2628.078) (-2630.443) -- 0:00:08 986000 -- (-2625.928) [-2622.583] (-2623.207) (-2616.679) * (-2617.885) [-2618.183] (-2628.094) (-2620.234) -- 0:00:07 986500 -- (-2618.050) (-2630.675) (-2620.657) [-2619.162] * (-2621.951) (-2635.034) [-2628.438] (-2620.519) -- 0:00:07 987000 -- (-2613.956) [-2620.637] (-2613.979) (-2619.480) * (-2621.104) (-2628.020) (-2622.778) [-2616.712] -- 0:00:07 987500 -- [-2616.368] (-2618.847) (-2624.691) (-2620.607) * (-2618.280) [-2615.938] (-2622.638) (-2630.872) -- 0:00:06 988000 -- [-2613.708] (-2621.534) (-2625.608) (-2614.791) * (-2622.406) (-2621.233) [-2615.683] (-2618.308) -- 0:00:06 988500 -- (-2620.428) (-2614.048) (-2631.281) [-2615.035] * [-2614.832] (-2625.307) (-2629.345) (-2620.462) -- 0:00:06 989000 -- (-2619.117) (-2615.221) (-2625.484) [-2614.914] * (-2616.191) (-2622.121) [-2622.280] (-2626.296) -- 0:00:06 989500 -- [-2613.599] (-2620.957) (-2616.627) (-2624.560) * [-2622.538] (-2619.237) (-2622.875) (-2631.726) -- 0:00:05 990000 -- (-2623.687) [-2619.476] (-2616.045) (-2614.759) * (-2617.879) (-2621.039) (-2632.039) [-2627.020] -- 0:00:05 Average standard deviation of split frequencies: 0.006345 990500 -- (-2621.553) (-2630.834) (-2626.808) [-2615.528] * [-2614.860] (-2618.313) (-2624.517) (-2627.235) -- 0:00:05 991000 -- [-2622.419] (-2629.056) (-2624.514) (-2612.649) * (-2619.162) (-2623.668) (-2633.465) [-2620.963] -- 0:00:05 991500 -- [-2624.103] (-2627.998) (-2619.861) (-2620.833) * [-2617.198] (-2628.387) (-2626.242) (-2622.789) -- 0:00:04 992000 -- (-2617.330) (-2617.827) (-2624.742) [-2623.364] * (-2625.599) [-2623.935] (-2627.623) (-2613.915) -- 0:00:04 992500 -- [-2619.223] (-2615.914) (-2615.647) (-2614.960) * [-2618.527] (-2621.359) (-2621.256) (-2619.794) -- 0:00:04 993000 -- (-2620.936) (-2614.868) (-2625.780) [-2618.642] * (-2621.780) (-2620.808) (-2618.548) [-2623.377] -- 0:00:03 993500 -- (-2619.146) [-2614.176] (-2626.661) (-2625.267) * [-2612.554] (-2619.858) (-2628.674) (-2620.854) -- 0:00:03 994000 -- (-2620.787) (-2619.420) (-2624.742) [-2619.770] * (-2626.163) (-2628.722) (-2613.086) [-2616.826] -- 0:00:03 994500 -- [-2620.781] (-2629.904) (-2624.026) (-2624.330) * (-2618.184) (-2614.873) [-2615.564] (-2617.860) -- 0:00:03 995000 -- (-2620.597) (-2623.050) (-2614.988) [-2614.480] * (-2617.043) (-2618.350) (-2614.882) [-2609.564] -- 0:00:02 Average standard deviation of split frequencies: 0.006311 995500 -- [-2616.680] (-2623.483) (-2621.961) (-2620.537) * (-2622.632) [-2618.714] (-2617.027) (-2619.364) -- 0:00:02 996000 -- (-2624.234) (-2619.523) [-2616.658] (-2623.047) * (-2621.439) (-2621.043) [-2620.153] (-2617.664) -- 0:00:02 996500 -- [-2625.687] (-2625.280) (-2622.445) (-2624.033) * (-2624.560) (-2624.383) (-2618.466) [-2626.596] -- 0:00:01 997000 -- [-2626.242] (-2617.279) (-2627.633) (-2626.322) * (-2620.713) (-2623.502) [-2618.370] (-2624.608) -- 0:00:01 997500 -- (-2625.642) [-2620.039] (-2616.160) (-2626.103) * (-2617.415) (-2626.035) (-2622.487) [-2616.768] -- 0:00:01 998000 -- (-2621.661) [-2615.794] (-2621.631) (-2632.112) * (-2622.902) [-2617.797] (-2619.218) (-2630.017) -- 0:00:01 998500 -- (-2625.258) (-2619.560) (-2618.818) [-2616.139] * [-2628.159] (-2612.664) (-2624.810) (-2622.188) -- 0:00:00 999000 -- [-2609.820] (-2629.181) (-2622.589) (-2618.997) * (-2625.569) (-2622.865) (-2621.772) [-2620.274] -- 0:00:00 999500 -- (-2628.405) (-2633.003) [-2623.662] (-2625.340) * (-2623.587) (-2624.637) (-2621.721) [-2613.543] -- 0:00:00 1000000 -- (-2617.289) (-2628.065) [-2622.286] (-2616.941) * (-2622.474) (-2622.695) (-2617.683) [-2616.816] -- 0:00:00 Average standard deviation of split frequencies: 0.006674 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2617.288649 -- 21.755875 Chain 1 -- -2617.288646 -- 21.755875 Chain 2 -- -2628.065144 -- 18.893639 Chain 2 -- -2628.065144 -- 18.893639 Chain 3 -- -2622.285955 -- 24.888096 Chain 3 -- -2622.285966 -- 24.888096 Chain 4 -- -2616.940696 -- 23.199053 Chain 4 -- -2616.940696 -- 23.199053 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2622.473854 -- 20.616119 Chain 1 -- -2622.473862 -- 20.616119 Chain 2 -- -2622.695053 -- 23.069724 Chain 2 -- -2622.695043 -- 23.069724 Chain 3 -- -2617.683059 -- 25.122524 Chain 3 -- -2617.683057 -- 25.122524 Chain 4 -- -2616.816480 -- 21.986655 Chain 4 -- -2616.816491 -- 21.986655 Analysis completed in 9 mins 18 seconds Analysis used 558.03 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2607.60 Likelihood of best state for "cold" chain of run 2 was -2607.81 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 41.5 % ( 32 %) Dirichlet(Revmat{all}) 58.5 % ( 43 %) Slider(Revmat{all}) 25.3 % ( 26 %) Dirichlet(Pi{all}) 26.5 % ( 22 %) Slider(Pi{all}) 33.0 % ( 25 %) Multiplier(Alpha{1,2}) 43.9 % ( 28 %) Multiplier(Alpha{3}) 58.5 % ( 28 %) Slider(Pinvar{all}) 13.4 % ( 21 %) ExtSPR(Tau{all},V{all}) 4.4 % ( 5 %) ExtTBR(Tau{all},V{all}) 20.6 % ( 21 %) NNI(Tau{all},V{all}) 25.3 % ( 27 %) ParsSPR(Tau{all},V{all}) 26.4 % ( 30 %) Multiplier(V{all}) 35.8 % ( 45 %) Nodeslider(V{all}) 25.2 % ( 23 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 41.8 % ( 35 %) Dirichlet(Revmat{all}) 58.3 % ( 42 %) Slider(Revmat{all}) 25.9 % ( 28 %) Dirichlet(Pi{all}) 27.3 % ( 35 %) Slider(Pi{all}) 33.2 % ( 34 %) Multiplier(Alpha{1,2}) 44.2 % ( 25 %) Multiplier(Alpha{3}) 58.2 % ( 28 %) Slider(Pinvar{all}) 13.6 % ( 8 %) ExtSPR(Tau{all},V{all}) 4.4 % ( 3 %) ExtTBR(Tau{all},V{all}) 20.9 % ( 17 %) NNI(Tau{all},V{all}) 25.4 % ( 27 %) ParsSPR(Tau{all},V{all}) 26.3 % ( 30 %) Multiplier(V{all}) 35.6 % ( 37 %) Nodeslider(V{all}) 25.1 % ( 16 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.43 2 | 166928 0.79 0.62 3 | 166754 166460 0.81 4 | 166586 166541 166731 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.44 2 | 166897 0.80 0.62 3 | 166604 166844 0.81 4 | 166698 166066 166891 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2617.02 | 1 1 | | 1 2 | | 1 12 12 1 * 1 2 | | 1 21 2 212 2 2 | | 2 1 2 2 1 2 1| |1 2 2 1 2 2 12 12 2 2 2 2 22 2| | 2 2 21 1222 1 121 2 1 *1 2 11 | |2 1 1 2 112 1 1 122 2 1 1 1 1 2 | | 2 1 2 11 1 2 12 1 2 1 * | | * 2 11 1 11 1 | | 1 2 1 2 2 2 | | 1 2 1 1 | | 2 | | | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2621.70 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2613.98 -2629.19 2 -2613.84 -2629.62 -------------------------------------- TOTAL -2613.91 -2629.43 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.722907 0.005789 0.572287 0.862370 0.719673 1331.12 1335.64 1.000 r(A<->C){all} 0.081119 0.000339 0.047377 0.117844 0.079887 867.86 873.55 1.000 r(A<->G){all} 0.198885 0.001149 0.134344 0.265523 0.196746 747.58 771.34 1.000 r(A<->T){all} 0.097152 0.001028 0.034606 0.157303 0.094691 728.63 790.69 1.004 r(C<->G){all} 0.072612 0.000247 0.042920 0.103686 0.071764 954.95 1034.68 1.000 r(C<->T){all} 0.474700 0.002301 0.382864 0.568550 0.474701 829.04 883.05 1.000 r(G<->T){all} 0.075532 0.000647 0.031406 0.128180 0.073263 687.88 861.57 1.001 pi(A){all} 0.243914 0.000191 0.215922 0.268917 0.243914 1081.24 1089.89 1.000 pi(C){all} 0.346969 0.000226 0.318347 0.377792 0.347028 1159.49 1220.89 1.000 pi(G){all} 0.264963 0.000191 0.239193 0.293374 0.264957 1170.36 1241.69 1.000 pi(T){all} 0.144154 0.000120 0.122731 0.164842 0.143690 931.92 1027.83 1.000 alpha{1,2} 0.145833 0.001290 0.077876 0.216657 0.143155 1070.44 1130.56 1.000 alpha{3} 1.941445 0.482982 0.884721 3.425454 1.817368 1305.07 1331.93 1.000 pinvar{all} 0.199859 0.007647 0.020301 0.351955 0.202562 1059.92 1091.67 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 Key to taxon bipartitions (saved to file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------------- 1 -- .********* 2 -- .*........ 3 -- ..*....... 4 -- ...*...... 5 -- ....*..... 6 -- .....*.... 7 -- ......*... 8 -- .......*.. 9 -- ........*. 10 -- .........* 11 -- .......**. 12 -- .....***** 13 -- ...******* 14 -- .....*.*** 15 -- ..******** 16 -- .....*...* 17 -- ...**..... 18 -- .......*** 19 -- ....****** 20 -- ...*.***** 21 -- .**....... 22 -- .*.******* ---------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 11 3002 1.000000 0.000000 1.000000 1.000000 2 12 3002 1.000000 0.000000 1.000000 1.000000 2 13 3000 0.999334 0.000942 0.998668 1.000000 2 14 2761 0.919720 0.000471 0.919387 0.920053 2 15 2068 0.688874 0.015075 0.678215 0.699534 2 16 2015 0.671219 0.007066 0.666223 0.676216 2 17 1669 0.555963 0.013662 0.546302 0.565623 2 18 928 0.309127 0.012248 0.300466 0.317788 2 19 765 0.254830 0.014604 0.244504 0.265157 2 20 568 0.189207 0.000942 0.188541 0.189873 2 21 483 0.160893 0.010835 0.153231 0.168554 2 22 451 0.150233 0.004240 0.147235 0.153231 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.018082 0.000036 0.007373 0.029299 0.017432 1.000 2 length{all}[2] 0.014375 0.000027 0.005218 0.024283 0.013789 1.000 2 length{all}[3] 0.009118 0.000018 0.002081 0.017392 0.008407 1.000 2 length{all}[4] 0.011908 0.000026 0.003657 0.022296 0.011258 1.000 2 length{all}[5] 0.010265 0.000021 0.002936 0.019717 0.009739 1.000 2 length{all}[6] 0.115343 0.000540 0.073415 0.162269 0.113635 1.000 2 length{all}[7] 0.241222 0.001626 0.171946 0.329913 0.237121 1.000 2 length{all}[8] 0.048971 0.000155 0.024467 0.072730 0.047848 1.000 2 length{all}[9] 0.039007 0.000124 0.017886 0.060030 0.038192 1.000 2 length{all}[10] 0.060229 0.000248 0.033566 0.092612 0.058656 1.000 2 length{all}[11] 0.040386 0.000163 0.017872 0.065656 0.039232 1.000 2 length{all}[12] 0.052728 0.000245 0.024938 0.084514 0.051296 1.000 2 length{all}[13] 0.013369 0.000033 0.003485 0.024704 0.012574 1.000 2 length{all}[14] 0.024101 0.000170 0.000533 0.047841 0.022353 1.000 2 length{all}[15] 0.003355 0.000007 0.000015 0.008089 0.002732 1.000 2 length{all}[16] 0.019180 0.000108 0.001848 0.039071 0.017799 1.000 2 length{all}[17] 0.005422 0.000017 0.000006 0.013409 0.004389 1.001 2 length{all}[18] 0.015117 0.000092 0.000165 0.033271 0.013777 0.999 2 length{all}[19] 0.003260 0.000007 0.000001 0.008299 0.002571 0.999 2 length{all}[20] 0.003019 0.000008 0.000003 0.008598 0.002157 1.000 2 length{all}[21] 0.002019 0.000004 0.000004 0.006593 0.001292 1.004 2 length{all}[22] 0.001797 0.000003 0.000003 0.005181 0.001249 1.001 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.006674 Maximum standard deviation of split frequencies = 0.015075 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.004 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C2 (2) | + /---------------------------------------------------------- C3 (3) | | | | /------------ C4 (4) | | /----------------56----------------+ \-----69----+ | \------------ C5 (5) | | | | /------------ C6 (6) | | /----67----+ \----100---+ | \------------ C10 (10) | /-----92----+ | | | /------------ C8 (8) | | \----100---+ \----100----+ \------------ C9 (9) | \----------------------------------- C7 (7) Phylogram (based on average branch lengths): /---- C1 (1) | |--- C2 (2) | +/-- C3 (3) || || /-- C4 (4) || /+ \+ |\-- C5 (5) | | | | /--------------------------- C6 (6) | | /---+ \--+ | \-------------- C10 (10) | /----+ | | | /------------ C8 (8) | | \--------+ \-----------+ \--------- C9 (9) | \-------------------------------------------------------- C7 (7) |----------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (81 trees sampled): 50 % credible set contains 4 trees 90 % credible set contains 16 trees 95 % credible set contains 26 trees 99 % credible set contains 55 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 10 ls = 882 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Sites with gaps or missing data are removed. 72 ambiguity characters in seq. 1 72 ambiguity characters in seq. 2 72 ambiguity characters in seq. 3 72 ambiguity characters in seq. 4 72 ambiguity characters in seq. 5 66 ambiguity characters in seq. 6 69 ambiguity characters in seq. 7 51 ambiguity characters in seq. 8 75 ambiguity characters in seq. 9 66 ambiguity characters in seq. 10 35 sites are removed. 15 16 31 39 46 47 52 53 54 56 57 58 59 64 65 66 71 76 83 84 92 93 94 96 97 98 99 287 288 289 290 291 292 293 294 Sequences read.. Counting site patterns.. 0:00 176 patterns at 259 / 259 sites (100.0%), 0:00 Counting codons.. 360 bytes for distance 171776 bytes for conP 23936 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 687104 bytes for conP, adjusted 0.035472 0.030270 0.002720 0.012939 0.017434 0.009975 0.024591 0.015232 0.077985 0.018864 0.028901 0.149613 0.106278 0.049211 0.089025 0.072794 0.328418 0.300000 1.300000 ntime & nrate & np: 17 2 19 Bounds (np=19): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 19 lnL0 = -2662.510968 Iterating by ming2 Initial: fx= 2662.510968 x= 0.03547 0.03027 0.00272 0.01294 0.01743 0.00998 0.02459 0.01523 0.07799 0.01886 0.02890 0.14961 0.10628 0.04921 0.08903 0.07279 0.32842 0.30000 1.30000 1 h-m-p 0.0000 0.0005 440.6381 +++ 2640.739264 m 0.0005 25 | 0/19 2 h-m-p 0.0000 0.0000 129849.0484 +YCCC 2637.240520 3 0.0000 53 | 0/19 3 h-m-p 0.0000 0.0001 5469.1752 YCYCC 2628.366845 4 0.0000 81 | 0/19 4 h-m-p 0.0001 0.0003 707.3988 +CYYCCCCC 2594.351861 7 0.0003 116 | 0/19 5 h-m-p 0.0000 0.0001 2622.8463 +CYYYC 2569.748417 4 0.0001 144 | 0/19 6 h-m-p 0.0000 0.0000 19453.6834 +CYYYYC 2558.842197 5 0.0000 173 | 0/19 7 h-m-p 0.0000 0.0002 873.0218 +CYYCCC 2538.460687 5 0.0002 204 | 0/19 8 h-m-p 0.0000 0.0001 2281.2430 +YYYCCCCC 2506.972332 7 0.0001 238 | 0/19 9 h-m-p 0.0000 0.0001 672.0246 +YYCCC 2500.897340 4 0.0001 267 | 0/19 10 h-m-p 0.0000 0.0001 842.9476 +CYCCC 2495.756939 4 0.0001 297 | 0/19 11 h-m-p 0.0000 0.0009 906.4650 ++YYYYYYCYCC 2345.949252 10 0.0008 333 | 0/19 12 h-m-p 0.0000 0.0000 2316.3704 YYCC 2345.060926 3 0.0000 359 | 0/19 13 h-m-p 0.0003 0.0066 32.5647 +YCCC 2344.426239 3 0.0009 387 | 0/19 14 h-m-p 0.0006 0.0031 25.9958 CC 2344.096665 1 0.0007 411 | 0/19 15 h-m-p 0.0013 0.0207 13.3831 ++YCCC 2335.918820 3 0.0146 440 | 0/19 16 h-m-p 0.0006 0.0031 73.0457 YCYCCC 2327.599389 5 0.0016 470 | 0/19 17 h-m-p 0.0001 0.0006 374.8173 +YYCCCC 2317.410584 5 0.0004 501 | 0/19 18 h-m-p 0.0003 0.0015 83.3375 YCCCCC 2315.308131 5 0.0006 532 | 0/19 19 h-m-p 0.0009 0.0045 32.7865 YCC 2314.996449 2 0.0006 557 | 0/19 20 h-m-p 0.0258 0.2900 0.7833 +YYCCCCC 2308.245974 6 0.1195 590 | 0/19 21 h-m-p 0.0012 0.0058 31.4537 YCC 2307.937101 2 0.0006 634 | 0/19 22 h-m-p 0.0633 0.5858 0.2962 +YCYCCCC 2298.824481 6 0.3232 667 | 0/19 23 h-m-p 0.3009 2.7308 0.3182 CYCCC 2292.809002 4 0.3575 715 | 0/19 24 h-m-p 0.3055 1.5274 0.2447 +YYCCCC 2283.534877 5 0.9263 765 | 0/19 25 h-m-p 0.6193 3.0967 0.1404 CCCC 2280.313073 3 0.7964 812 | 0/19 26 h-m-p 0.9379 4.6894 0.0986 CCCC 2278.704564 3 1.2318 859 | 0/19 27 h-m-p 1.1104 5.5522 0.0489 CCCC 2278.152227 3 1.4611 906 | 0/19 28 h-m-p 1.6000 8.0000 0.0083 YCC 2277.846494 2 3.4251 950 | 0/19 29 h-m-p 1.6000 8.0000 0.0110 CCC 2277.584834 2 2.4129 995 | 0/19 30 h-m-p 1.6000 8.0000 0.0115 CCC 2277.387150 2 2.1822 1040 | 0/19 31 h-m-p 1.5534 7.7672 0.0085 CCCC 2277.175442 3 2.0496 1087 | 0/19 32 h-m-p 1.6000 8.0000 0.0082 CC 2277.010797 1 2.3646 1130 | 0/19 33 h-m-p 1.1477 8.0000 0.0169 +CCC 2276.678029 2 4.8050 1176 | 0/19 34 h-m-p 1.6000 8.0000 0.0233 CCC 2276.401261 2 1.9101 1221 | 0/19 35 h-m-p 1.3991 6.9955 0.0218 CCCC 2276.132438 3 2.0369 1268 | 0/19 36 h-m-p 1.3117 8.0000 0.0339 +YCC 2275.798891 2 3.6363 1313 | 0/19 37 h-m-p 1.6000 8.0000 0.0250 YCCC 2275.369942 3 2.8693 1359 | 0/19 38 h-m-p 1.6000 8.0000 0.0394 CYC 2274.813103 2 2.0296 1403 | 0/19 39 h-m-p 0.8239 4.1193 0.0174 CCCC 2274.639839 3 1.4239 1450 | 0/19 40 h-m-p 1.6000 8.0000 0.0060 CYC 2274.387005 2 1.9080 1494 | 0/19 41 h-m-p 0.8104 8.0000 0.0142 ++ 2273.210425 m 8.0000 1535 | 0/19 42 h-m-p 0.8929 4.4647 0.0161 CC 2272.553299 1 1.3111 1578 | 0/19 43 h-m-p 1.6000 8.0000 0.0130 YCCC 2272.239374 3 2.8937 1624 | 0/19 44 h-m-p 1.2646 8.0000 0.0298 +YCCC 2271.667927 3 3.9039 1671 | 0/19 45 h-m-p 1.6000 8.0000 0.0277 YCC 2270.823303 2 3.3024 1715 | 0/19 46 h-m-p 1.6000 8.0000 0.0114 CCC 2270.568891 2 1.8010 1760 | 0/19 47 h-m-p 1.2928 8.0000 0.0158 YC 2270.366279 1 3.2185 1802 | 0/19 48 h-m-p 1.6000 8.0000 0.0300 YC 2270.084135 1 3.8538 1844 | 0/19 49 h-m-p 1.6000 8.0000 0.0045 CCCC 2269.898250 3 2.7486 1891 | 0/19 50 h-m-p 0.7278 8.0000 0.0172 +YCC 2269.806269 2 2.3869 1936 | 0/19 51 h-m-p 1.6000 8.0000 0.0039 CC 2269.769832 1 2.1438 1979 | 0/19 52 h-m-p 1.4142 8.0000 0.0059 +YC 2269.739132 1 4.1382 2022 | 0/19 53 h-m-p 1.6000 8.0000 0.0030 C 2269.730003 0 1.6343 2063 | 0/19 54 h-m-p 1.6000 8.0000 0.0005 YC 2269.728216 1 3.1155 2105 | 0/19 55 h-m-p 0.4793 8.0000 0.0035 +YC 2269.726104 1 3.4371 2148 | 0/19 56 h-m-p 1.6000 8.0000 0.0004 YC 2269.725990 1 1.0933 2190 | 0/19 57 h-m-p 1.6000 8.0000 0.0001 Y 2269.725989 0 1.0723 2231 | 0/19 58 h-m-p 1.6000 8.0000 0.0000 Y 2269.725989 0 1.1651 2272 | 0/19 59 h-m-p 1.6000 8.0000 0.0000 Y 2269.725989 0 1.6000 2313 | 0/19 60 h-m-p 1.6000 8.0000 0.0000 C 2269.725989 0 0.4000 2354 | 0/19 61 h-m-p 0.0431 8.0000 0.0000 -C 2269.725989 0 0.0027 2396 | 0/19 62 h-m-p 0.4881 8.0000 0.0000 Y 2269.725989 0 0.1220 2437 | 0/19 63 h-m-p 0.1335 8.0000 0.0000 -----------Y 2269.725989 0 0.0000 2489 Out.. lnL = -2269.725989 2490 lfun, 2490 eigenQcodon, 42330 P(t) Time used: 0:18 Model 1: NearlyNeutral TREE # 1 (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 0.035472 0.030270 0.002720 0.012939 0.017434 0.009975 0.024591 0.015232 0.077985 0.018864 0.028901 0.149613 0.106278 0.049211 0.089025 0.072794 0.328418 2.419536 0.718247 0.265678 ntime & nrate & np: 17 2 20 Bounds (np=20): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.766591 np = 20 lnL0 = -2354.172499 Iterating by ming2 Initial: fx= 2354.172499 x= 0.03547 0.03027 0.00272 0.01294 0.01743 0.00998 0.02459 0.01523 0.07799 0.01886 0.02890 0.14961 0.10628 0.04921 0.08903 0.07279 0.32842 2.41954 0.71825 0.26568 1 h-m-p 0.0000 0.0010 403.5360 +++YCCYCCC 2289.113465 6 0.0009 40 | 0/20 2 h-m-p 0.0000 0.0001 469.6294 CYCCCC 2286.304332 5 0.0000 72 | 0/20 3 h-m-p 0.0001 0.0006 153.2983 +YCYCCC 2282.817319 5 0.0003 104 | 0/20 4 h-m-p 0.0002 0.0009 243.2864 CCCC 2281.380504 3 0.0001 133 | 0/20 5 h-m-p 0.0003 0.0015 108.3068 YCCCC 2279.310924 4 0.0006 163 | 0/20 6 h-m-p 0.0001 0.0005 205.1292 +YYCCC 2277.296010 4 0.0003 193 | 0/20 7 h-m-p 0.0001 0.0006 55.4663 YCCCC 2277.044126 4 0.0002 223 | 0/20 8 h-m-p 0.0003 0.0037 40.6017 +YYC 2276.490530 2 0.0012 249 | 0/20 9 h-m-p 0.0003 0.0016 66.2932 YCCC 2276.021916 3 0.0007 277 | 0/20 10 h-m-p 0.0006 0.0030 25.0230 CCC 2275.847896 2 0.0009 304 | 0/20 11 h-m-p 0.0003 0.0016 39.4447 YCCC 2275.700994 3 0.0006 332 | 0/20 12 h-m-p 0.0007 0.0033 21.0806 CCC 2275.613987 2 0.0008 359 | 0/20 13 h-m-p 0.0009 0.0084 17.5831 YYC 2275.547157 2 0.0008 384 | 0/20 14 h-m-p 0.0010 0.0254 13.3501 +CCCC 2275.268906 3 0.0041 414 | 0/20 15 h-m-p 0.0013 0.0189 41.1752 +YYC 2274.283229 2 0.0048 440 | 0/20 16 h-m-p 0.0003 0.0015 234.4402 CCCCC 2273.792603 4 0.0004 471 | 0/20 17 h-m-p 0.0008 0.0100 112.8927 YC 2272.867006 1 0.0016 495 | 0/20 18 h-m-p 0.0016 0.0178 112.1950 +YCYC 2270.141353 3 0.0052 523 | 0/20 19 h-m-p 0.0010 0.0052 249.0188 YCCCC 2266.859333 4 0.0025 553 | 0/20 20 h-m-p 0.0068 0.0341 4.1894 YCCC 2266.397238 3 0.0128 581 | 0/20 21 h-m-p 0.0144 0.0718 3.2881 +YYYYYC 2257.756706 5 0.0574 610 | 0/20 22 h-m-p 0.0570 0.2848 2.3678 +YCCC 2249.688827 3 0.2542 639 | 0/20 23 h-m-p 0.0281 0.1407 4.4613 CCC 2248.709695 2 0.0310 666 | 0/20 24 h-m-p 0.0968 0.5248 1.4271 +YCCC 2246.414870 3 0.2884 695 | 0/20 25 h-m-p 0.4686 3.2941 0.8784 YYC 2245.601078 2 0.3652 720 | 0/20 26 h-m-p 0.4645 2.3224 0.0381 YYC 2245.508749 2 0.3670 765 | 0/20 27 h-m-p 0.4977 7.8644 0.0281 YC 2245.485675 1 0.3333 809 | 0/20 28 h-m-p 0.4707 8.0000 0.0199 CC 2245.482382 1 0.5678 854 | 0/20 29 h-m-p 1.6000 8.0000 0.0015 Y 2245.482158 0 0.3177 897 | 0/20 30 h-m-p 0.2446 8.0000 0.0020 Y 2245.482092 0 0.5234 940 | 0/20 31 h-m-p 1.6000 8.0000 0.0004 Y 2245.482078 0 0.6677 983 | 0/20 32 h-m-p 1.1723 8.0000 0.0002 C 2245.482063 0 1.6153 1026 | 0/20 33 h-m-p 0.7571 8.0000 0.0005 C 2245.482060 0 0.7571 1069 | 0/20 34 h-m-p 1.6000 8.0000 0.0000 C 2245.482060 0 0.6276 1112 | 0/20 35 h-m-p 1.6000 8.0000 0.0000 Y 2245.482060 0 0.6675 1155 | 0/20 36 h-m-p 1.6000 8.0000 0.0000 C 2245.482060 0 0.4000 1198 | 0/20 37 h-m-p 1.3409 8.0000 0.0000 ---C 2245.482060 0 0.0052 1244 Out.. lnL = -2245.482060 1245 lfun, 3735 eigenQcodon, 42330 P(t) Time used: 0:35 Model 2: PositiveSelection TREE # 1 (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 initial w for M2:NSpselection reset. 0.035472 0.030270 0.002720 0.012939 0.017434 0.009975 0.024591 0.015232 0.077985 0.018864 0.028901 0.149613 0.106278 0.049211 0.089025 0.072794 0.328418 2.576891 1.659473 0.574115 0.238709 2.403915 ntime & nrate & np: 17 3 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.032730 np = 22 lnL0 = -2372.999121 Iterating by ming2 Initial: fx= 2372.999121 x= 0.03547 0.03027 0.00272 0.01294 0.01743 0.00998 0.02459 0.01523 0.07799 0.01886 0.02890 0.14961 0.10628 0.04921 0.08903 0.07279 0.32842 2.57689 1.65947 0.57412 0.23871 2.40392 1 h-m-p 0.0000 0.0012 416.7693 +++CYCYCYCCC 2335.483582 8 0.0010 43 | 0/22 2 h-m-p 0.0000 0.0001 356.3978 YCYCCC 2331.870902 5 0.0001 76 | 0/22 3 h-m-p 0.0001 0.0009 230.9677 +YCYYCCC 2316.729598 6 0.0007 112 | 0/22 4 h-m-p 0.0001 0.0007 460.4592 +YCCC 2307.925590 3 0.0004 143 | 0/22 5 h-m-p 0.0001 0.0007 301.9661 +YCCC 2303.544968 3 0.0004 174 | 0/22 6 h-m-p 0.0002 0.0011 75.8052 +CYCCC 2301.018355 4 0.0010 208 | 0/22 7 h-m-p 0.0008 0.0078 93.3800 +YCCC 2296.754934 3 0.0022 239 | 0/22 8 h-m-p 0.0010 0.0049 55.6718 CYCCC 2295.370319 4 0.0016 271 | 0/22 9 h-m-p 0.0012 0.0065 74.1182 YCCCC 2293.331334 4 0.0022 303 | 0/22 10 h-m-p 0.0009 0.0046 54.6168 YCCC 2292.425615 3 0.0017 333 | 0/22 11 h-m-p 0.0013 0.0065 43.2609 CYC 2291.994371 2 0.0012 361 | 0/22 12 h-m-p 0.0013 0.0063 38.0567 CC 2291.723264 1 0.0011 388 | 0/22 13 h-m-p 0.0016 0.0093 26.0521 CCCC 2291.357855 3 0.0025 419 | 0/22 14 h-m-p 0.0011 0.0056 24.7844 CCCC 2291.175954 3 0.0015 450 | 0/22 15 h-m-p 0.0022 0.0970 16.7795 +CCC 2290.594729 2 0.0081 480 | 0/22 16 h-m-p 0.0028 0.0142 27.8236 CCCC 2290.150404 3 0.0036 511 | 0/22 17 h-m-p 0.0019 0.0420 52.6067 +YCCC 2287.052608 3 0.0140 542 | 0/22 18 h-m-p 0.0074 0.0369 89.5308 YCCC 2280.804621 3 0.0174 572 | 0/22 19 h-m-p 0.0039 0.0195 155.3239 YCCC 2274.658197 3 0.0097 602 | 0/22 20 h-m-p 0.0054 0.0269 26.1845 YCCC 2273.514768 3 0.0116 632 | 0/22 21 h-m-p 0.0391 0.7012 7.7536 +CYCCCCC 2266.344106 6 0.2616 669 | 0/22 22 h-m-p 0.2883 1.4417 1.4225 +YCC 2263.074044 2 0.8267 698 | 0/22 23 h-m-p 0.0765 0.3827 6.2412 YCCCC 2258.765918 4 0.1854 730 | 0/22 24 h-m-p 0.3325 1.6626 0.4787 +YYCCC 2255.781604 4 1.0712 762 | 0/22 25 h-m-p 0.1028 0.5138 1.3982 YCCCC 2254.601513 4 0.1989 816 | 0/22 26 h-m-p 0.4437 4.0639 0.6268 YCCC 2252.400401 3 0.8036 846 | 0/22 27 h-m-p 0.2036 1.0182 0.7316 YCCCC 2251.436639 4 0.4692 900 | 0/22 28 h-m-p 0.2041 1.0205 1.1484 CCCCC 2250.624184 4 0.2736 955 | 0/22 29 h-m-p 0.1444 0.7220 0.9554 +YCCC 2249.939657 3 0.3853 986 | 0/22 30 h-m-p 0.1906 2.0060 1.9314 CYC 2249.468039 2 0.1975 1036 | 0/22 31 h-m-p 0.2902 1.4643 1.3144 YCCCC 2248.443950 4 0.5930 1068 | 0/22 32 h-m-p 0.3810 1.9051 1.8432 CCCC 2247.580580 3 0.5788 1099 | 0/22 33 h-m-p 0.2298 1.1489 2.1280 CCCC 2247.046964 3 0.3580 1130 | 0/22 34 h-m-p 0.6278 8.0000 1.2134 CYCC 2246.604592 3 0.8474 1160 | 0/22 35 h-m-p 0.5385 4.3041 1.9093 CCCC 2246.230852 3 0.6748 1191 | 0/22 36 h-m-p 0.5779 2.8896 2.1884 YYC 2245.998356 2 0.4741 1218 | 0/22 37 h-m-p 0.5967 4.4054 1.7386 YCC 2245.900807 2 0.4085 1246 | 0/22 38 h-m-p 0.3945 6.0375 1.8005 CCC 2245.821966 2 0.4133 1275 | 0/22 39 h-m-p 0.3603 8.0000 2.0652 YCCC 2245.697586 3 0.7258 1305 | 0/22 40 h-m-p 0.5532 5.6613 2.7099 YCC 2245.642515 2 0.3784 1333 | 0/22 41 h-m-p 0.4881 8.0000 2.1009 CC 2245.593953 1 0.5537 1360 | 0/22 42 h-m-p 0.7041 8.0000 1.6521 CC 2245.566560 1 0.6038 1387 | 0/22 43 h-m-p 0.5457 8.0000 1.8280 CC 2245.543368 1 0.6138 1414 | 0/22 44 h-m-p 0.6563 8.0000 1.7095 CY 2245.524264 1 0.6699 1441 | 0/22 45 h-m-p 0.5440 8.0000 2.1051 CC 2245.513227 1 0.5183 1468 | 0/22 46 h-m-p 0.5683 8.0000 1.9197 YC 2245.499817 1 1.0045 1494 | 0/22 47 h-m-p 0.9050 8.0000 2.1308 YC 2245.495325 1 0.4371 1520 | 0/22 48 h-m-p 0.6003 8.0000 1.5515 YC 2245.489613 1 1.2843 1546 | 0/22 49 h-m-p 1.1601 8.0000 1.7177 YC 2245.486989 1 0.8249 1572 | 0/22 50 h-m-p 0.6977 8.0000 2.0308 C 2245.485184 0 0.7467 1597 | 0/22 51 h-m-p 0.9306 8.0000 1.6296 C 2245.483973 0 1.0779 1622 | 0/22 52 h-m-p 0.8576 8.0000 2.0483 YC 2245.483348 1 0.5917 1648 | 0/22 53 h-m-p 0.7889 8.0000 1.5363 CC 2245.482802 1 1.2187 1675 | 0/22 54 h-m-p 1.1214 8.0000 1.6697 YC 2245.482556 1 0.8086 1701 | 0/22 55 h-m-p 1.1365 8.0000 1.1879 C 2245.482362 0 1.2992 1726 | 0/22 56 h-m-p 1.6000 8.0000 0.9467 YC 2245.482289 1 0.9360 1752 | 0/22 57 h-m-p 0.3546 8.0000 2.4994 YC 2245.482215 1 0.8197 1800 | 0/22 58 h-m-p 1.6000 8.0000 0.2326 Y 2245.482170 0 1.1210 1825 | 0/22 59 h-m-p 0.2026 8.0000 1.2868 +Y 2245.482134 0 1.5440 1873 | 0/22 60 h-m-p 1.6000 8.0000 0.7631 C 2245.482130 0 0.5476 1898 | 0/22 61 h-m-p 1.0138 8.0000 0.4122 C 2245.482120 0 0.8520 1945 | 0/22 62 h-m-p 1.0110 8.0000 0.3474 +Y 2245.482110 0 2.8198 1993 | 0/22 63 h-m-p 0.9378 8.0000 1.0445 +C 2245.482078 0 4.2705 2041 | 0/22 64 h-m-p 1.4760 8.0000 3.0220 -C 2245.482078 0 0.1129 2067 | 0/22 65 h-m-p 0.1519 8.0000 2.2448 Y 2245.482071 0 0.2938 2092 | 0/22 66 h-m-p 0.2570 8.0000 2.5661 -------C 2245.482071 0 0.0000 2124 | 0/22 67 h-m-p 0.0160 8.0000 0.0120 ++Y 2245.482071 0 0.6338 2151 | 0/22 68 h-m-p 1.6000 8.0000 0.0016 Y 2245.482071 0 0.9085 2198 | 0/22 69 h-m-p 1.6000 8.0000 0.0006 Y 2245.482071 0 1.0197 2245 | 0/22 70 h-m-p 1.6000 8.0000 0.0003 Y 2245.482071 0 0.9167 2292 | 0/22 71 h-m-p 1.6000 8.0000 0.0001 Y 2245.482071 0 1.6000 2339 | 0/22 72 h-m-p 1.6000 8.0000 0.0000 ------Y 2245.482071 0 0.0001 2392 Out.. lnL = -2245.482071 2393 lfun, 9572 eigenQcodon, 122043 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2258.061063 S = -2159.469449 -89.469063 Calculating f(w|X), posterior probabilities of site classes. did 10 / 176 patterns 1:26 did 20 / 176 patterns 1:26 did 30 / 176 patterns 1:26 did 40 / 176 patterns 1:26 did 50 / 176 patterns 1:26 did 60 / 176 patterns 1:26 did 70 / 176 patterns 1:26 did 80 / 176 patterns 1:26 did 90 / 176 patterns 1:26 did 100 / 176 patterns 1:26 did 110 / 176 patterns 1:26 did 120 / 176 patterns 1:26 did 130 / 176 patterns 1:27 did 140 / 176 patterns 1:27 did 150 / 176 patterns 1:27 did 160 / 176 patterns 1:27 did 170 / 176 patterns 1:27 did 176 / 176 patterns 1:27 Time used: 1:27 Model 3: discrete TREE # 1 (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 0.035472 0.030270 0.002720 0.012939 0.017434 0.009975 0.024591 0.015232 0.077985 0.018864 0.028901 0.149613 0.106278 0.049211 0.089025 0.072794 0.328418 2.576906 0.339697 0.499728 0.034442 0.072415 0.140917 ntime & nrate & np: 17 4 23 Bounds (np=23): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 15.633476 np = 23 lnL0 = -2267.507644 Iterating by ming2 Initial: fx= 2267.507644 x= 0.03547 0.03027 0.00272 0.01294 0.01743 0.00998 0.02459 0.01523 0.07799 0.01886 0.02890 0.14961 0.10628 0.04921 0.08903 0.07279 0.32842 2.57691 0.33970 0.49973 0.03444 0.07242 0.14092 1 h-m-p 0.0000 0.0002 302.9227 +++ 2257.217155 m 0.0002 29 | 1/23 2 h-m-p 0.0000 0.0002 269.1285 +CCYC 2252.307622 3 0.0002 62 | 1/23 3 h-m-p 0.0000 0.0002 360.6047 +YYCCC 2249.368711 4 0.0001 95 | 1/23 4 h-m-p 0.0001 0.0003 166.2680 +YCCC 2248.294303 3 0.0001 127 | 0/23 5 h-m-p 0.0001 0.0007 289.5086 YCCC 2246.893665 3 0.0001 158 | 0/23 6 h-m-p 0.0003 0.0014 56.6705 YCCC 2246.752734 3 0.0001 189 | 0/23 7 h-m-p 0.0001 0.0005 54.2691 YC 2246.555829 1 0.0003 216 | 0/23 8 h-m-p 0.0000 0.0001 89.9175 +CC 2246.433874 1 0.0001 245 | 0/23 9 h-m-p 0.0000 0.0001 31.7511 ++ 2246.397491 m 0.0001 271 | 1/23 10 h-m-p 0.0004 0.0100 10.4857 YC 2246.384171 1 0.0003 298 | 1/23 11 h-m-p 0.0003 0.0141 11.7622 CC 2246.368548 1 0.0004 326 | 1/23 12 h-m-p 0.0007 0.0256 7.0650 YC 2246.360831 1 0.0005 353 | 1/23 13 h-m-p 0.0002 0.0073 15.1712 CC 2246.352846 1 0.0003 381 | 1/23 14 h-m-p 0.0008 0.0476 5.0014 CC 2246.343334 1 0.0012 409 | 1/23 15 h-m-p 0.0004 0.0230 16.3582 YC 2246.338149 1 0.0002 436 | 1/23 16 h-m-p 0.0005 0.1247 7.7560 +YC 2246.292957 1 0.0042 464 | 1/23 17 h-m-p 0.0009 0.0443 35.9614 +CCC 2246.035581 2 0.0051 495 | 1/23 18 h-m-p 0.0012 0.0135 152.6745 CCC 2245.667760 2 0.0017 525 | 1/23 19 h-m-p 0.0020 0.0158 134.8201 YC 2245.497901 1 0.0009 552 | 1/23 20 h-m-p 0.0120 0.0601 7.3069 -CC 2245.486401 1 0.0012 581 | 1/23 21 h-m-p 0.0020 0.4305 4.4523 +++YCC 2244.831282 2 0.1063 613 | 1/23 22 h-m-p 0.0019 0.0097 171.8432 YC 2244.650385 1 0.0008 640 | 1/23 23 h-m-p 0.3412 1.7061 0.2832 CCCC 2243.789950 3 0.5050 672 | 0/23 24 h-m-p 0.0007 0.0034 102.5512 YC 2243.617514 1 0.0005 721 | 0/23 25 h-m-p 0.0551 0.3061 0.8994 ++ 2243.373641 m 0.3061 747 | 1/23 26 h-m-p 0.5547 2.7736 0.0776 CCC 2243.156275 2 0.8350 800 | 0/23 27 h-m-p 0.0003 0.0015 99.3091 -C 2243.156120 0 0.0000 849 | 0/23 28 h-m-p 0.0110 5.4974 0.1920 +++YCC 2242.960344 2 1.2620 881 | 0/23 29 h-m-p 1.3513 6.7564 0.1295 YCCC 2242.857730 3 0.5837 935 | 0/23 30 h-m-p 0.7179 8.0000 0.1053 YCC 2242.806959 2 1.0835 987 | 0/23 31 h-m-p 1.6000 8.0000 0.0267 YC 2242.802178 1 0.9685 1037 | 0/23 32 h-m-p 1.6000 8.0000 0.0129 C 2242.801051 0 1.5787 1086 | 0/23 33 h-m-p 0.8585 8.0000 0.0237 ++ 2242.795112 m 8.0000 1135 | 0/23 34 h-m-p 0.0319 0.1593 0.2095 ++ 2242.793944 m 0.1593 1184 | 1/23 35 h-m-p 0.1280 8.0000 0.2607 +YCCC 2242.787573 3 0.5895 1239 | 0/23 36 h-m-p 0.0000 0.0015 14425.0631 --C 2242.787568 0 0.0000 1289 | 0/23 37 h-m-p 0.2762 8.0000 0.0132 +CC 2242.783403 1 1.6634 1318 | 0/23 38 h-m-p 0.0348 0.1741 0.0537 ++ 2242.782594 m 0.1741 1367 | 1/23 39 h-m-p 0.0881 8.0000 0.1061 ++YYC 2242.776366 2 1.2126 1420 | 0/23 40 h-m-p 0.0000 0.0005 14487.6167 --C 2242.776364 0 0.0000 1470 | 0/23 41 h-m-p 0.0339 0.1696 0.0602 ++ 2242.774957 m 0.1696 1496 | 1/23 42 h-m-p 0.0561 8.0000 0.1819 ++YCCCC 2242.761886 4 1.1353 1554 | 0/23 43 h-m-p 0.0000 0.0016 18815.3109 --C 2242.761876 0 0.0000 1604 | 0/23 44 h-m-p 0.0619 8.0000 0.0770 ++YCYC 2242.751311 3 1.8497 1636 | 0/23 45 h-m-p 0.9613 8.0000 0.1481 YYC 2242.744270 2 0.6978 1687 | 0/23 46 h-m-p 1.0653 5.3267 0.0311 CC 2242.737988 1 1.3727 1738 | 0/23 47 h-m-p 1.5884 8.0000 0.0269 YC 2242.733349 1 2.9244 1788 | 0/23 48 h-m-p 1.6000 8.0000 0.0146 YC 2242.732084 1 0.6627 1838 | 0/23 49 h-m-p 0.0952 8.0000 0.1016 +YC 2242.729735 1 0.8069 1889 | 0/23 50 h-m-p 1.6000 8.0000 0.0362 C 2242.728789 0 1.6000 1938 | 0/23 51 h-m-p 1.6000 8.0000 0.0056 YC 2242.728642 1 0.7885 1988 | 0/23 52 h-m-p 0.3609 8.0000 0.0122 +Y 2242.728596 0 0.9754 2038 | 0/23 53 h-m-p 1.6000 8.0000 0.0016 C 2242.728586 0 2.1935 2087 | 0/23 54 h-m-p 1.6000 8.0000 0.0003 ++ 2242.728555 m 8.0000 2136 | 0/23 55 h-m-p 1.6000 8.0000 0.0012 ++ 2242.728292 m 8.0000 2185 | 0/23 56 h-m-p 0.2204 8.0000 0.0449 +YC 2242.726693 1 1.9391 2236 | 0/23 57 h-m-p 1.6000 8.0000 0.0520 CYC 2242.722434 2 2.7221 2288 | 0/23 58 h-m-p 1.5401 8.0000 0.0919 YY 2242.714616 1 1.5401 2338 | 0/23 59 h-m-p 0.8073 8.0000 0.1752 YCC 2242.708304 2 0.5297 2390 | 0/23 60 h-m-p 0.6454 4.6403 0.1438 CC 2242.700679 1 0.2413 2441 | 0/23 61 h-m-p 0.4040 8.0000 0.0859 +CYCC 2242.687769 3 2.5891 2496 | 0/23 62 h-m-p 1.6000 8.0000 0.0703 CYC 2242.674445 2 1.8049 2548 | 0/23 63 h-m-p 0.9325 8.0000 0.1362 YC 2242.669510 1 0.9325 2598 | 0/23 64 h-m-p 1.6000 8.0000 0.0432 CYC 2242.661643 2 1.8981 2650 | 0/23 65 h-m-p 1.6000 8.0000 0.0349 CCC 2242.654722 2 2.1330 2703 | 0/23 66 h-m-p 1.0451 8.0000 0.0713 YCC 2242.635572 2 1.7847 2755 | 0/23 67 h-m-p 0.7980 8.0000 0.1594 +CCC 2242.585623 2 3.5676 2809 | 0/23 68 h-m-p 0.8551 8.0000 0.6650 CYC 2242.577348 2 0.2007 2861 | 0/23 69 h-m-p 0.2029 8.0000 0.6578 +YCC 2242.543644 2 0.5731 2914 | 0/23 70 h-m-p 1.6000 8.0000 0.1746 YCCC 2242.447049 3 3.9737 2968 | 0/23 71 h-m-p 1.1241 8.0000 0.6171 CYC 2242.386771 2 1.0920 3020 | 0/23 72 h-m-p 1.5284 8.0000 0.4409 CC 2242.339619 1 0.3058 3071 | 0/23 73 h-m-p 0.3366 8.0000 0.4007 YC 2242.313180 1 0.7615 3121 | 0/23 74 h-m-p 1.6000 8.0000 0.0739 +YC 2242.278116 1 4.1090 3172 | 0/23 75 h-m-p 1.6000 8.0000 0.1412 CCCC 2242.175671 3 2.7704 3227 | 0/23 76 h-m-p 0.7062 8.0000 0.5538 CCC 2242.103075 2 1.0893 3280 | 0/23 77 h-m-p 1.6000 8.0000 0.1756 YCC 2242.083953 2 1.1407 3332 | 0/23 78 h-m-p 1.6000 8.0000 0.0688 YC 2242.082514 1 0.9506 3382 | 0/23 79 h-m-p 1.6000 8.0000 0.0096 YC 2242.082465 1 0.9429 3432 | 0/23 80 h-m-p 1.6000 8.0000 0.0023 Y 2242.082462 0 0.9408 3481 | 0/23 81 h-m-p 1.6000 8.0000 0.0005 Y 2242.082462 0 0.9468 3530 | 0/23 82 h-m-p 1.6000 8.0000 0.0000 C 2242.082462 0 1.3109 3579 | 0/23 83 h-m-p 1.6000 8.0000 0.0000 ---C 2242.082462 0 0.0072 3631 Out.. lnL = -2242.082462 3632 lfun, 14528 eigenQcodon, 185232 P(t) Time used: 2:43 Model 7: beta TREE # 1 (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 0.035472 0.030270 0.002720 0.012939 0.017434 0.009975 0.024591 0.015232 0.077985 0.018864 0.028901 0.149613 0.106278 0.049211 0.089025 0.072794 0.328418 2.479042 0.309823 1.349954 ntime & nrate & np: 17 1 20 Bounds (np=20): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 11.597814 np = 20 lnL0 = -2268.678805 Iterating by ming2 Initial: fx= 2268.678805 x= 0.03547 0.03027 0.00272 0.01294 0.01743 0.00998 0.02459 0.01523 0.07799 0.01886 0.02890 0.14961 0.10628 0.04921 0.08903 0.07279 0.32842 2.47904 0.30982 1.34995 1 h-m-p 0.0000 0.0021 310.5860 ++YYCCC 2261.526726 4 0.0002 33 | 0/20 2 h-m-p 0.0000 0.0002 304.8712 +YYCYCCC 2252.611933 6 0.0002 66 | 0/20 3 h-m-p 0.0001 0.0003 363.3506 +YCYCCC 2247.968922 5 0.0002 98 | 0/20 4 h-m-p 0.0001 0.0005 368.2696 CCCCC 2245.124087 4 0.0001 129 | 0/20 5 h-m-p 0.0001 0.0005 91.0341 CCCC 2244.803816 3 0.0001 158 | 0/20 6 h-m-p 0.0003 0.0028 28.3779 CCC 2244.678721 2 0.0004 185 | 0/20 7 h-m-p 0.0002 0.0012 49.5760 YCC 2244.612255 2 0.0001 211 | 0/20 8 h-m-p 0.0005 0.0034 15.2107 YC 2244.594107 1 0.0002 235 | 0/20 9 h-m-p 0.0002 0.0075 14.4676 YC 2244.571831 1 0.0004 259 | 0/20 10 h-m-p 0.0003 0.0103 19.5259 CC 2244.551894 1 0.0003 284 | 0/20 11 h-m-p 0.0006 0.0129 9.9058 YC 2244.539716 1 0.0005 308 | 0/20 12 h-m-p 0.0002 0.0292 23.3961 YC 2244.520353 1 0.0004 332 | 0/20 13 h-m-p 0.0010 0.0146 8.7468 YC 2244.511946 1 0.0005 356 | 0/20 14 h-m-p 0.0002 0.0179 24.5240 +CC 2244.478728 1 0.0008 382 | 0/20 15 h-m-p 0.0009 0.0520 21.9499 +CC 2244.351564 1 0.0035 408 | 0/20 16 h-m-p 0.0013 0.0147 60.5363 CCC 2244.147214 2 0.0021 435 | 0/20 17 h-m-p 0.0026 0.0164 48.4519 YC 2244.060493 1 0.0011 459 | 0/20 18 h-m-p 0.0160 0.0802 1.9378 -CC 2244.057886 1 0.0012 485 | 0/20 19 h-m-p 0.0037 0.8214 0.6058 ++CCC 2243.913102 2 0.0933 514 | 0/20 20 h-m-p 0.0009 0.0069 62.2334 +YCCC 2243.447862 3 0.0027 563 | 0/20 21 h-m-p 0.1109 0.5546 1.0558 CCC 2243.314076 2 0.1241 590 | 0/20 22 h-m-p 1.4812 8.0000 0.0884 YCCC 2243.273363 3 0.7773 618 | 0/20 23 h-m-p 0.8005 8.0000 0.0859 YCC 2243.241186 2 1.3566 664 | 0/20 24 h-m-p 1.6000 8.0000 0.0391 YC 2243.227855 1 1.0637 708 | 0/20 25 h-m-p 1.6000 8.0000 0.0014 YC 2243.226561 1 0.8522 752 | 0/20 26 h-m-p 0.8988 8.0000 0.0013 C 2243.226511 0 0.9088 795 | 0/20 27 h-m-p 1.6000 8.0000 0.0003 Y 2243.226510 0 0.8806 838 | 0/20 28 h-m-p 1.6000 8.0000 0.0000 Y 2243.226510 0 0.8862 881 | 0/20 29 h-m-p 1.6000 8.0000 0.0000 Y 2243.226510 0 1.6000 924 | 0/20 30 h-m-p 1.6000 8.0000 0.0000 ------Y 2243.226510 0 0.0001 973 Out.. lnL = -2243.226510 974 lfun, 10714 eigenQcodon, 165580 P(t) Time used: 3:51 Model 8: beta&w>1 TREE # 1 (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 initial w for M8:NSbetaw>1 reset. 0.035472 0.030270 0.002720 0.012939 0.017434 0.009975 0.024591 0.015232 0.077985 0.018864 0.028901 0.149613 0.106278 0.049211 0.089025 0.072794 0.328418 2.455158 0.900000 0.966220 1.075304 2.140227 ntime & nrate & np: 17 2 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 5.388415 np = 22 lnL0 = -2376.573985 Iterating by ming2 Initial: fx= 2376.573985 x= 0.03547 0.03027 0.00272 0.01294 0.01743 0.00998 0.02459 0.01523 0.07799 0.01886 0.02890 0.14961 0.10628 0.04921 0.08903 0.07279 0.32842 2.45516 0.90000 0.96622 1.07530 2.14023 1 h-m-p 0.0000 0.0004 405.8254 ++YCCC 2361.707767 3 0.0003 34 | 0/22 2 h-m-p 0.0000 0.0001 362.5322 ++ 2351.806278 m 0.0001 59 | 1/22 3 h-m-p 0.0000 0.0001 486.5490 +CCCY 2345.595724 3 0.0001 92 | 1/22 4 h-m-p 0.0001 0.0004 375.5790 +YYYYYYC 2334.824022 6 0.0003 124 | 1/22 5 h-m-p 0.0000 0.0002 1943.0551 +CYCCC 2308.402081 4 0.0002 158 | 1/22 6 h-m-p 0.0000 0.0000 2493.2547 ++ 2304.092583 m 0.0000 183 | 1/22 7 h-m-p 0.0000 0.0000 1967.2692 ++ 2299.024126 m 0.0000 208 | 1/22 8 h-m-p 0.0000 0.0000 1509.2735 h-m-p: 1.50639447e-20 7.53197237e-20 1.50927349e+03 2299.024126 .. | 1/22 9 h-m-p 0.0000 0.0032 2487.8636 YYCCC 2292.852265 4 0.0000 261 | 1/22 10 h-m-p 0.0001 0.0004 485.7846 YCYCCC 2280.521613 5 0.0002 294 | 1/22 11 h-m-p 0.0001 0.0006 186.8550 +YYYCCC 2271.946569 5 0.0004 327 | 1/22 12 h-m-p 0.0000 0.0002 794.1850 +YYCCCC 2264.197216 5 0.0001 361 | 1/22 13 h-m-p 0.0000 0.0001 1958.6844 YCYCCC 2256.727242 5 0.0001 394 | 1/22 14 h-m-p 0.0000 0.0001 2119.0125 CCCCC 2253.456106 4 0.0000 427 | 1/22 15 h-m-p 0.0001 0.0004 356.5402 YCCC 2252.465262 3 0.0001 457 | 0/22 16 h-m-p 0.0000 0.0003 428.9138 CYCCC 2250.518461 4 0.0000 489 | 0/22 17 h-m-p 0.0004 0.0023 38.1457 YC 2250.319065 1 0.0003 515 | 0/22 18 h-m-p 0.0002 0.0013 50.5605 CYC 2250.185811 2 0.0002 543 | 0/22 19 h-m-p 0.0003 0.0037 38.7310 YCCC 2250.015118 3 0.0005 573 | 0/22 20 h-m-p 0.0005 0.0024 36.7017 YYYY 2249.888179 3 0.0005 601 | 0/22 21 h-m-p 0.0001 0.0030 121.6644 YC 2249.688838 1 0.0002 627 | 0/22 22 h-m-p 0.0007 0.0239 43.7546 +CYC 2249.070249 2 0.0024 656 | 0/22 23 h-m-p 0.0015 0.0107 67.4028 CCC 2248.462374 2 0.0016 685 | 0/22 24 h-m-p 0.0017 0.0129 65.1025 YCCC 2247.462324 3 0.0029 715 | 0/22 25 h-m-p 0.0019 0.0168 101.7610 CCC 2246.684837 2 0.0016 744 | 0/22 26 h-m-p 0.0045 0.0223 16.4393 YCC 2246.637365 2 0.0008 772 | 0/22 27 h-m-p 0.0110 0.0989 1.1922 CC 2246.633511 1 0.0024 799 | 0/22 28 h-m-p 0.0021 0.2071 1.3593 +CC 2246.607578 1 0.0088 827 | 0/22 29 h-m-p 0.0009 0.2227 12.6975 ++YCCC 2245.663684 3 0.0289 859 | 0/22 30 h-m-p 0.1969 0.9847 1.3564 CCC 2244.571054 2 0.2357 888 | 0/22 31 h-m-p 0.7102 3.5509 0.1874 +YCCC 2243.459776 3 1.9108 919 | 0/22 32 h-m-p 0.2935 1.4673 0.3308 +YCYCC 2242.658138 4 0.8881 973 | 0/22 33 h-m-p 0.9369 4.6846 0.0613 CCCC 2242.400304 3 1.2036 1026 | 0/22 34 h-m-p 1.1142 5.5709 0.0271 CCC 2242.326330 2 1.3827 1077 | 0/22 35 h-m-p 0.4022 8.0000 0.0930 CCC 2242.288195 2 0.5391 1128 | 0/22 36 h-m-p 0.5944 8.0000 0.0844 CCC 2242.266267 2 0.8742 1179 | 0/22 37 h-m-p 1.6000 8.0000 0.0301 CC 2242.256288 1 1.3327 1228 | 0/22 38 h-m-p 1.4265 8.0000 0.0281 YC 2242.252966 1 1.1433 1276 | 0/22 39 h-m-p 1.6000 8.0000 0.0158 CC 2242.250775 1 1.9755 1325 | 0/22 40 h-m-p 1.6000 8.0000 0.0094 C 2242.249727 0 1.5653 1372 | 0/22 41 h-m-p 1.6000 8.0000 0.0079 C 2242.249276 0 1.9634 1419 | 0/22 42 h-m-p 1.6000 8.0000 0.0063 CC 2242.248854 1 2.4542 1468 | 0/22 43 h-m-p 1.6000 8.0000 0.0010 Y 2242.248821 0 1.0129 1515 | 0/22 44 h-m-p 1.6000 8.0000 0.0005 C 2242.248818 0 1.9531 1562 | 0/22 45 h-m-p 1.6000 8.0000 0.0002 Y 2242.248818 0 1.1792 1609 | 0/22 46 h-m-p 1.6000 8.0000 0.0001 C 2242.248818 0 1.3535 1656 | 0/22 47 h-m-p 1.6000 8.0000 0.0001 C 2242.248818 0 1.6986 1703 | 0/22 48 h-m-p 1.6000 8.0000 0.0000 --------Y 2242.248818 0 0.0000 1758 Out.. lnL = -2242.248818 1759 lfun, 21108 eigenQcodon, 328933 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2261.381845 S = -2161.829093 -91.034028 Calculating f(w|X), posterior probabilities of site classes. did 10 / 176 patterns 6:07 did 20 / 176 patterns 6:07 did 30 / 176 patterns 6:07 did 40 / 176 patterns 6:08 did 50 / 176 patterns 6:08 did 60 / 176 patterns 6:08 did 70 / 176 patterns 6:08 did 80 / 176 patterns 6:08 did 90 / 176 patterns 6:09 did 100 / 176 patterns 6:09 did 110 / 176 patterns 6:09 did 120 / 176 patterns 6:09 did 130 / 176 patterns 6:09 did 140 / 176 patterns 6:10 did 150 / 176 patterns 6:10 did 160 / 176 patterns 6:10 did 170 / 176 patterns 6:10 did 176 / 176 patterns 6:10 Time used: 6:10 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=99, Nseq=10, Len=294 D_melanogaster_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS D_sechellia_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS D_simulans_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS D_yakuba_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS D_erecta_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS D_suzukii_Abd-B-PC MSIQLAPLHIPAMR--PGFEPDTSAAVKRH-PAHWTYNDDAFNQYPGYAK D_eugracilis_Abd-B-PC MSIQLAPLHIPAIRPGPGFETDTSAAVKRHQAAHWGYADEGFHQIPNYAS D_ficusphila_Abd-B-PC MSIQLAPLHIPAIRPGPGFETDASAAVKRH-TAPWPYNDDGFNQY--HAS D_elegans_Abd-B-PC MSIQLAPLHIPAIRPGPGFDTDASAAVKRH-TAPWPYN-DEFNQY--HAS D_takahashii_Abd-B-PC MSIQLAPLHIPAIRPGPGFETDTSAAVKRH-PAHWTYNDDGFNQY--HAS ************:* ***:.*:******* .* * * : *:* :.. D_melanogaster_Abd-B-PC G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A D_sechellia_Abd-B-PC G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A D_simulans_Abd-B-PC G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A D_yakuba_Abd-B-PC G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A D_erecta_Abd-B-PC G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A D_suzukii_Abd-B-PC G--HY----DRNH---MFPYPYPDTSQFPVVS--GPRYRADQGSSASTAA D_eugracilis_Abd-B-PC TGC-Y----DRKH---IFPYPYPDP-QYSVSQLCWPNYRTD---QN---A D_ficusphila_Abd-B-PC ASQYYMEQRDRKHAATMFPY-YPDT-QFQVSQYWPPNYRADQTTS----A D_elegans_Abd-B-PC ASQYY----DRKH---MFSY-YPDT-QFQVSQYWPPNYRTDQTTS----A D_takahashii_Abd-B-PC ASGYY----DRKH---MFPYPYPDT-QFPVSQYWTQGYRADQTTSA---A * **:* :*.* **:. *: * . **.* . * D_melanogaster_Abd-B-PC AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS D_sechellia_Abd-B-PC AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS D_simulans_Abd-B-PC AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS D_yakuba_Abd-B-PC AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS D_erecta_Abd-B-PC AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS D_suzukii_Abd-B-PC AAVAYMNEQDRHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPGENYSS D_eugracilis_Abd-B-PC AAAAYMNDAERHVSAAARQSVEGTSTSSYEPPTYASPGGLRGYSSENYPS D_ficusphila_Abd-B-PC AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS D_elegans_Abd-B-PC AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS D_takahashii_Abd-B-PC AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS **.****: :************************:********..***.* D_melanogaster_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_sechellia_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_simulans_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_yakuba_Abd-B-PC SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_erecta_Abd-B-PC SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_suzukii_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_eugracilis_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_ficusphila_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_elegans_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL D_takahashii_Abd-B-PC SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL *************.************************************ D_melanogaster_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_sechellia_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_simulans_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_yakuba_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_erecta_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_suzukii_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_eugracilis_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_ficusphila_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_elegans_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN D_takahashii_Abd-B-PC FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN ************************************************** D_melanogaster_Abd-B-PC NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- D_sechellia_Abd-B-PC NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- D_simulans_Abd-B-PC NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- D_yakuba_Abd-B-PC NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo- D_erecta_Abd-B-PC NSSSNHNHAQANQQHHSGHHLNLSLNMGHHAAKMHQooooooo- D_suzukii_Abd-B-PC NSSSNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- D_eugracilis_Abd-B-PC NSSSNHNHSQPTQQHHSGHHLNLGLNMGHHAAKMHQoooooo-- D_ficusphila_Abd-B-PC NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ-------- D_elegans_Abd-B-PC NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQoooooooo D_takahashii_Abd-B-PC NSSGNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQooooo--- ***.****:*..*****.***.*.*******:****
>D_melanogaster_Abd-B-PC ATGTCCATACAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAATCAGCAT------TACGGCTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTATCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCA GCGGCGGCGGCCTACATGAACGAAGCGGAGCGCCACGTGAGCGCCGCCGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTATGAGCCGCCCACCT ACTCCTCGCCAGGCGGCCTGCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTATCCGTGGGAGCAGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTTCTT TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAC AATTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >D_sechellia_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAT------TACGGCTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCG GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCTGC TCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTATGAGCCGCCCACCT ACTCCTCGCCAGGCGGCCTGCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCCGTGGGAGCGGTGGGTCCTTGCACGCC CAATCCCGGATTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCATACTCGAAGTTCCAAACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTTTCTAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAAAACAACAACAAC AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >D_simulans_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCTGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAT------TACGGCTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCTTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCG GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCAGGCGGCCTGCGCGGTTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCCGTAGGAGCGGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAATCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >D_yakuba_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCATATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAC------TACGGTTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCCTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGATCAGACCACCTCTGCC---------GCC GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC CCGCCAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCGGGCGGACTGCGTGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCGGTGGGCTCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTCTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCACAGCGCCAGGCCAATCAGCAGAACAACAACAAT AACTCGAGCAGCAACCACAACCACGCGCAGGCGACCCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >D_erecta_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGGCCGGTCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---ACGGCAC ACTGGGCCTACAACGACGAGGGATTCAACCAGCAC------TACGGTTCC GGG---TAC---TAC------------GACCGCAAGCAC---------AT GTTCGCCTACCCCTACCCAGAAACG---CAGTTTCCGGTTGGTCAGTACT GGGGCCCCAACTACCGCCCCGACCAGACCACCTCTGCC---------GCG GCGGCGGCGGCCTACATGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCGGGCGGACTGCGGGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCGGTGGGTTCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGC GCAAGCCGTACTCGAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCGTATGTTTCCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTT GCAGCTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCCCAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACGCGCAGGCGAACCAGCAGCACCACAG CGGCCACCACCTGAACCTTAGCCTGAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >D_suzukii_Abd-B-PC ATGTCCATCCAATTAGCGCCCCTGCACATACCCGCCATGCGG------CC GGGATTCGAGCCGGACACCTCGGCGGCGGTCAAGCGGCAC---CCGGCAC ACTGGACCTACAACGATGACGCATTCAACCAGTATCCCGGCTACGCGAAA GGG------CACTAC------------GACCGCAACCAC---------AT GTTCCCCTACCCCTATCCAGACACCAGCCAGTTTCCGGTTGTAAGT---- --GGCCCCAGATACCGCGCCGATCAGGGCAGCTCCGCCAGCACCGCTGCG GCGGCAGTGGCCTATATGAACGAACAGGATCGCCACGTGAGCGCAGCCGC CCGACAGTCCGTCGAGGGCACTTCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCTCCAGGCGGACTGCGCGGCTATCCCGGCGAGAACTACTCCAGC TCAGGAGCCTCCGGTGGATTGTCGGTGGGTGCAGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC GAAAGCCGTACTCCAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCATACGTGTCCAAGCAGAAGCGCTGGGAGCTGGCCAGGAACTT ACAGTTGACCGAGCGACAGGTCAAGATATGGTTCCAGAACCGGCGCATGA AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAATAACAAC AACTCGAGCAGCAATCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACCTGAACCTTAGCCTAAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------ >D_eugracilis_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCAGGCCCGGTCC GGGTTTCGAGACGGACACCTCGGCCGCGGTCAAGCGTCATCAAGCAGCGC ACTGGGGCTACGCCGATGAGGGATTCCACCAAATTCCAAACTACGCCTCT ACAGGGTGC---TAT------------GACCGCAAGCAC---------AT TTTTCCCTACCCCTATCCAGACCCC---CAGTATTCGGTAAGTCAGTTGT GCTGGCCCAACTACCGCACTGAT---------CAGAAT---------GCG GCGGCGGCGGCCTACATGAACGATGCCGAGCGCCATGTGAGCGCCGCTGC CCGACAGTCCGTCGAGGGCACATCGACGTCCAGTTATGAGCCGCCCACCT ATGCTTCGCCGGGCGGACTGCGCGGCTATTCCAGCGAGAACTACCCCAGC TCAGGAGCCTCTGGCGGCTTGTCTGTGGGTGCAGTGGGTCCTTGCACACC CAATCCTGGACTGCACGAGTGGACCGGTCAGGTGTCTGTAAGGAAAAAGC GGAAGCCCTACTCCAAGTTTCAGACCCTGGAGCTGGAGAAGGAGTTCCTC TTCAATGCGTATGTCTCCAAGCAGAAACGCTGGGAACTGGCCAGGAACTT GCAGCTGACAGAGAGACAGGTCAAAATATGGTTCCAGAATCGACGCATGA AGAACAAAAAGAACTCACAGCGCCAGGCCAATCAGCAGAATAACAACAAC AACTCGAGCAGCAACCACAACCACTCGCAGCCGACACAGCAGCATCATAG CGGCCACCACCTGAATCTTGGCCTGAACATGGGACATCATGCCGCCAAGA TGCACCAG------------------------ >D_ficusphila_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGCCCGGTCC GGGATTCGAGACGGACGCCTCGGCGGCGGTGAAGCGGCAC---ACGGCCC CCTGGCCCTACAACGACGACGGGTTCAACCAGTAC------CACGCCTCC GCGTCACAGTACTACATGGAGCAGCGCGACCGCAAGCACGCCGCCACCAT GTTCCCCTAC---TATCCAGACACC---CAGTTTCAGGTGAGTCAGTACT GGCCCCCCAACTACCGCGCCGACCAAACCACCTCC------------GCC GCCGCGGTGGCCTACATGAACGACGCGGAGCGCCACGTGAGCGCCGCTGC CCGCCAGTCCGTCGAGGGCACGTCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCCGGCGGCCTGCGCGGCTACCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCTGGTGGATTGTCGGTGGGAGCAGTGGGTCCTTGCACGCC AAATCCTGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC GGAAGCCGTACTCCAAGTTCCAGACTCTGGAGCTGGAGAAGGAGTTCCTC TTCAATGCGTATGTTTCTAAGCAGAAACGCTGGGAATTGGCCAGGAATTT GCAGCTGACTGAGAGACAGGTCAAGATATGGTTCCAGAATCGCCGCATGA AGAACAAGAAGAACTCGCAGCGGCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACTTGAGCCTCGGCCTGAACATGGGTCACCATGCCACCAAGA TGCACCAG------------------------ >D_elegans_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCACATACCCGCCATCCGGCCGGGTCC GGGATTCGATACGGACGCCTCGGCGGCGGTCAAGCGGCAC---ACGGCCC CCTGGCCCTACAAC---GATGAGTTCAACCAGTAC------CACGCCTCT GCGTCACAGTACTAC------------GATCGCAAGCAC---------AT GTTCTCCTAC---TACCCAGACACC---CAGTTTCAGGTGAGTCAGTACT GGCCGCCCAACTACCGCACCGACCAGACGACCTCC------------GCG GCGGCGGTGGCCTACATGAACGATGCGGAGCGCCACGTGAGCGCCGCCGC CCGCCAGTCCGTCGAGGGCACCTCGACGTCCAGCTACGAGCCGCCCACCT ACTCCTCGCCGGGCGGACTGCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCTTCCGGTGGATTGTCGGTGGGTGCAGTGGGTCCTTGCACGCC CAACCCAGGACTGCACGAGTGGACCGGCCAGGTGTCCGTCCGGAAAAAGC GGAAGCCGTACTCCAAGTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTC TTCAATGCGTATGTGTCCAAGCAGAAGCGCTGGGAGTTGGCCAGGAATTT GCAGTTGACCGAGCGACAGGTCAAAATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCAGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACCTGAGCCTCGGCCTGAACATGGGTCATCATGCCACCAAGA TGCACCAG------------------------ >D_takahashii_Abd-B-PC ATGTCCATCCAATTAGCGCCACTGCACATACCAGCCATCCGGCCAGGCCC GGGATTCGAGACGGACACCTCGGCGGCGGTCAAGCGGCAC---CCGGCAC ACTGGACCTACAACGATGACGGCTTCAACCAGTAC------CACGCCTCC GCGTCGGGGTACTAC------------GACCGCAAGCAC---------AT GTTCCCCTACCCCTATCCAGACACC---CAGTTTCCGGTAAGTCAGTACT GGACCCAAGGCTACCGCGCCGATCAGACCACCTCCGCC---------GCG GCGGCAGTGGCCTACATGAACGATGCCGAGCGCCACGTCAGCGCCGCGGC CCGCCAGTCCGTCGAGGGCACATCGACGTCCAGCTACGAGCCACCTACTT ACTCCTCGCCGGGCGGACTCCGCGGCTATCCCAGCGAGAACTACTCCAGC TCAGGAGCCTCCGGTGGTTTGTCCGTGGGAGCGGTGGGTCCTTGCACGCC CAATCCCGGACTGCACGAGTGGACCGGCCAAGTGTCCGTCCGGAAAAAGC GGAAGCCGTACTCCAAGTTCCAGACTTTGGAGCTGGAGAAGGAGTTCCTT TTCAATGCATATGTGTCCAAGCAGAAGCGCTGGGAGCTGGCCAGGAATTT GCAGTTGACCGAGCGACAGGTCAAGATATGGTTCCAGAATCGGCGCATGA AGAACAAGAAGAACTCGCAGCGCCAGGCCAATCAGCAGAACAACAACAAC AACTCGAGCGGCAACCACAACCACTCGCAGGCGACCCAGCAGCACCACAG CAGCCACCACCTGAACCTTAGCCTAAACATGGGTCACCATGCCGCCAAGA TGCACCAG------------------------
>D_melanogaster_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >D_sechellia_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >D_simulans_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >D_yakuba_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ >D_erecta_Abd-B-PC MSIQLAPLHIPAIRAGPGFETDTSAAVKRH-TAHWAYNDEGFNQH--YGS G-Y-Y----DRKH---MFAYPYPET-QFPVGQYWGPNYRPDQTTSA---A AAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHAQANQQHHSGHHLNLSLNMGHHAAKMHQ >D_suzukii_Abd-B-PC MSIQLAPLHIPAMR--PGFEPDTSAAVKRH-PAHWTYNDDAFNQYPGYAK G--HY----DRNH---MFPYPYPDTSQFPVVS--GPRYRADQGSSASTAA AAVAYMNEQDRHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPGENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQ >D_eugracilis_Abd-B-PC MSIQLAPLHIPAIRPGPGFETDTSAAVKRHQAAHWGYADEGFHQIPNYAS TGC-Y----DRKH---IFPYPYPDP-QYSVSQLCWPNYRTD---QN---A AAAAYMNDAERHVSAAARQSVEGTSTSSYEPPTYASPGGLRGYSSENYPS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQPTQQHHSGHHLNLGLNMGHHAAKMHQ >D_ficusphila_Abd-B-PC MSIQLAPLHIPAIRPGPGFETDASAAVKRH-TAPWPYNDDGFNQY--HAS ASQYYMEQRDRKHAATMFPY-YPDT-QFQVSQYWPPNYRADQTTS----A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ >D_elegans_Abd-B-PC MSIQLAPLHIPAIRPGPGFDTDASAAVKRH-TAPWPYN-DEFNQY--HAS ASQYY----DRKH---MFSY-YPDT-QFQVSQYWPPNYRTDQTTS----A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSSNHNHSQATQQHHSSHHLSLGLNMGHHATKMHQ >D_takahashii_Abd-B-PC MSIQLAPLHIPAIRPGPGFETDTSAAVKRH-PAHWTYNDDGFNQY--HAS ASGYY----DRKH---MFPYPYPDT-QFPVSQYWTQGYRADQTTSA---A AAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGYPSENYSS SGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFL FNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQQNNNN NSSGNHNHSQATQQHHSSHHLNLSLNMGHHAAKMHQ
#NEXUS [ID: 3269566890] begin taxa; dimensions ntax=10; taxlabels D_melanogaster_Abd-B-PC D_sechellia_Abd-B-PC D_simulans_Abd-B-PC D_yakuba_Abd-B-PC D_erecta_Abd-B-PC D_suzukii_Abd-B-PC D_eugracilis_Abd-B-PC D_ficusphila_Abd-B-PC D_elegans_Abd-B-PC D_takahashii_Abd-B-PC ; end; begin trees; translate 1 D_melanogaster_Abd-B-PC, 2 D_sechellia_Abd-B-PC, 3 D_simulans_Abd-B-PC, 4 D_yakuba_Abd-B-PC, 5 D_erecta_Abd-B-PC, 6 D_suzukii_Abd-B-PC, 7 D_eugracilis_Abd-B-PC, 8 D_ficusphila_Abd-B-PC, 9 D_elegans_Abd-B-PC, 10 D_takahashii_Abd-B-PC ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01743197,2:0.01378914,(3:0.008407115,((4:0.01125774,5:0.009738991)0.556:0.004388835,(((6:0.1136351,10:0.05865599)0.671:0.01779877,(8:0.04784781,9:0.03819212)1.000:0.0392318)0.920:0.02235269,7:0.237121)1.000:0.05129563)0.999:0.0125738)0.689:0.002732416); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01743197,2:0.01378914,(3:0.008407115,((4:0.01125774,5:0.009738991):0.004388835,(((6:0.1136351,10:0.05865599):0.01779877,(8:0.04784781,9:0.03819212):0.0392318):0.02235269,7:0.237121):0.05129563):0.0125738):0.002732416); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2613.98 -2629.19 2 -2613.84 -2629.62 -------------------------------------- TOTAL -2613.91 -2629.43 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/2/Abd-B-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.722907 0.005789 0.572287 0.862370 0.719673 1331.12 1335.64 1.000 r(A<->C){all} 0.081119 0.000339 0.047377 0.117844 0.079887 867.86 873.55 1.000 r(A<->G){all} 0.198885 0.001149 0.134344 0.265523 0.196746 747.58 771.34 1.000 r(A<->T){all} 0.097152 0.001028 0.034606 0.157303 0.094691 728.63 790.69 1.004 r(C<->G){all} 0.072612 0.000247 0.042920 0.103686 0.071764 954.95 1034.68 1.000 r(C<->T){all} 0.474700 0.002301 0.382864 0.568550 0.474701 829.04 883.05 1.000 r(G<->T){all} 0.075532 0.000647 0.031406 0.128180 0.073263 687.88 861.57 1.001 pi(A){all} 0.243914 0.000191 0.215922 0.268917 0.243914 1081.24 1089.89 1.000 pi(C){all} 0.346969 0.000226 0.318347 0.377792 0.347028 1159.49 1220.89 1.000 pi(G){all} 0.264963 0.000191 0.239193 0.293374 0.264957 1170.36 1241.69 1.000 pi(T){all} 0.144154 0.000120 0.122731 0.164842 0.143690 931.92 1027.83 1.000 alpha{1,2} 0.145833 0.001290 0.077876 0.216657 0.143155 1070.44 1130.56 1.000 alpha{3} 1.941445 0.482982 0.884721 3.425454 1.817368 1305.07 1331.93 1.000 pinvar{all} 0.199859 0.007647 0.020301 0.351955 0.202562 1059.92 1091.67 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/2/Abd-B-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 10 ls = 259 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 2 1 1 1 1 1 | Ser TCT 2 3 2 3 3 1 | Tyr TAT 4 3 2 2 2 4 | Cys TGT 0 0 0 0 0 0 TTC 6 7 7 7 7 7 | TCC 9 8 9 8 9 10 | TAC 9 10 11 11 11 10 | TGC 1 1 1 1 1 1 Leu TTA 2 1 1 1 1 2 | TCA 2 2 2 2 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 2 4 3 3 3 2 | TCG 5 5 5 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 0 0 1 | His CAT 3 3 3 2 1 1 | Arg CGT 0 0 0 1 0 0 CTC 0 0 0 0 0 0 | CCC 7 7 7 7 7 8 | CAC 13 13 13 14 15 14 | CGC 8 8 8 8 7 7 CTA 0 0 0 0 0 1 | CCA 3 4 3 2 2 2 | Gln CAA 2 4 2 2 2 1 | CGA 2 2 2 1 2 3 CTG 8 7 8 8 8 7 | CCG 4 3 4 5 5 6 | CAG 17 15 17 17 17 18 | CGG 4 4 4 4 5 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 1 | Asn AAT 7 5 6 6 5 5 | Ser AGT 0 0 0 0 0 1 ATC 1 2 2 2 2 1 | ACC 6 6 6 6 5 8 | AAC 14 16 15 15 17 16 | AGC 8 8 8 8 8 8 ATA 3 2 2 2 2 2 | ACA 1 1 1 1 1 0 | Lys AAA 1 1 1 1 1 2 | Arg AGA 1 1 1 1 1 1 Met ATG 6 6 6 6 6 7 | ACG 5 5 5 5 5 2 | AAG 13 13 13 13 13 12 | AGG 0 0 0 0 0 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 1 2 1 | Ala GCT 0 2 0 0 0 0 | Asp GAT 1 1 1 1 0 2 | Gly GGT 5 5 6 5 6 4 GTC 4 4 4 5 4 4 | GCC 12 10 12 13 12 10 | GAC 2 2 2 2 3 4 | GGC 7 7 6 6 5 6 GTA 0 0 1 0 0 1 | GCA 3 1 1 1 1 6 | Glu GAA 3 2 2 2 2 1 | GGA 6 6 6 7 7 5 GTG 4 4 3 4 4 6 | GCG 10 12 12 11 12 7 | GAG 11 12 12 12 12 10 | GGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------ Phe TTT 2 1 1 1 | Ser TCT 4 2 1 0 | Tyr TAT 7 2 2 3 | Cys TGT 0 0 0 0 TTC 5 7 7 7 | TCC 6 9 11 12 | TAC 7 11 11 10 | TGC 1 1 1 1 Leu TTA 1 1 1 1 | TCA 2 1 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 2 4 4 4 | TCG 6 7 7 6 | TAG 0 0 0 0 | Trp TGG 5 4 4 4 ------------------------------------------------------------------------------------------------------ Leu CTT 1 0 0 2 | Pro CCT 2 2 1 2 | His CAT 6 1 2 1 | Arg CGT 1 0 0 0 CTC 1 2 2 1 | CCC 8 9 7 4 | CAC 10 14 13 15 | CGC 7 8 8 8 CTA 0 0 0 1 | CCA 2 3 3 4 | Gln CAA 2 1 1 3 | CGA 2 0 1 1 CTG 9 7 7 5 | CCG 4 3 5 5 | CAG 18 19 19 17 | CGG 1 5 5 5 ------------------------------------------------------------------------------------------------------ Ile ATT 2 0 0 0 | Thr ACT 1 2 0 2 | Asn AAT 6 5 4 5 | Ser AGT 2 1 1 1 ATC 2 2 2 2 | ACC 4 5 9 7 | AAC 13 15 16 15 | AGC 6 9 9 8 ATA 2 2 2 2 | ACA 5 0 0 1 | Lys AAA 4 2 2 1 | Arg AGA 1 1 0 0 Met ATG 5 6 6 6 | ACG 2 5 4 3 | AAG 10 12 12 13 | AGG 3 1 1 1 ------------------------------------------------------------------------------------------------------ Val GTT 0 1 0 0 | Ala GCT 2 1 1 0 | Asp GAT 2 0 4 2 | Gly GGT 4 3 4 4 GTC 4 3 4 5 | GCC 13 14 11 12 | GAC 3 6 3 4 | GGC 8 6 5 7 GTA 2 0 0 1 | GCA 2 1 1 3 | Glu GAA 1 1 0 0 | GGA 5 5 5 5 GTG 4 7 7 5 | GCG 8 8 10 9 | GAG 11 10 11 11 | GGG 0 1 0 0 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Abd-B-PC position 1: T:0.18533 C:0.28571 A:0.25483 G:0.27413 position 2: T:0.16216 C:0.27027 A:0.38610 G:0.18147 position 3: T:0.11197 C:0.41313 A:0.11197 G:0.36293 Average T:0.15315 C:0.32304 A:0.25097 G:0.27284 #2: D_sechellia_Abd-B-PC position 1: T:0.18919 C:0.28185 A:0.25483 G:0.27413 position 2: T:0.16216 C:0.27027 A:0.38610 G:0.18147 position 3: T:0.10811 C:0.42085 A:0.10425 G:0.36680 Average T:0.15315 C:0.32432 A:0.24839 G:0.27413 #3: D_simulans_Abd-B-PC position 1: T:0.18533 C:0.28571 A:0.25483 G:0.27413 position 2: T:0.16216 C:0.27027 A:0.38610 G:0.18147 position 3: T:0.10039 C:0.42857 A:0.09653 G:0.37452 Average T:0.14929 C:0.32819 A:0.24582 G:0.27671 #4: D_yakuba_Abd-B-PC position 1: T:0.18919 C:0.28185 A:0.25483 G:0.27413 position 2: T:0.16216 C:0.27027 A:0.38610 G:0.18147 position 3: T:0.09266 C:0.43629 A:0.08880 G:0.38224 Average T:0.14801 C:0.32947 A:0.24324 G:0.27928 #5: D_erecta_Abd-B-PC position 1: T:0.18919 C:0.28185 A:0.25483 G:0.27413 position 2: T:0.16216 C:0.26641 A:0.38996 G:0.18147 position 3: T:0.08494 C:0.43629 A:0.08880 G:0.38996 Average T:0.14543 C:0.32819 A:0.24453 G:0.28185 #6: D_suzukii_Abd-B-PC position 1: T:0.18919 C:0.28958 A:0.25869 G:0.26255 position 2: T:0.16988 C:0.26641 A:0.38610 G:0.17761 position 3: T:0.09266 C:0.44015 A:0.10811 G:0.35907 Average T:0.15058 C:0.33205 A:0.25097 G:0.26641 #7: D_eugracilis_Abd-B-PC position 1: T:0.18533 C:0.28571 A:0.26255 G:0.26641 position 2: T:0.16216 C:0.27413 A:0.38610 G:0.17761 position 3: T:0.16216 C:0.37838 A:0.11969 G:0.33977 Average T:0.16988 C:0.31274 A:0.25611 G:0.26126 #8: D_ficusphila_Abd-B-PC position 1: T:0.19305 C:0.28571 A:0.26255 G:0.25869 position 2: T:0.16602 C:0.27799 A:0.38224 G:0.17375 position 3: T:0.08108 C:0.46718 A:0.06950 G:0.38224 Average T:0.14672 C:0.34363 A:0.23810 G:0.27156 #9: D_elegans_Abd-B-PC position 1: T:0.19691 C:0.28571 A:0.26255 G:0.25483 position 2: T:0.16602 C:0.27799 A:0.38610 G:0.16988 position 3: T:0.08108 C:0.45946 A:0.06564 G:0.39382 Average T:0.14801 C:0.34106 A:0.23810 G:0.27284 #10: D_takahashii_Abd-B-PC position 1: T:0.19305 C:0.28571 A:0.25869 G:0.26255 position 2: T:0.16602 C:0.27413 A:0.38610 G:0.17375 position 3: T:0.08880 C:0.45560 A:0.09266 G:0.36293 Average T:0.14929 C:0.33848 A:0.24582 G:0.26641 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 12 | Ser S TCT 21 | Tyr Y TAT 31 | Cys C TGT 0 TTC 67 | TCC 91 | TAC 101 | TGC 10 Leu L TTA 12 | TCA 15 | *** * TAA 0 | *** * TGA 0 TTG 31 | TCG 59 | TAG 0 | Trp W TGG 41 ------------------------------------------------------------------------------ Leu L CTT 15 | Pro P CCT 11 | His H CAT 23 | Arg R CGT 2 CTC 6 | CCC 71 | CAC 134 | CGC 77 CTA 2 | CCA 28 | Gln Q CAA 20 | CGA 16 CTG 74 | CCG 44 | CAG 174 | CGG 41 ------------------------------------------------------------------------------ Ile I ATT 2 | Thr T ACT 6 | Asn N AAT 54 | Ser S AGT 6 ATC 18 | ACC 62 | AAC 152 | AGC 80 ATA 21 | ACA 11 | Lys K AAA 16 | Arg R AGA 8 Met M ATG 60 | ACG 41 | AAG 124 | AGG 7 ------------------------------------------------------------------------------ Val V GTT 11 | Ala A GCT 6 | Asp D GAT 14 | Gly G GGT 46 GTC 41 | GCC 119 | GAC 31 | GGC 63 GTA 5 | GCA 20 | Glu E GAA 14 | GGA 57 GTG 48 | GCG 99 | GAG 112 | GGG 7 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.18958 C:0.28494 A:0.25792 G:0.26757 position 2: T:0.16409 C:0.27181 A:0.38610 G:0.17799 position 3: T:0.10039 C:0.43359 A:0.09459 G:0.37143 Average T:0.15135 C:0.33012 A:0.24620 G:0.27233 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Abd-B-PC D_sechellia_Abd-B-PC -1.0000 (0.0000 0.0943) D_simulans_Abd-B-PC -1.0000 (0.0000 0.0756)-1.0000 (0.0000 0.0636) D_yakuba_Abd-B-PC 0.0140 (0.0017 0.1197) 0.0148 (0.0017 0.1135) 0.0205 (0.0017 0.0818) D_erecta_Abd-B-PC 0.0297 (0.0034 0.1133) 0.0333 (0.0034 0.1007) 0.0483 (0.0034 0.0696) 0.0325 (0.0017 0.0516) D_suzukii_Abd-B-PC 0.1642 (0.0470 0.2860) 0.1548 (0.0469 0.3032) 0.1791 (0.0470 0.2621) 0.1751 (0.0487 0.2783) 0.2047 (0.0505 0.2468) D_eugracilis_Abd-B-PC 0.1022 (0.0502 0.4917) 0.1064 (0.0502 0.4719) 0.1116 (0.0502 0.4502) 0.1080 (0.0520 0.4817) 0.1200 (0.0547 0.4559) 0.1539 (0.0812 0.5278) D_ficusphila_Abd-B-PC 0.1310 (0.0378 0.2883) 0.1384 (0.0377 0.2728) 0.1429 (0.0378 0.2642) 0.1540 (0.0395 0.2566) 0.1768 (0.0413 0.2335) 0.1569 (0.0528 0.3365) 0.1108 (0.0552 0.4983) D_elegans_Abd-B-PC 0.1474 (0.0413 0.2802) 0.1428 (0.0413 0.2890) 0.1661 (0.0413 0.2486) 0.1906 (0.0431 0.2259) 0.2282 (0.0448 0.1964) 0.2444 (0.0582 0.2382) 0.1326 (0.0582 0.4392) 0.0316 (0.0067 0.2124) D_takahashii_Abd-B-PC 0.1195 (0.0369 0.3087) 0.1259 (0.0369 0.2928) 0.1418 (0.0369 0.2601) 0.1531 (0.0386 0.2525) 0.1704 (0.0404 0.2371) 0.1899 (0.0430 0.2265) 0.1055 (0.0564 0.5349) 0.0756 (0.0229 0.3030) 0.1307 (0.0307 0.2349) Model 0: one-ratio TREE # 1: (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 lnL(ntime: 17 np: 19): -2269.725989 +0.000000 11..1 11..2 11..12 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..10 16..18 18..8 18..9 15..7 0.036418 0.028241 0.003738 0.012260 0.015478 0.011338 0.023421 0.019919 0.085833 0.041750 0.037843 0.190234 0.102521 0.082417 0.088614 0.081225 0.347975 2.419536 0.068883 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.20922 (1: 0.036418, 2: 0.028241, (3: 0.012260, ((4: 0.023421, 5: 0.019919): 0.011338, (((6: 0.190234, 10: 0.102521): 0.037843, (8: 0.088614, 9: 0.081225): 0.082417): 0.041750, 7: 0.347975): 0.085833): 0.015478): 0.003738); (D_melanogaster_Abd-B-PC: 0.036418, D_sechellia_Abd-B-PC: 0.028241, (D_simulans_Abd-B-PC: 0.012260, ((D_yakuba_Abd-B-PC: 0.023421, D_erecta_Abd-B-PC: 0.019919): 0.011338, (((D_suzukii_Abd-B-PC: 0.190234, D_takahashii_Abd-B-PC: 0.102521): 0.037843, (D_ficusphila_Abd-B-PC: 0.088614, D_elegans_Abd-B-PC: 0.081225): 0.082417): 0.041750, D_eugracilis_Abd-B-PC: 0.347975): 0.085833): 0.015478): 0.003738); Detailed output identifying parameters kappa (ts/tv) = 2.41954 omega (dN/dS) = 0.06888 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.036 643.9 133.1 0.0689 0.0037 0.0531 2.4 7.1 11..2 0.028 643.9 133.1 0.0689 0.0028 0.0412 1.8 5.5 11..12 0.004 643.9 133.1 0.0689 0.0004 0.0055 0.2 0.7 12..3 0.012 643.9 133.1 0.0689 0.0012 0.0179 0.8 2.4 12..13 0.015 643.9 133.1 0.0689 0.0016 0.0226 1.0 3.0 13..14 0.011 643.9 133.1 0.0689 0.0011 0.0165 0.7 2.2 14..4 0.023 643.9 133.1 0.0689 0.0024 0.0342 1.5 4.6 14..5 0.020 643.9 133.1 0.0689 0.0020 0.0291 1.3 3.9 13..15 0.086 643.9 133.1 0.0689 0.0086 0.1253 5.6 16.7 15..16 0.042 643.9 133.1 0.0689 0.0042 0.0609 2.7 8.1 16..17 0.038 643.9 133.1 0.0689 0.0038 0.0552 2.4 7.4 17..6 0.190 643.9 133.1 0.0689 0.0191 0.2776 12.3 37.0 17..10 0.103 643.9 133.1 0.0689 0.0103 0.1496 6.6 19.9 16..18 0.082 643.9 133.1 0.0689 0.0083 0.1203 5.3 16.0 18..8 0.089 643.9 133.1 0.0689 0.0089 0.1293 5.7 17.2 18..9 0.081 643.9 133.1 0.0689 0.0082 0.1185 5.3 15.8 15..7 0.348 643.9 133.1 0.0689 0.0350 0.5078 22.5 67.6 tree length for dN: 0.1215 tree length for dS: 1.7646 Time used: 0:18 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 lnL(ntime: 17 np: 20): -2245.482060 +0.000000 11..1 11..2 11..12 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..10 16..18 18..8 18..9 15..7 0.037274 0.028766 0.003833 0.012455 0.015300 0.011760 0.023598 0.020123 0.092380 0.043126 0.033454 0.206836 0.107813 0.085938 0.092690 0.080418 0.383389 2.576891 0.928262 0.034301 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.27915 (1: 0.037274, 2: 0.028766, (3: 0.012455, ((4: 0.023598, 5: 0.020123): 0.011760, (((6: 0.206836, 10: 0.107813): 0.033454, (8: 0.092690, 9: 0.080418): 0.085938): 0.043126, 7: 0.383389): 0.092380): 0.015300): 0.003833); (D_melanogaster_Abd-B-PC: 0.037274, D_sechellia_Abd-B-PC: 0.028766, (D_simulans_Abd-B-PC: 0.012455, ((D_yakuba_Abd-B-PC: 0.023598, D_erecta_Abd-B-PC: 0.020123): 0.011760, (((D_suzukii_Abd-B-PC: 0.206836, D_takahashii_Abd-B-PC: 0.107813): 0.033454, (D_ficusphila_Abd-B-PC: 0.092690, D_elegans_Abd-B-PC: 0.080418): 0.085938): 0.043126, D_eugracilis_Abd-B-PC: 0.383389): 0.092380): 0.015300): 0.003833); Detailed output identifying parameters kappa (ts/tv) = 2.57689 dN/dS (w) for site classes (K=2) p: 0.92826 0.07174 w: 0.03430 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.037 642.7 134.3 0.1036 0.0050 0.0481 3.2 6.5 11..2 0.029 642.7 134.3 0.1036 0.0038 0.0371 2.5 5.0 11..12 0.004 642.7 134.3 0.1036 0.0005 0.0049 0.3 0.7 12..3 0.012 642.7 134.3 0.1036 0.0017 0.0161 1.1 2.2 12..13 0.015 642.7 134.3 0.1036 0.0020 0.0197 1.3 2.6 13..14 0.012 642.7 134.3 0.1036 0.0016 0.0152 1.0 2.0 14..4 0.024 642.7 134.3 0.1036 0.0032 0.0304 2.0 4.1 14..5 0.020 642.7 134.3 0.1036 0.0027 0.0260 1.7 3.5 13..15 0.092 642.7 134.3 0.1036 0.0123 0.1191 7.9 16.0 15..16 0.043 642.7 134.3 0.1036 0.0058 0.0556 3.7 7.5 16..17 0.033 642.7 134.3 0.1036 0.0045 0.0431 2.9 5.8 17..6 0.207 642.7 134.3 0.1036 0.0276 0.2667 17.8 35.8 17..10 0.108 642.7 134.3 0.1036 0.0144 0.1390 9.3 18.7 16..18 0.086 642.7 134.3 0.1036 0.0115 0.1108 7.4 14.9 18..8 0.093 642.7 134.3 0.1036 0.0124 0.1195 8.0 16.0 18..9 0.080 642.7 134.3 0.1036 0.0107 0.1037 6.9 13.9 15..7 0.383 642.7 134.3 0.1036 0.0512 0.4944 32.9 66.4 Time used: 0:35 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 lnL(ntime: 17 np: 22): -2245.482071 +0.000000 11..1 11..2 11..12 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..10 16..18 18..8 18..9 15..7 0.037274 0.028766 0.003833 0.012455 0.015300 0.011760 0.023598 0.020123 0.092381 0.043127 0.033454 0.206837 0.107814 0.085938 0.092690 0.080419 0.383392 2.576906 0.928262 0.071738 0.034301 47.770608 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.27916 (1: 0.037274, 2: 0.028766, (3: 0.012455, ((4: 0.023598, 5: 0.020123): 0.011760, (((6: 0.206837, 10: 0.107814): 0.033454, (8: 0.092690, 9: 0.080419): 0.085938): 0.043127, 7: 0.383392): 0.092381): 0.015300): 0.003833); (D_melanogaster_Abd-B-PC: 0.037274, D_sechellia_Abd-B-PC: 0.028766, (D_simulans_Abd-B-PC: 0.012455, ((D_yakuba_Abd-B-PC: 0.023598, D_erecta_Abd-B-PC: 0.020123): 0.011760, (((D_suzukii_Abd-B-PC: 0.206837, D_takahashii_Abd-B-PC: 0.107814): 0.033454, (D_ficusphila_Abd-B-PC: 0.092690, D_elegans_Abd-B-PC: 0.080419): 0.085938): 0.043127, D_eugracilis_Abd-B-PC: 0.383392): 0.092381): 0.015300): 0.003833); Detailed output identifying parameters kappa (ts/tv) = 2.57691 dN/dS (w) for site classes (K=3) p: 0.92826 0.07174 0.00000 w: 0.03430 1.00000 47.77061 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.037 642.7 134.3 0.1036 0.0050 0.0481 3.2 6.5 11..2 0.029 642.7 134.3 0.1036 0.0038 0.0371 2.5 5.0 11..12 0.004 642.7 134.3 0.1036 0.0005 0.0049 0.3 0.7 12..3 0.012 642.7 134.3 0.1036 0.0017 0.0161 1.1 2.2 12..13 0.015 642.7 134.3 0.1036 0.0020 0.0197 1.3 2.6 13..14 0.012 642.7 134.3 0.1036 0.0016 0.0152 1.0 2.0 14..4 0.024 642.7 134.3 0.1036 0.0032 0.0304 2.0 4.1 14..5 0.020 642.7 134.3 0.1036 0.0027 0.0260 1.7 3.5 13..15 0.092 642.7 134.3 0.1036 0.0123 0.1191 7.9 16.0 15..16 0.043 642.7 134.3 0.1036 0.0058 0.0556 3.7 7.5 16..17 0.033 642.7 134.3 0.1036 0.0045 0.0431 2.9 5.8 17..6 0.207 642.7 134.3 0.1036 0.0276 0.2667 17.8 35.8 17..10 0.108 642.7 134.3 0.1036 0.0144 0.1390 9.3 18.7 16..18 0.086 642.7 134.3 0.1036 0.0115 0.1108 7.4 14.9 18..8 0.093 642.7 134.3 0.1036 0.0124 0.1195 8.0 16.0 18..9 0.080 642.7 134.3 0.1036 0.0107 0.1037 6.9 13.9 15..7 0.383 642.7 134.3 0.1036 0.0512 0.4944 32.9 66.4 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Abd-B-PC) Pr(w>1) post mean +- SE for w 63 G 0.692 1.440 +- 0.536 65 G 0.729 1.462 +- 0.523 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.917 0.058 0.013 0.005 0.002 0.001 0.001 0.001 0.000 0.000 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.998 sum of density on p0-p1 = 1.000000 Time used: 1:27 Model 3: discrete (3 categories) TREE # 1: (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 lnL(ntime: 17 np: 23): -2242.082462 +0.000000 11..1 11..2 11..12 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..10 16..18 18..8 18..9 15..7 0.037126 0.028711 0.003820 0.012450 0.015685 0.011493 0.023762 0.020234 0.094628 0.040906 0.038646 0.205220 0.103733 0.082730 0.092452 0.083387 0.378240 2.479042 0.839332 0.153180 0.017130 0.361948 2.232560 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.27322 (1: 0.037126, 2: 0.028711, (3: 0.012450, ((4: 0.023762, 5: 0.020234): 0.011493, (((6: 0.205220, 10: 0.103733): 0.038646, (8: 0.092452, 9: 0.083387): 0.082730): 0.040906, 7: 0.378240): 0.094628): 0.015685): 0.003820); (D_melanogaster_Abd-B-PC: 0.037126, D_sechellia_Abd-B-PC: 0.028711, (D_simulans_Abd-B-PC: 0.012450, ((D_yakuba_Abd-B-PC: 0.023762, D_erecta_Abd-B-PC: 0.020234): 0.011493, (((D_suzukii_Abd-B-PC: 0.205220, D_takahashii_Abd-B-PC: 0.103733): 0.038646, (D_ficusphila_Abd-B-PC: 0.092452, D_elegans_Abd-B-PC: 0.083387): 0.082730): 0.040906, D_eugracilis_Abd-B-PC: 0.378240): 0.094628): 0.015685): 0.003820); Detailed output identifying parameters kappa (ts/tv) = 2.47904 dN/dS (w) for site classes (K=3) p: 0.83933 0.15318 0.00749 w: 0.01713 0.36195 2.23256 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.037 643.4 133.6 0.0865 0.0044 0.0508 2.8 6.8 11..2 0.029 643.4 133.6 0.0865 0.0034 0.0393 2.2 5.2 11..12 0.004 643.4 133.6 0.0865 0.0005 0.0052 0.3 0.7 12..3 0.012 643.4 133.6 0.0865 0.0015 0.0170 0.9 2.3 12..13 0.016 643.4 133.6 0.0865 0.0019 0.0215 1.2 2.9 13..14 0.011 643.4 133.6 0.0865 0.0014 0.0157 0.9 2.1 14..4 0.024 643.4 133.6 0.0865 0.0028 0.0325 1.8 4.3 14..5 0.020 643.4 133.6 0.0865 0.0024 0.0277 1.5 3.7 13..15 0.095 643.4 133.6 0.0865 0.0112 0.1295 7.2 17.3 15..16 0.041 643.4 133.6 0.0865 0.0048 0.0560 3.1 7.5 16..17 0.039 643.4 133.6 0.0865 0.0046 0.0529 2.9 7.1 17..6 0.205 643.4 133.6 0.0865 0.0243 0.2809 15.6 37.5 17..10 0.104 643.4 133.6 0.0865 0.0123 0.1420 7.9 19.0 16..18 0.083 643.4 133.6 0.0865 0.0098 0.1132 6.3 15.1 18..8 0.092 643.4 133.6 0.0865 0.0109 0.1265 7.0 16.9 18..9 0.083 643.4 133.6 0.0865 0.0099 0.1141 6.4 15.2 15..7 0.378 643.4 133.6 0.0865 0.0448 0.5176 28.8 69.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Abd-B-PC) Pr(w>1) post mean +- SE for w 63 G 0.658 1.594 65 G 0.873 1.994 Time used: 2:43 Model 7: beta (10 categories) TREE # 1: (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 lnL(ntime: 17 np: 20): -2243.226510 +0.000000 11..1 11..2 11..12 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..10 16..18 18..8 18..9 15..7 0.036974 0.028591 0.003806 0.012409 0.015587 0.011483 0.023680 0.020152 0.091321 0.039851 0.036478 0.199294 0.105377 0.084033 0.091147 0.081771 0.371738 2.455158 0.145686 1.553864 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.25369 (1: 0.036974, 2: 0.028591, (3: 0.012409, ((4: 0.023680, 5: 0.020152): 0.011483, (((6: 0.199294, 10: 0.105377): 0.036478, (8: 0.091147, 9: 0.081771): 0.084033): 0.039851, 7: 0.371738): 0.091321): 0.015587): 0.003806); (D_melanogaster_Abd-B-PC: 0.036974, D_sechellia_Abd-B-PC: 0.028591, (D_simulans_Abd-B-PC: 0.012409, ((D_yakuba_Abd-B-PC: 0.023680, D_erecta_Abd-B-PC: 0.020152): 0.011483, (((D_suzukii_Abd-B-PC: 0.199294, D_takahashii_Abd-B-PC: 0.105377): 0.036478, (D_ficusphila_Abd-B-PC: 0.091147, D_elegans_Abd-B-PC: 0.081771): 0.084033): 0.039851, D_eugracilis_Abd-B-PC: 0.371738): 0.091321): 0.015587): 0.003806); Detailed output identifying parameters kappa (ts/tv) = 2.45516 Parameters in M7 (beta): p = 0.14569 q = 1.55386 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00004 0.00040 0.00226 0.00898 0.02854 0.07810 0.19570 0.49444 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.037 643.6 133.4 0.0808 0.0042 0.0516 2.7 6.9 11..2 0.029 643.6 133.4 0.0808 0.0032 0.0399 2.1 5.3 11..12 0.004 643.6 133.4 0.0808 0.0004 0.0053 0.3 0.7 12..3 0.012 643.6 133.4 0.0808 0.0014 0.0173 0.9 2.3 12..13 0.016 643.6 133.4 0.0808 0.0018 0.0218 1.1 2.9 13..14 0.011 643.6 133.4 0.0808 0.0013 0.0160 0.8 2.1 14..4 0.024 643.6 133.4 0.0808 0.0027 0.0331 1.7 4.4 14..5 0.020 643.6 133.4 0.0808 0.0023 0.0281 1.5 3.8 13..15 0.091 643.6 133.4 0.0808 0.0103 0.1276 6.6 17.0 15..16 0.040 643.6 133.4 0.0808 0.0045 0.0557 2.9 7.4 16..17 0.036 643.6 133.4 0.0808 0.0041 0.0510 2.7 6.8 17..6 0.199 643.6 133.4 0.0808 0.0225 0.2784 14.5 37.1 17..10 0.105 643.6 133.4 0.0808 0.0119 0.1472 7.7 19.6 16..18 0.084 643.6 133.4 0.0808 0.0095 0.1174 6.1 15.7 18..8 0.091 643.6 133.4 0.0808 0.0103 0.1273 6.6 17.0 18..9 0.082 643.6 133.4 0.0808 0.0092 0.1142 5.9 15.2 15..7 0.372 643.6 133.4 0.0808 0.0420 0.5192 27.0 69.3 Time used: 3:51 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, (3, ((4, 5), (((6, 10), (8, 9)), 7)))); MP score: 239 lnL(ntime: 17 np: 22): -2242.248818 +0.000000 11..1 11..2 11..12 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..10 16..18 18..8 18..9 15..7 0.037132 0.028715 0.003821 0.012454 0.015675 0.011506 0.023767 0.020237 0.094671 0.040592 0.038745 0.204743 0.103711 0.082805 0.092393 0.083394 0.378028 2.475930 0.992372 0.175028 2.160082 2.196935 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.27239 (1: 0.037132, 2: 0.028715, (3: 0.012454, ((4: 0.023767, 5: 0.020237): 0.011506, (((6: 0.204743, 10: 0.103711): 0.038745, (8: 0.092393, 9: 0.083394): 0.082805): 0.040592, 7: 0.378028): 0.094671): 0.015675): 0.003821); (D_melanogaster_Abd-B-PC: 0.037132, D_sechellia_Abd-B-PC: 0.028715, (D_simulans_Abd-B-PC: 0.012454, ((D_yakuba_Abd-B-PC: 0.023767, D_erecta_Abd-B-PC: 0.020237): 0.011506, (((D_suzukii_Abd-B-PC: 0.204743, D_takahashii_Abd-B-PC: 0.103711): 0.038745, (D_ficusphila_Abd-B-PC: 0.092393, D_elegans_Abd-B-PC: 0.083394): 0.082805): 0.040592, D_eugracilis_Abd-B-PC: 0.378028): 0.094671): 0.015675): 0.003821); Detailed output identifying parameters kappa (ts/tv) = 2.47593 Parameters in M8 (beta&w>1): p0 = 0.99237 p = 0.17503 q = 2.16008 (p1 = 0.00763) w = 2.19693 dN/dS (w) for site classes (K=11) p: 0.09924 0.09924 0.09924 0.09924 0.09924 0.09924 0.09924 0.09924 0.09924 0.09924 0.00763 w: 0.00000 0.00001 0.00013 0.00090 0.00380 0.01205 0.03191 0.07547 0.16947 0.40642 2.19693 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.037 643.5 133.5 0.0862 0.0044 0.0509 2.8 6.8 11..2 0.029 643.5 133.5 0.0862 0.0034 0.0393 2.2 5.3 11..12 0.004 643.5 133.5 0.0862 0.0005 0.0052 0.3 0.7 12..3 0.012 643.5 133.5 0.0862 0.0015 0.0171 0.9 2.3 12..13 0.016 643.5 133.5 0.0862 0.0019 0.0215 1.2 2.9 13..14 0.012 643.5 133.5 0.0862 0.0014 0.0158 0.9 2.1 14..4 0.024 643.5 133.5 0.0862 0.0028 0.0326 1.8 4.3 14..5 0.020 643.5 133.5 0.0862 0.0024 0.0277 1.5 3.7 13..15 0.095 643.5 133.5 0.0862 0.0112 0.1297 7.2 17.3 15..16 0.041 643.5 133.5 0.0862 0.0048 0.0556 3.1 7.4 16..17 0.039 643.5 133.5 0.0862 0.0046 0.0531 2.9 7.1 17..6 0.205 643.5 133.5 0.0862 0.0242 0.2805 15.6 37.5 17..10 0.104 643.5 133.5 0.0862 0.0123 0.1421 7.9 19.0 16..18 0.083 643.5 133.5 0.0862 0.0098 0.1135 6.3 15.2 18..8 0.092 643.5 133.5 0.0862 0.0109 0.1266 7.0 16.9 18..9 0.083 643.5 133.5 0.0862 0.0099 0.1143 6.3 15.3 15..7 0.378 643.5 133.5 0.0862 0.0447 0.5179 28.7 69.2 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Abd-B-PC) Pr(w>1) post mean +- SE for w 63 G 0.667 1.593 65 G 0.866 1.957 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Abd-B-PC) Pr(w>1) post mean +- SE for w 63 G 0.873 1.508 +- 0.589 65 G 0.929 1.570 +- 0.544 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.006 0.036 0.123 0.291 0.543 ws: 0.905 0.069 0.016 0.006 0.002 0.001 0.000 0.000 0.000 0.000 Time used: 6:10
Model 1: NearlyNeutral -2245.48206 Model 2: PositiveSelection -2245.482071 Model 0: one-ratio -2269.725989 Model 3: discrete -2242.082462 Model 7: beta -2243.22651 Model 8: beta&w>1 -2242.248818 Model 0 vs 1 48.487858000000415 Model 2 vs 1 2.2000000171829015E-5 Model 8 vs 7 1.9553839999998672