--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 11 18:30:44 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/2/Abd-B-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2990.33         -2999.78
2      -2990.32         -2999.64
--------------------------------------
TOTAL    -2990.33         -2999.71
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.307166    0.002497    0.223345    0.416524    0.299814   1181.56   1245.03    1.000
r(A<->C){all}   0.049151    0.000358    0.015864    0.086916    0.047163    894.67    971.51    1.000
r(A<->G){all}   0.373252    0.003204    0.265247    0.486765    0.370861    646.17    714.25    1.000
r(A<->T){all}   0.067136    0.001209    0.008022    0.134798    0.063227    579.07    719.27    1.000
r(C<->G){all}   0.049701    0.000274    0.021686    0.085666    0.048302    814.62    906.80    1.000
r(C<->T){all}   0.415346    0.003811    0.298281    0.538207    0.415453    684.56    712.80    1.000
r(G<->T){all}   0.045414    0.000652    0.002373    0.092515    0.041701    856.87    911.46    1.000
pi(A){all}      0.247981    0.000115    0.227766    0.269254    0.247915   1067.45   1072.24    1.000
pi(C){all}      0.365045    0.000137    0.341023    0.386349    0.364947   1081.61   1092.70    1.000
pi(G){all}      0.251929    0.000113    0.231327    0.272210    0.251735   1161.31   1212.35    1.000
pi(T){all}      0.135045    0.000073    0.116864    0.150586    0.134936   1121.80   1133.66    1.000
alpha{1,2}      0.053260    0.001260    0.000101    0.116517    0.050252   1190.93   1195.90    1.000
alpha{3}        2.239791    0.628880    0.850167    3.727047    2.121262   1176.60   1273.08    1.000
pinvar{all}     0.598131    0.002070    0.507893    0.685951    0.599866   1011.99   1192.70    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2645.258414
Model 2: PositiveSelection	-2645.213561
Model 0: one-ratio	-2655.43363
Model 3: discrete	-2644.99544
Model 7: beta	-2645.372
Model 8: beta&w>1	-2645.045682


Model 0 vs 1	20.350432000000183

Model 2 vs 1	0.08970599999975093

Model 8 vs 7	0.6526359999998022
>C1
MQQHHLQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPLHTTSHHH
SAHPHLQQQQQQQQHAVVASSPSSVLQQQQQQSTPTTHSTPTHAVMYEDP
PPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVAGALSPAQTPTG
PSAQQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQQQNAAVAPGQT
QIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSAAV
KRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNYRP
DQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLRGY
PSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTL
ELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQA
NQQNNNNNSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQooooooo
oooo
>C2
MQQHHLQQQQQQQQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQHAVVASSPSSVLQQQQQQSTPTTHSTPTH
AVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVAGALS
PAQTPTGPSAQQQQQQHLTSPHHQQLPQQQTPNSVASGASSNLQQQQQNA
AVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFE
TDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQY
WGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSS
PGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRKP
YSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNK
KNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLNLSLNMGHHAAKMHQ
oooo
>C3
MQQHHLQQQQQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPLHTT
SHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQQQSTPTTHSTPTHA
VMYEDPPPVPLVAVQQQHLPAPQQQQQQLQQQQQQQQLATTPVAGALSPA
QTPTGPSAQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASSNLQQQQQQ
QQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRAG
PGFETDTSAAVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFP
VGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPP
TYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLHEWTGQVSVRK
KRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRR
MKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLNLSLNMGHHAA
KMHQ
>C4
MQQHHLQQQQQQQQQQEQQHLQEHLQQLHLHAHHHLPQPLHTTSHHHSAH
PHLQQQQQQQQQQQQHAVVASSPSSVLQQSTPTTHSTPTHAVMYEDPPPV
PLVAVQQQHLPAPQQQQQQLQQQQQQQLATTPVAGALSPAQTPTGPSAQQ
QQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASSNLQQQQQQQNAAVAPG
QTQIVAPTAASVSPSSVSSQKEDINMSIQLAPLHIPAIRAGPGFETDTSA
AVKRHTAHWAYNDEGFNQHYGSGYYDRKHMFAYPYPETQFPVGQYWGPNY
RPDQTTSAAAAAAYMNEAERHVSAAARQSVEGTSTSSYEPPTYSSPGGLR
GYPSENYSSSGASGGLSVGAVGSCTPNPGLHEWTGQVSVRKKRKPYSKFQ
TLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQR
QANQQNNNNNSSSNHNHAQANQQHHSGHHLNLSLNMGHHAAKMHQooooo
oooo
>C5
MQQHHLQQQQQQQQQQEQQHLQEQQHLQQLHHHAHHHLPQPLHTTSHHHS
AHPHLQQQQQQQQQQQQHAVVPSSPNSLLQQQQQQSTPTTHSTPTHAVMY
EDPPPVPIVAVQQQLLPAPQQQQQLQQQQQQQLATTPVAGALSPSQTPTG
PSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASANLQQQQQQNAA
VAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPLHIPAIRPGPGFET
DTSAAVKRHPAHWTYNDDGFNQYHASASGYYDRKHMFPYPYPDTQFPVSQ
YWTQGYRADQTTSAAAAVAYMNDAERHVSAAARQSVEGTSTSSYEPPTYS
SPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLHEWTGQVSVRKKRK
PYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKN
KKNSQRQANQQNNNNNSSGNHNHSQATQQHHSSHHLNLSLNMGHHAAKMH
Qooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=525 

C1              MQQHHLQQQQQQQQQQ-------EQQHLQEQQQHLQQLHHHAHHHLPQPL
C2              MQQHHLQQQQQQQQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPL
C3              MQQHHLQQQQQQQQQQQQQQ---EQQHLQEQQQHLQQLHHHAHHHLPQPL
C4              MQQHHLQQQQQQQQQQ-------EQQHLQE---HLQQLHLHAHHHLPQPL
C5              MQQHHLQQQQQQQQQQ-------EQQHLQEQQ-HLQQLHHHAHHHLPQPL
                ****************       *******   ****** **********

C1              HTTSHHHSAHPHLQQQQQQQQ----HAVVASSPSSVLQQQQQQSTPTTHS
C2              HTTSHHHSAHPHLQQQQQQQQ----HAVVASSPSSVLQQQQQQSTPTTHS
C3              HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQQ--QSTPTTHS
C4              HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQS----TPTTHS
C5              HTTSHHHSAHPHLQQQQQQQQQQQQHAVVPSSPNSLLQQQQQQSTPTTHS
                *********************    ****.***.*:***.    ******

C1              TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
C2              TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
C3              TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQ-QLQQQQQQQQLATTPVA
C4              TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQ--QLQQQQQQQLATTPVA
C5              TPTHAVMYEDPPPVPIVAVQQQLLPAPQQQQQ---LQQQQQQQLATTPVA
                ***************:****** *********    **************

C1              GALSPAQTPTGPSAQQQQ------HLTSPHHQQLPQQQ-TPNSVASGASS
C2              GALSPAQTPTGPSAQQQQQQ----HLTSPHHQQLPQQQ-TPNSVASGASS
C3              GALSPAQTPTGPSAQQQQQQQQ--HLTSPHHQQLPQQQQTPNSVASGASS
C4              GALSPAQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASS
C5              GALSPSQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASA
                *****:************      ************** **********:

C1              NLQQQQQQQ-NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
C2              NLQQQQQ---NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
C3              NLQQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
C4              NLQQQQQQQ-NAAVAPGQTQIVAPTAASVSPSSVSSQKEDINMSIQLAPL
C5              NLQQQQQQ--NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
                *******   ***************:************************

C1              HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
C2              HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
C3              HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
C4              HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
C5              HIPAIRPGPGFETDTSAAVKRHPAHWTYNDDGFNQYHASASGYYDRKHMF
                ******.***************.***:***:****::.  **********

C1              AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
C2              AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
C3              AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
C4              AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
C5              PYPYPDTQFPVSQYWTQGYRADQTTSAAAAVAYMNDAERHVSAAARQSVE
                .****:*****.***  .**.*********.****:**************

C1              GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
C2              GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
C3              GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
C4              GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
C5              GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
                *****************************************.********

C1              EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
C2              EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
C3              EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
C4              EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
C5              EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
                **************************************************

C1              QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
C2              QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
C3              QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
C4              QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQANQQHHSGHHLN
C5              QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSGNHNHSQATQQHHSSHHLN
                *******************************.****:**.*****.****

C1              LSLNMGHHAAKMHQooooooooooo
C2              LSLNMGHHAAKMHQoooo-------
C3              LSLNMGHHAAKMHQ-----------
C4              LSLNMGHHAAKMHQooooooooo--
C5              LSLNMGHHAAKMHQooo--------
                **************           




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  504 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  504 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13004]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [13004]--->[11876]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/2/Abd-B-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.332 Mb, Max= 30.831 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQQHHLQQQQQQQQQQ-------EQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQ----HAVVASSPSSVLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQ------HLTSPHHQQLPQQQ-TPNSVASGASS
NLQQQQQQQ-NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQooooooooooo
>C2
MQQHHLQQQQQQQQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQ----HAVVASSPSSVLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQ----HLTSPHHQQLPQQQ-TPNSVASGASS
NLQQQQQ---NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQoooo-------
>C3
MQQHHLQQQQQQQQQQQQQQ---EQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQQ--QSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQ-QLQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQQQ--HLTSPHHQQLPQQQQTPNSVASGASS
NLQQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQ-----------
>C4
MQQHHLQQQQQQQQQQ-------EQQHLQE---HLQQLHLHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQS----TPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQ--QLQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASS
NLQQQQQQQ-NAAVAPGQTQIVAPTAASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQANQQHHSGHHLN
LSLNMGHHAAKMHQooooooooo--
>C5
MQQHHLQQQQQQQQQQ-------EQQHLQEQQ-HLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVPSSPNSLLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPIVAVQQQLLPAPQQQQQ---LQQQQQQQLATTPVA
GALSPSQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASA
NLQQQQQQ--NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRPGPGFETDTSAAVKRHPAHWTYNDDGFNQYHASASGYYDRKHMF
PYPYPDTQFPVSQYWTQGYRADQTTSAAAAVAYMNDAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSGNHNHSQATQQHHSSHHLN
LSLNMGHHAAKMHQooo--------

FORMAT of file /tmp/tmp2321793205978594076aln Not Supported[FATAL:T-COFFEE]
>C1
MQQHHLQQQQQQQQQQ-------EQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQ----HAVVASSPSSVLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQ------HLTSPHHQQLPQQQ-TPNSVASGASS
NLQQQQQQQ-NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQooooooooooo
>C2
MQQHHLQQQQQQQQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQ----HAVVASSPSSVLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQ----HLTSPHHQQLPQQQ-TPNSVASGASS
NLQQQQQ---NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQoooo-------
>C3
MQQHHLQQQQQQQQQQQQQQ---EQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQQ--QSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQ-QLQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQQQ--HLTSPHHQQLPQQQQTPNSVASGASS
NLQQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQ-----------
>C4
MQQHHLQQQQQQQQQQ-------EQQHLQE---HLQQLHLHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQS----TPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQ--QLQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASS
NLQQQQQQQ-NAAVAPGQTQIVAPTAASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYG--SGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQANQQHHSGHHLN
LSLNMGHHAAKMHQooooooooo--
>C5
MQQHHLQQQQQQQQQQ-------EQQHLQEQQ-HLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVPSSPNSLLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPIVAVQQQLLPAPQQQQQ---LQQQQQQQLATTPVA
GALSPSQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASA
NLQQQQQQ--NAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRPGPGFETDTSAAVKRHPAHWTYNDDGFNQYHASASGYYDRKHMF
PYPYPDTQFPVSQYWTQGYRADQTTSAAAAVAYMNDAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSGNHNHSQATQQHHSSHHLN
LSLNMGHHAAKMHQooo--------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:525 S:94 BS:525
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 99.59 C1	 C3	 99.59
TOP	    2    0	 99.59 C3	 C1	 99.59
BOT	    0    3	 98.78 C1	 C4	 98.78
TOP	    3    0	 98.78 C4	 C1	 98.78
BOT	    0    4	 94.50 C1	 C5	 94.50
TOP	    4    0	 94.50 C5	 C1	 94.50
BOT	    1    2	 99.60 C2	 C3	 99.60
TOP	    2    1	 99.60 C3	 C2	 99.60
BOT	    1    3	 98.77 C2	 C4	 98.77
TOP	    3    1	 98.77 C4	 C2	 98.77
BOT	    1    4	 94.51 C2	 C5	 94.51
TOP	    4    1	 94.51 C5	 C2	 94.51
BOT	    2    3	 98.78 C3	 C4	 98.78
TOP	    3    2	 98.78 C4	 C3	 98.78
BOT	    2    4	 94.34 C3	 C5	 94.34
TOP	    4    2	 94.34 C5	 C3	 94.34
BOT	    3    4	 93.75 C4	 C5	 93.75
TOP	    4    3	 93.75 C5	 C4	 93.75
AVG	 0	 C1	  *	 98.22
AVG	 1	 C2	  *	 98.22
AVG	 2	 C3	  *	 98.08
AVG	 3	 C4	  *	 97.52
AVG	 4	 C5	  *	 94.28
TOT	 TOT	  *	 97.26
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCAGCAGCACCATCTGCAGCAGCAGCAACAGCAGCAGCAGCAGCAG--
C2              ATGCAGCAGCACCACCTGCAGCAGCAGCAACAGCAGCAGCAGCAGCAACA
C3              ATGCAGCAGCACCACCTGCAGCAGCAGCAACAGCAGCAACAACAGCAGCA
C4              ATGCAGCAGCACCACCTGCAGCAGCAGCAACAGCAGCAGCAGCAGCAG--
C5              ATGCAGCAGCACCACCTGCAACAGCAGCAGCAGCAGCAGCAGCAGCAG--
                ************** *****.********.********.**.*****.  

C1              -------------------GAGCAGCAGCATCTGCAGGAGCAGCAGCAGC
C2              ACAGCAGCAGCAGCAGCAGGAGCAGCAGCATCTGCAGGAGCAGCAGCAGC
C3              GCAGCAGCAG---------GAGCAGCAGCATCTGCAGGAGCAGCAGCAGC
C4              -------------------GAGCAGCAGCATCTGCAGGAG---------C
C5              -------------------GAGCAGCAGCATCTGCAGGAGCAGCAA---C
                                   *********************         *

C1              ATCTGCAGCAACTGCATCACCATGCGCACCACCACCTGCCTCAGCCTCTC
C2              ATCTGCAGCAACTGCATCACCATGCGCACCACCACCTGCCTCAGCCTCTC
C3              ATCTGCAGCAACTGCACCACCATGCGCACCACCACCTGCCTCAGCCTCTC
C4              ATCTGCAGCAACTGCATCTCCATGCGCACCACCACCTGCCTCAGCCTCTC
C5              ATCTGCAGCAACTGCATCACCATGCCCACCACCACCTGCCTCAGCCTCTG
                **************** *:****** *********************** 

C1              CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
C2              CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
C3              CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
C4              CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
C5              CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAACAGCAGCA
                *****************************************.********

C1              ACAGCAGCAGCAA------------CATGCAGTCGTCGCCTCCTCACCCT
C2              ACAGCAGCAGCAA------------CATGCAGTCGTCGCCTCCTCACCCT
C3              GCAACAGCAACAGCAGCAGCAGCAACATGCAGTGGTCGCCTCCTCGCCCT
C4              GCAGCAGCAACAGCAGCAGCAGCAACATGCAGTCGTCGCCTCCTCGCCCT
C5              ACAGCAACAACAGCAGCAGCAGCAACATGCAGTGGTCCCCTCCTCGCCCA
                .**.**.**.**.            ******** *** *******.***:

C1              CCTCGGTGCTCCAGCAGCAGCAACAGCAGTCAACTCCCACCACACATTCC
C2              CCTCGGTGCTCCAGCAGCAGCAACAGCAGTCAACTCCCACCACACATTCC
C3              CCTCGGTGCTCCAGCAACAG------CAGTCAACTCCCACCACACATTCC
C4              CCTCCGTGCTCCAGCAGTCA------------ACTCCCACCACACATTCC
C5              ACTCTCTGCTCCAGCAGCAGCAACAGCAGTCAACTCCCACCACACATTCC
                .***  **********. ..            ******************

C1              ACGCCCACGCATGCGGTTATGTACGAGGATCCTCCGCCTGTGCCACTTGT
C2              ACGCCCACGCACGCGGTTATGTACGAGGATCCTCCGCCTGTGCCACTTGT
C3              ACGCCCACGCATGCGGTCATGTACGAGGATCCTCCGCCTGTGCCACTTGT
C4              ACGCCCACGCATGCGGTCATGTACGAGGATCCTCCGCCTGTGCCACTTGT
C5              ACGCCCACGCATGCGGTCATGTACGAGGATCCTCCGCCTGTGCCAATTGT
                *********** ***** ***************************.****

C1              CGCCGTACAGCAGCAACACCTCCCCGCTCCGCAGCAGCAGCAGCAACTTC
C2              CGCCGTGCAGCAGCAACATCTCCCCGCTCCGCAACAACAGCAGCAACTCC
C3              CGCCGTGCAGCAGCAACACCTCCCCGCTCCGCAGCAACAGCAGCAG---C
C4              CGCCGTGCAGCAGCAACACCTCCCCGCTCCGCAGCAACAGCAGCAG----
C5              CGCCGTGCAGCAGCAACTTCTCCCCGCTCCGCAACAGCAGCAGCAA----
                ******.**********: **************.**.********.    

C1              AACAGCAGCAGCAACAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
C2              AACAGCAGCAGCAACAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
C3              AGCTCCAACAGCAGCAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
C4              --CAGCTCCAACAGCAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
C5              -----CTCCAGCAGCAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
                     *: **.**.************************************

C1              GGCGCCCTCAGTCCTGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
C2              GGCGCCCTCAGTCCCGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
C3              GGCGCCCTCAGTCCCGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
C4              GGCGCCCTCAGTCCCGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
C5              GGCGCCCTCAGTCCCTCCCAAACACCCACTGGACCCTCCGCCCAGCAGCA
                **************  ****************************.**.**

C1              GCAA------------------CATCTCACATCGCCCCACCACCAGCAAC
C2              GCAGCAGCAA------------CATCTCACATCGCCCCACCACCAGCAAC
C3              GCAACAGCAGCAGCAA------CATCTCACATCGCCCCACCACCAGCAAC
C4              GCAACAGCAGCAGCAGCAGCAACATCTCACATCCCCCCACCACCAGCAAC
C5              GCAGCAACAGCAACAGCAGCAACATCTCACATCGCCCCACCATCAGCAAC
                ***.                  *********** ******** *******

C1              TGCCGCAGCAACAA---ACCCCGAACAGTGTCGCCAGCGGCGCCTCCTCG
C2              TGCCGCAGCAACAA---ACCCCGAACAGTGTCGCCAGTGGCGCCTCCTCG
C3              TGCCGCAGCAGCAACAAACCCCAAACAGCGTCGCCAGCGGCGCCTCCTCG
C4              TGCCGCAGCAGCAGCAAACCCCAAACAGTGTCGCCAGCGGCGCCTCCTCG
C5              TGCCGCAGCAGCAACAGACCCCGAATAGCGTTGCCAGTGGCGCCTCCGCG
                **********.**.   *****.** ** ** ***** ********* **

C1              AATCTCCAGCAGCAGCAGCAACAGCAG---AATGCTGCAGTTGCTCCTGG
C2              AATCTCCAGCAGCAACAGCAG---------AATGCTGCAGTTGCTCCTGG
C3              AATCTCCAGCAGCAGCAGCAGCAACAGCAGAATGCTGCAGTTGCTCCTGG
C4              AATCTCCAGCAGCAGCAGCAACAGCAG---AATGCTGCAGTTGCTCCTGG
C5              AATCTCCAGCAGCAGCAACAGCAG------AATGCTGCAGTTGCTCCTGG
                **************.**.**.         ********************

C1              CCAGACGCAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
C2              CCAGACGCAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
C3              CCAGACGCAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
C4              CCAGACGCAGATCGTGGCGCCGACCGCGGCGAGTGTTTCTCCCTCCAGCG
C5              CCAGACACAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
                ******.******** *********.********************** *

C1              TTAGTTCTCAGAAGGAAGACATCAATATGTCCATACAATTAGCGCCACTG
C2              TTAGTTCTCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
C3              TTAGTTCGCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
C4              TTAGTTCTCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
C5              TTAGTTCTCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
                ******* **************************.***************

C1              CATATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
C2              CATATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
C3              CATATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
C4              CACATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
C5              CACATACCAGCCATCCGGCCAGGCCCGGGATTCGAGACGGACACCTCGGC
                ** *****.********* *.** **************************

C1              GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
C2              GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
C3              GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
C4              GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
C5              GGCGGTCAAGCGGCACCCGGCACACTGGACCTACAACGATGACGGCTTCA
                ****************.***********.********** ** **.****

C1              ATCAGCATTACGGC------TCCGGGTACTACGACCGCAAGCACATGTTC
C2              ACCAGCATTACGGC------TCCGGGTACTACGACCGCAAGCACATGTTC
C3              ACCAGCACTACGGT------TCCGGGTACTACGACCGCAAGCACATGTTC
C4              ACCAGCACTACGGT------TCCGGGTACTACGACCGCAAGCACATGTTC
C5              ACCAGTACCACGCCTCCGCGTCGGGGTACTACGACCGCAAGCACATGTTC
                * *** *  ***        ** ***************************

C1              GCCTATCCTTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
C2              GCCTACCCTTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
C3              GCCTACCCCTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
C4              GCCTACCCCTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
C5              CCCTACCCCTATCCAGACACCCAGTTTCCGGTAAGTCAGTACTGGACCCA
                 **** ** ** *****.** ***********:.***********. **.

C1              CAACTACCGCCCCGATCAGACCACCTCTGCCGCAGCGGCGGCGGCCTACA
C2              CAACTACCGCCCCGATCAGACCACCTCTGCCGCGGCGGCGGCGGCCTACA
C3              CAACTACCGCCCCGATCAGACCACCTCTGCCGCCGCGGCGGCGGCCTACA
C4              CAACTACCGCCCCGACCAGACCACCTCTGCCGCGGCGGCGGCGGCCTACA
C5              AGGCTACCGCGCCGATCAGACCACCTCCGCCGCGGCGGCAGTGGCCTACA
                ...******* **** *********** ***** *****.* ********

C1              TGAACGAAGCGGAGCGCCACGTGAGCGCCGCCGCCCGACAGTCCGTCGAG
C2              TGAACGAGGCGGAGCGCCACGTGAGCGCCGCTGCTCGACAGTCCGTCGAG
C3              TGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGCCCGCCAGTCCGTCGAG
C4              TGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGCCCGACAGTCCGTCGAG
C5              TGAACGATGCCGAGCGCCACGTCAGCGCCGCGGCCCGCCAGTCCGTCGAG
                ******* ** *********** ******** ** **.************

C1              GGCACATCGACGTCCAGCTATGAGCCGCCCACCTACTCCTCGCCAGGCGG
C2              GGCACATCGACGTCCAGCTATGAGCCGCCCACCTACTCCTCGCCAGGCGG
C3              GGCACATCGACGTCCAGCTACGAGCCGCCCACCTACTCCTCGCCGGGCGG
C4              GGCACATCGACGTCCAGCTACGAGCCGCCCACCTACTCCTCGCCGGGCGG
C5              GGCACATCGACGTCCAGCTACGAGCCACCTACTTACTCCTCGCCGGGCGG
                ******************** *****.** ** ***********.*****

C1              CCTGCGCGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
C2              CCTGCGCGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
C3              ACTGCGTGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
C4              ACTGCGGGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
C5              ACTCCGCGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCCGGTG
                .** ** ************************************** ****

C1              GATTATCCGTGGGAGCAGTGGGTCCTTGCACGCCCAATCCCGGACTGCAC
C2              GATTGTCCGTGGGAGCGGTGGGTCCTTGCACGCCCAATCCCGGATTGCAC
C3              GATTGTCGGTGGGAGCGGTGGGCTCTTGCACGCCCAATCCCGGACTGCAC
C4              GATTGTCGGTGGGAGCGGTGGGTTCTTGCACGCCCAATCCCGGACTGCAC
C5              GTTTGTCCGTGGGAGCGGTGGGTCCTTGCACGCCCAATCCCGGACTGCAC
                *:**.** ********.*****  ******************** *****

C1              GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCGTACTCGAA
C2              GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCATACTCGAA
C3              GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCGTACTCGAA
C4              GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCGTACTCGAA
C5              GAGTGGACCGGCCAAGTGTCCGTCCGGAAAAAGCGGAAGCCGTACTCCAA
                *********** **.******************** *****.***** **

C1              GTTCCAGACCCTGGAGCTGGAGAAGGAGTTTCTTTTCAATGCGTATGTTT
C2              GTTCCAAACCCTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCGTATGTTT
C3              GTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCGTATGTCT
C4              GTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCGTATGTTT
C5              GTTCCAGACTTTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCATATGTGT
                ******.**  ******************* ***********.***** *

C1              CCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
C2              CTAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
C3              CCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
C4              CCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
C5              CCAAGCAGAAGCGCTGGGAGCTGGCCAGGAATTTGCAGTTGACCGAGCGA
                * *****.***********. *******.********* ***********

C1              CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
C2              CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
C3              CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
C4              CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
C5              CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
                **************************************************

C1              ACAGCGCCAGGCCAATCAGCAGAACAACAACAACAATTCGAGCAGCAACC
C2              ACAGCGCCAGGCCAATCAGCAAAACAACAACAACAACTCGAGCAGCAACC
C3              ACAGCGCCAGGCCAATCAGCAGAACAACAACAATAACTCGAGCAGCAACC
C4              CCAGCGCCAGGCCAATCAGCAGAACAACAACAACAACTCGAGCAGCAACC
C5              GCAGCGCCAGGCCAATCAGCAGAACAACAACAACAACTCGAGCGGCAACC
                 ********************.*********** ** ******.******

C1              ACAACCACGCGCAGGCGACCCAGCAGCACCACAGCGGCCACCACCTGAAC
C2              ACAACCACGCGCAGGCGACCCAGCAGCACCACAGCGGCCACCACCTGAAC
C3              ACAACCACGCGCAGGCGACCCAGCAGCACCACAGCGGCCACCACCTGAAC
C4              ACAACCACGCGCAGGCGAACCAGCAGCACCACAGCGGCCACCACCTGAAC
C5              ACAACCACTCGCAGGCGACCCAGCAGCACCACAGCAGCCACCACCTGAAC
                ******** *********.****************.**************

C1              CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
C2              CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
C3              CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
C4              CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
C5              CTTAGCCTAAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
                ********.*********************************        

C1              -------------------------
C2              -------------------------
C3              -------------------------
C4              -------------------------
C5              -------------------------
                                         



>C1
ATGCAGCAGCACCATCTGCAGCAGCAGCAACAGCAGCAGCAGCAGCAG--
-------------------GAGCAGCAGCATCTGCAGGAGCAGCAGCAGC
ATCTGCAGCAACTGCATCACCATGCGCACCACCACCTGCCTCAGCCTCTC
CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
ACAGCAGCAGCAA------------CATGCAGTCGTCGCCTCCTCACCCT
CCTCGGTGCTCCAGCAGCAGCAACAGCAGTCAACTCCCACCACACATTCC
ACGCCCACGCATGCGGTTATGTACGAGGATCCTCCGCCTGTGCCACTTGT
CGCCGTACAGCAGCAACACCTCCCCGCTCCGCAGCAGCAGCAGCAACTTC
AACAGCAGCAGCAACAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
GGCGCCCTCAGTCCTGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
GCAA------------------CATCTCACATCGCCCCACCACCAGCAAC
TGCCGCAGCAACAA---ACCCCGAACAGTGTCGCCAGCGGCGCCTCCTCG
AATCTCCAGCAGCAGCAGCAACAGCAG---AATGCTGCAGTTGCTCCTGG
CCAGACGCAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
TTAGTTCTCAGAAGGAAGACATCAATATGTCCATACAATTAGCGCCACTG
CATATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
ATCAGCATTACGGC------TCCGGGTACTACGACCGCAAGCACATGTTC
GCCTATCCTTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
CAACTACCGCCCCGATCAGACCACCTCTGCCGCAGCGGCGGCGGCCTACA
TGAACGAAGCGGAGCGCCACGTGAGCGCCGCCGCCCGACAGTCCGTCGAG
GGCACATCGACGTCCAGCTATGAGCCGCCCACCTACTCCTCGCCAGGCGG
CCTGCGCGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
GATTATCCGTGGGAGCAGTGGGTCCTTGCACGCCCAATCCCGGACTGCAC
GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCGTACTCGAA
GTTCCAGACCCTGGAGCTGGAGAAGGAGTTTCTTTTCAATGCGTATGTTT
CCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
ACAGCGCCAGGCCAATCAGCAGAACAACAACAACAATTCGAGCAGCAACC
ACAACCACGCGCAGGCGACCCAGCAGCACCACAGCGGCCACCACCTGAAC
CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
-------------------------
>C2
ATGCAGCAGCACCACCTGCAGCAGCAGCAACAGCAGCAGCAGCAGCAACA
ACAGCAGCAGCAGCAGCAGGAGCAGCAGCATCTGCAGGAGCAGCAGCAGC
ATCTGCAGCAACTGCATCACCATGCGCACCACCACCTGCCTCAGCCTCTC
CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
ACAGCAGCAGCAA------------CATGCAGTCGTCGCCTCCTCACCCT
CCTCGGTGCTCCAGCAGCAGCAACAGCAGTCAACTCCCACCACACATTCC
ACGCCCACGCACGCGGTTATGTACGAGGATCCTCCGCCTGTGCCACTTGT
CGCCGTGCAGCAGCAACATCTCCCCGCTCCGCAACAACAGCAGCAACTCC
AACAGCAGCAGCAACAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
GGCGCCCTCAGTCCCGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
GCAGCAGCAA------------CATCTCACATCGCCCCACCACCAGCAAC
TGCCGCAGCAACAA---ACCCCGAACAGTGTCGCCAGTGGCGCCTCCTCG
AATCTCCAGCAGCAACAGCAG---------AATGCTGCAGTTGCTCCTGG
CCAGACGCAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
TTAGTTCTCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
CATATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
ACCAGCATTACGGC------TCCGGGTACTACGACCGCAAGCACATGTTC
GCCTACCCTTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
CAACTACCGCCCCGATCAGACCACCTCTGCCGCGGCGGCGGCGGCCTACA
TGAACGAGGCGGAGCGCCACGTGAGCGCCGCTGCTCGACAGTCCGTCGAG
GGCACATCGACGTCCAGCTATGAGCCGCCCACCTACTCCTCGCCAGGCGG
CCTGCGCGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
GATTGTCCGTGGGAGCGGTGGGTCCTTGCACGCCCAATCCCGGATTGCAC
GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCATACTCGAA
GTTCCAAACCCTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCGTATGTTT
CTAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
ACAGCGCCAGGCCAATCAGCAAAACAACAACAACAACTCGAGCAGCAACC
ACAACCACGCGCAGGCGACCCAGCAGCACCACAGCGGCCACCACCTGAAC
CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
-------------------------
>C3
ATGCAGCAGCACCACCTGCAGCAGCAGCAACAGCAGCAACAACAGCAGCA
GCAGCAGCAG---------GAGCAGCAGCATCTGCAGGAGCAGCAGCAGC
ATCTGCAGCAACTGCACCACCATGCGCACCACCACCTGCCTCAGCCTCTC
CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
GCAACAGCAACAGCAGCAGCAGCAACATGCAGTGGTCGCCTCCTCGCCCT
CCTCGGTGCTCCAGCAACAG------CAGTCAACTCCCACCACACATTCC
ACGCCCACGCATGCGGTCATGTACGAGGATCCTCCGCCTGTGCCACTTGT
CGCCGTGCAGCAGCAACACCTCCCCGCTCCGCAGCAACAGCAGCAG---C
AGCTCCAACAGCAGCAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
GGCGCCCTCAGTCCCGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
GCAACAGCAGCAGCAA------CATCTCACATCGCCCCACCACCAGCAAC
TGCCGCAGCAGCAACAAACCCCAAACAGCGTCGCCAGCGGCGCCTCCTCG
AATCTCCAGCAGCAGCAGCAGCAACAGCAGAATGCTGCAGTTGCTCCTGG
CCAGACGCAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
TTAGTTCGCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
CATATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
ACCAGCACTACGGT------TCCGGGTACTACGACCGCAAGCACATGTTC
GCCTACCCCTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
CAACTACCGCCCCGATCAGACCACCTCTGCCGCCGCGGCGGCGGCCTACA
TGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGCCCGCCAGTCCGTCGAG
GGCACATCGACGTCCAGCTACGAGCCGCCCACCTACTCCTCGCCGGGCGG
ACTGCGTGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
GATTGTCGGTGGGAGCGGTGGGCTCTTGCACGCCCAATCCCGGACTGCAC
GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCGTACTCGAA
GTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCGTATGTCT
CCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
ACAGCGCCAGGCCAATCAGCAGAACAACAACAATAACTCGAGCAGCAACC
ACAACCACGCGCAGGCGACCCAGCAGCACCACAGCGGCCACCACCTGAAC
CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
-------------------------
>C4
ATGCAGCAGCACCACCTGCAGCAGCAGCAACAGCAGCAGCAGCAGCAG--
-------------------GAGCAGCAGCATCTGCAGGAG---------C
ATCTGCAGCAACTGCATCTCCATGCGCACCACCACCTGCCTCAGCCTCTC
CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAGCAGCAGCA
GCAGCAGCAACAGCAGCAGCAGCAACATGCAGTCGTCGCCTCCTCGCCCT
CCTCCGTGCTCCAGCAGTCA------------ACTCCCACCACACATTCC
ACGCCCACGCATGCGGTCATGTACGAGGATCCTCCGCCTGTGCCACTTGT
CGCCGTGCAGCAGCAACACCTCCCCGCTCCGCAGCAACAGCAGCAG----
--CAGCTCCAACAGCAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
GGCGCCCTCAGTCCCGCCCAAACACCCACTGGACCCTCCGCCCAACAACA
GCAACAGCAGCAGCAGCAGCAACATCTCACATCCCCCCACCACCAGCAAC
TGCCGCAGCAGCAGCAAACCCCAAACAGTGTCGCCAGCGGCGCCTCCTCG
AATCTCCAGCAGCAGCAGCAACAGCAG---AATGCTGCAGTTGCTCCTGG
CCAGACGCAGATCGTGGCGCCGACCGCGGCGAGTGTTTCTCCCTCCAGCG
TTAGTTCTCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
CACATACCCGCCATCCGGGCCGGTCCGGGATTCGAGACGGACACCTCGGC
GGCGGTCAAGCGGCACACGGCACACTGGGCCTACAACGACGAGGGATTCA
ACCAGCACTACGGT------TCCGGGTACTACGACCGCAAGCACATGTTC
GCCTACCCCTACCCAGAAACGCAGTTTCCGGTTGGTCAGTACTGGGGCCC
CAACTACCGCCCCGACCAGACCACCTCTGCCGCGGCGGCGGCGGCCTACA
TGAACGAGGCGGAGCGCCACGTGAGCGCCGCCGCCCGACAGTCCGTCGAG
GGCACATCGACGTCCAGCTACGAGCCGCCCACCTACTCCTCGCCGGGCGG
ACTGCGGGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCTGGTG
GATTGTCGGTGGGAGCGGTGGGTTCTTGCACGCCCAATCCCGGACTGCAC
GAGTGGACCGGTCAGGTGTCCGTCCGGAAAAAGCGCAAGCCGTACTCGAA
GTTCCAGACCCTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCGTATGTTT
CCAAGCAAAAGCGCTGGGAATTGGCCAGAAATTTGCAGCTGACCGAGCGA
CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
CCAGCGCCAGGCCAATCAGCAGAACAACAACAACAACTCGAGCAGCAACC
ACAACCACGCGCAGGCGAACCAGCAGCACCACAGCGGCCACCACCTGAAC
CTTAGCCTGAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
-------------------------
>C5
ATGCAGCAGCACCACCTGCAACAGCAGCAGCAGCAGCAGCAGCAGCAG--
-------------------GAGCAGCAGCATCTGCAGGAGCAGCAA---C
ATCTGCAGCAACTGCATCACCATGCCCACCACCACCTGCCTCAGCCTCTG
CACACCACCAGCCATCACCACAGCGCGCATCCCCACCTGCAACAGCAGCA
ACAGCAACAACAGCAGCAGCAGCAACATGCAGTGGTCCCCTCCTCGCCCA
ACTCTCTGCTCCAGCAGCAGCAACAGCAGTCAACTCCCACCACACATTCC
ACGCCCACGCATGCGGTCATGTACGAGGATCCTCCGCCTGTGCCAATTGT
CGCCGTGCAGCAGCAACTTCTCCCCGCTCCGCAACAGCAGCAGCAA----
-----CTCCAGCAGCAGCAGCAACAACAGCTGGCGACAACACCGGTGGCC
GGCGCCCTCAGTCCCTCCCAAACACCCACTGGACCCTCCGCCCAGCAGCA
GCAGCAACAGCAACAGCAGCAACATCTCACATCGCCCCACCATCAGCAAC
TGCCGCAGCAGCAACAGACCCCGAATAGCGTTGCCAGTGGCGCCTCCGCG
AATCTCCAGCAGCAGCAACAGCAG------AATGCTGCAGTTGCTCCTGG
CCAGACACAGATCGTTGCGCCGACCACGGCGAGTGTTTCTCCCTCCAGTG
TTAGTTCTCAGAAGGAAGACATCAATATGTCCATCCAATTAGCGCCACTG
CACATACCAGCCATCCGGCCAGGCCCGGGATTCGAGACGGACACCTCGGC
GGCGGTCAAGCGGCACCCGGCACACTGGACCTACAACGATGACGGCTTCA
ACCAGTACCACGCCTCCGCGTCGGGGTACTACGACCGCAAGCACATGTTC
CCCTACCCCTATCCAGACACCCAGTTTCCGGTAAGTCAGTACTGGACCCA
AGGCTACCGCGCCGATCAGACCACCTCCGCCGCGGCGGCAGTGGCCTACA
TGAACGATGCCGAGCGCCACGTCAGCGCCGCGGCCCGCCAGTCCGTCGAG
GGCACATCGACGTCCAGCTACGAGCCACCTACTTACTCCTCGCCGGGCGG
ACTCCGCGGCTATCCCAGCGAGAACTACTCCAGCTCAGGAGCCTCCGGTG
GTTTGTCCGTGGGAGCGGTGGGTCCTTGCACGCCCAATCCCGGACTGCAC
GAGTGGACCGGCCAAGTGTCCGTCCGGAAAAAGCGGAAGCCGTACTCCAA
GTTCCAGACTTTGGAGCTGGAGAAGGAGTTCCTTTTCAATGCATATGTGT
CCAAGCAGAAGCGCTGGGAGCTGGCCAGGAATTTGCAGTTGACCGAGCGA
CAGGTCAAGATATGGTTCCAGAATCGGCGCATGAAGAACAAGAAGAACTC
GCAGCGCCAGGCCAATCAGCAGAACAACAACAACAACTCGAGCGGCAACC
ACAACCACTCGCAGGCGACCCAGCAGCACCACAGCAGCCACCACCTGAAC
CTTAGCCTAAACATGGGTCACCATGCCGCCAAGATGCACCAG--------
-------------------------
>C1
MQQHHLQQQQQQQQQQoooooooEQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQooooHAVVASSPSSVLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQooooooHLTSPHHQQLPQQQoTPNSVASGASS
NLQQQQQQQoNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGooSGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQ
>C2
MQQHHLQQQQQQQQQQQQQQQQQEQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQooooHAVVASSPSSVLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQLQQQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQooooHLTSPHHQQLPQQQoTPNSVASGASS
NLQQQQQoooNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGooSGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQ
>C3
MQQHHLQQQQQQQQQQQQQQoooEQQHLQEQQQHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQQooQSTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQoQLQQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQQQooHLTSPHHQQLPQQQQTPNSVASGASS
NLQQQQQQQQNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGooSGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQATQQHHSGHHLN
LSLNMGHHAAKMHQ
>C4
MQQHHLQQQQQQQQQQoooooooEQQHLQEoooHLQQLHLHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVASSPSSVLQQSooooTPTTHS
TPTHAVMYEDPPPVPLVAVQQQHLPAPQQQQQooQLQQQQQQQLATTPVA
GALSPAQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASS
NLQQQQQQQoNAAVAPGQTQIVAPTAASVSPSSVSSQKEDINMSIQLAPL
HIPAIRAGPGFETDTSAAVKRHTAHWAYNDEGFNQHYGooSGYYDRKHMF
AYPYPETQFPVGQYWGPNYRPDQTTSAAAAAAYMNEAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGSCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSSNHNHAQANQQHHSGHHLN
LSLNMGHHAAKMHQ
>C5
MQQHHLQQQQQQQQQQoooooooEQQHLQEQQoHLQQLHHHAHHHLPQPL
HTTSHHHSAHPHLQQQQQQQQQQQQHAVVPSSPNSLLQQQQQQSTPTTHS
TPTHAVMYEDPPPVPIVAVQQQLLPAPQQQQQoooLQQQQQQQLATTPVA
GALSPSQTPTGPSAQQQQQQQQQQHLTSPHHQQLPQQQQTPNSVASGASA
NLQQQQQQooNAAVAPGQTQIVAPTTASVSPSSVSSQKEDINMSIQLAPL
HIPAIRPGPGFETDTSAAVKRHPAHWTYNDDGFNQYHASASGYYDRKHMF
PYPYPDTQFPVSQYWTQGYRADQTTSAAAAVAYMNDAERHVSAAARQSVE
GTSTSSYEPPTYSSPGGLRGYPSENYSSSGASGGLSVGAVGPCTPNPGLH
EWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTER
QVKIWFQNRRMKNKKNSQRQANQQNNNNNSSGNHNHSQATQQHHSSHHLN
LSLNMGHHAAKMHQ


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1575 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1478888704
      Setting output file names to "/opt/ADOPS/2/Abd-B-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 923392208
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 3061225325
      Seed = 1908209732
      Swapseed = 1478888704
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 36 unique site patterns
      Division 2 has 29 unique site patterns
      Division 3 has 81 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3776.368129 -- -25.624409
         Chain 2 -- -3784.814658 -- -25.624409
         Chain 3 -- -3787.721351 -- -25.624409
         Chain 4 -- -3728.604086 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3778.904908 -- -25.624409
         Chain 2 -- -3791.034499 -- -25.624409
         Chain 3 -- -3791.034499 -- -25.624409
         Chain 4 -- -3784.814658 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3776.368] (-3784.815) (-3787.721) (-3728.604) * [-3778.905] (-3791.034) (-3791.034) (-3784.815) 
        500 -- [-3066.645] (-3103.737) (-3135.266) (-3145.189) * (-3081.560) (-3137.171) (-3071.144) [-3075.680] -- 0:00:00
       1000 -- (-3049.024) [-3051.135] (-3112.558) (-3060.129) * [-3052.686] (-3096.069) (-3054.863) (-3068.537) -- 0:00:00
       1500 -- [-3035.054] (-3035.965) (-3072.539) (-3056.202) * [-3044.296] (-3055.576) (-3046.348) (-3054.708) -- 0:00:00
       2000 -- [-3029.854] (-3042.514) (-3041.984) (-3039.099) * (-3030.928) [-3029.336] (-3039.357) (-3031.001) -- 0:00:00
       2500 -- [-3009.585] (-3026.082) (-3040.874) (-3024.734) * [-3018.082] (-3028.111) (-3035.870) (-3028.719) -- 0:00:00
       3000 -- (-3009.469) [-3012.396] (-3031.189) (-3030.622) * [-2999.890] (-3017.778) (-3029.683) (-3015.483) -- 0:05:32
       3500 -- [-3002.569] (-3011.218) (-3020.098) (-3036.172) * [-2996.349] (-3008.505) (-3031.093) (-3005.262) -- 0:04:44
       4000 -- (-3004.106) [-3004.899] (-3009.085) (-3031.524) * [-2995.575] (-3004.689) (-3017.792) (-2997.144) -- 0:04:09
       4500 -- (-3004.634) (-3002.904) [-2998.075] (-3021.645) * [-2994.370] (-3014.776) (-3005.067) (-2998.527) -- 0:03:41
       5000 -- (-3004.991) (-2995.126) [-2998.228] (-3018.196) * [-2992.572] (-2999.689) (-3007.943) (-2997.224) -- 0:03:19

      Average standard deviation of split frequencies: 0.039284

       5500 -- (-2994.797) [-2993.719] (-2993.082) (-3016.946) * (-2996.506) (-2996.036) (-3007.390) [-2994.812] -- 0:03:00
       6000 -- [-3000.160] (-2998.053) (-3004.073) (-2996.219) * (-2999.545) (-2989.785) [-2996.060] (-2997.371) -- 0:02:45
       6500 -- (-3000.342) (-3000.759) [-2990.954] (-2995.917) * (-2997.259) [-2988.323] (-2996.454) (-2999.447) -- 0:05:05
       7000 -- [-2992.487] (-2992.946) (-2989.979) (-2990.887) * (-3003.411) [-2994.619] (-3005.547) (-2998.703) -- 0:04:43
       7500 -- [-2995.192] (-3001.967) (-2992.760) (-2994.894) * (-3005.233) (-2994.378) (-3003.343) [-2994.465] -- 0:04:24
       8000 -- [-2990.264] (-2995.065) (-2999.831) (-2993.120) * (-2996.441) (-2998.367) (-3004.029) [-2993.547] -- 0:04:08
       8500 -- (-2990.212) (-2992.046) [-2994.193] (-2994.932) * (-2994.036) (-2998.099) (-2999.970) [-2992.974] -- 0:03:53
       9000 -- (-2993.638) (-2999.707) (-2999.175) [-2991.850] * (-3001.769) [-2993.810] (-3004.168) (-2990.592) -- 0:03:40
       9500 -- (-2993.268) (-2996.212) (-2993.816) [-2991.450] * (-2997.080) (-2994.176) [-3002.769] (-2992.967) -- 0:03:28
      10000 -- [-2993.441] (-2997.044) (-2991.301) (-2995.368) * (-2995.796) [-2992.303] (-2997.202) (-2994.217) -- 0:03:18

      Average standard deviation of split frequencies: 0.088388

      10500 -- (-2996.318) (-2994.452) [-2996.379] (-2995.083) * [-2992.649] (-2990.827) (-3001.695) (-2991.278) -- 0:04:42
      11000 -- (-2991.170) (-2994.491) (-2996.429) [-2993.618] * [-2995.172] (-2990.528) (-3014.383) (-3001.371) -- 0:04:29
      11500 -- (-2993.449) (-2990.363) [-2993.392] (-2996.927) * (-2993.559) [-2989.546] (-3007.005) (-2995.037) -- 0:04:17
      12000 -- (-2994.692) (-2991.696) [-2998.889] (-2992.458) * (-2999.981) [-2989.086] (-3000.324) (-2990.890) -- 0:04:07
      12500 -- (-2994.259) (-2994.948) (-2992.865) [-2989.584] * (-2992.452) (-2990.182) (-3000.113) [-2994.526] -- 0:03:57
      13000 -- (-2995.581) (-2991.381) (-2992.638) [-2988.261] * [-2992.573] (-2995.796) (-3004.202) (-2994.410) -- 0:03:47
      13500 -- (-3003.726) (-2991.328) (-2993.405) [-2992.587] * (-2999.372) [-2992.555] (-3001.143) (-2992.445) -- 0:03:39
      14000 -- (-2997.886) (-2994.971) [-2991.276] (-2992.103) * (-2998.487) (-2991.382) (-2993.717) [-2994.606] -- 0:04:41
      14500 -- [-2995.021] (-2992.404) (-2988.974) (-2995.666) * (-2996.456) (-2995.554) [-2997.083] (-2995.441) -- 0:04:31
      15000 -- (-2992.881) (-2990.552) [-2993.068] (-2995.971) * [-2991.917] (-3001.636) (-2988.668) (-3000.651) -- 0:04:22

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-2991.316) (-2993.824) [-2991.041] (-2995.031) * (-3000.421) (-2994.309) [-2988.767] (-2989.653) -- 0:04:14
      16000 -- (-2993.905) (-3000.103) (-2992.835) [-2992.910] * [-2996.037] (-2993.829) (-2991.145) (-2992.506) -- 0:04:06
      16500 -- (-2993.722) (-2994.597) (-2992.525) [-2995.419] * (-2994.266) (-2993.855) [-2992.165] (-2990.281) -- 0:03:58
      17000 -- (-2993.669) (-2995.166) [-2989.415] (-2992.776) * (-3002.184) (-2987.408) (-2991.830) [-2996.973] -- 0:03:51
      17500 -- (-2998.405) (-2986.345) [-2990.045] (-2993.745) * (-2999.717) (-2992.564) [-2996.272] (-3001.307) -- 0:04:40
      18000 -- (-2992.325) (-2991.275) [-2997.831] (-2994.867) * (-3003.017) [-2996.136] (-3000.003) (-3004.706) -- 0:04:32
      18500 -- [-2990.617] (-2992.540) (-2993.707) (-2998.576) * (-3004.766) (-2997.019) [-3004.630] (-2998.671) -- 0:04:25
      19000 -- (-2987.238) [-2996.818] (-2995.941) (-2999.019) * (-2994.970) (-2989.254) (-2990.141) [-2991.791] -- 0:04:18
      19500 -- [-2987.742] (-3002.680) (-2994.141) (-2997.403) * (-2996.168) (-2993.540) [-2993.774] (-2993.017) -- 0:04:11
      20000 -- [-2987.083] (-2997.577) (-2990.848) (-2993.041) * (-2990.463) (-3002.817) (-2989.787) [-2992.843] -- 0:04:05

      Average standard deviation of split frequencies: 0.045620

      20500 -- [-2993.739] (-2992.207) (-2993.007) (-2993.198) * [-2991.959] (-2996.795) (-2992.355) (-2993.471) -- 0:03:58
      21000 -- (-2989.142) (-2993.170) (-2998.723) [-2996.143] * (-2996.618) (-2991.206) [-2991.571] (-2997.605) -- 0:03:53
      21500 -- [-2987.728] (-2991.855) (-2994.628) (-2992.800) * [-2994.004] (-2996.981) (-3002.795) (-2996.530) -- 0:04:33
      22000 -- (-2997.221) [-2993.441] (-2991.380) (-2993.786) * (-2995.581) (-2993.806) [-2992.819] (-3001.311) -- 0:04:26
      22500 -- (-2993.831) (-2995.480) [-2997.842] (-2998.462) * (-2998.576) (-2994.651) [-2994.864] (-2993.428) -- 0:04:20
      23000 -- (-2991.689) [-2998.562] (-2995.238) (-2992.327) * (-2997.500) [-2987.327] (-2993.410) (-2989.982) -- 0:04:14
      23500 -- (-2993.182) (-2993.252) [-2991.055] (-2990.659) * (-2990.521) [-2993.100] (-2996.079) (-2996.006) -- 0:04:09
      24000 -- (-2986.991) (-3000.109) (-2993.207) [-2992.527] * (-2991.288) (-2990.604) (-2996.350) [-2988.304] -- 0:04:04
      24500 -- (-2993.402) (-2992.568) [-2993.777] (-2995.226) * (-2992.605) (-2992.939) [-2993.025] (-2989.821) -- 0:03:58
      25000 -- (-2993.242) [-2992.703] (-2993.724) (-2990.654) * (-2994.759) (-2990.854) (-2989.379) [-2989.662] -- 0:04:33

      Average standard deviation of split frequencies: 0.027196

      25500 -- (-3000.727) (-2992.998) [-2990.876] (-2994.416) * (-2995.388) [-2989.892] (-2998.061) (-2995.591) -- 0:04:27
      26000 -- (-2998.934) (-2997.010) [-2988.405] (-2994.872) * (-2995.372) [-2993.960] (-2990.880) (-2993.310) -- 0:04:22
      26500 -- (-2993.850) (-2996.590) (-2993.084) [-2993.413] * (-2994.334) (-2992.339) [-2992.944] (-2992.903) -- 0:04:17
      27000 -- [-2990.082] (-2998.092) (-3000.775) (-2994.874) * (-2998.248) [-2993.774] (-2992.455) (-2993.105) -- 0:04:12
      27500 -- (-2992.176) (-2998.261) [-2994.448] (-2996.032) * (-2996.159) (-2995.599) [-2988.164] (-2997.336) -- 0:04:07
      28000 -- (-2998.428) [-2996.916] (-2994.411) (-2995.943) * (-3000.297) (-2995.545) [-2990.815] (-2994.716) -- 0:04:03
      28500 -- (-3004.952) (-2999.523) [-2993.016] (-2994.530) * [-2992.087] (-2998.611) (-2991.016) (-2994.202) -- 0:04:32
      29000 -- [-2999.008] (-2996.165) (-2990.250) (-2997.694) * (-2989.147) (-2995.759) (-2998.577) [-2990.981] -- 0:04:27
      29500 -- (-2995.319) [-2992.590] (-2990.705) (-3001.962) * [-2996.207] (-2995.462) (-2994.061) (-2994.359) -- 0:04:23
      30000 -- [-2988.966] (-2995.514) (-2995.988) (-2997.698) * [-2994.116] (-2998.353) (-2996.150) (-2995.622) -- 0:04:18

      Average standard deviation of split frequencies: 0.046116

      30500 -- [-2997.366] (-2998.008) (-2991.994) (-3000.656) * (-2990.696) [-2994.616] (-2992.353) (-2994.668) -- 0:04:14
      31000 -- (-2989.266) (-2997.818) [-2989.855] (-2989.748) * (-2990.459) (-2996.907) [-2994.703] (-2997.976) -- 0:04:10
      31500 -- [-2993.891] (-2990.747) (-2994.366) (-2995.762) * [-2990.036] (-2995.424) (-2991.194) (-2997.418) -- 0:04:05
      32000 -- (-2995.712) (-2996.514) [-2989.474] (-2995.653) * (-2988.933) (-2997.798) (-2996.279) [-2993.125] -- 0:04:02
      32500 -- (-2992.509) (-2991.554) [-2994.857] (-2995.744) * (-2990.622) [-2990.750] (-2991.533) (-2993.037) -- 0:04:27
      33000 -- (-2992.556) [-2990.247] (-2989.903) (-2994.954) * [-2996.324] (-2996.651) (-2997.561) (-2995.549) -- 0:04:23
      33500 -- [-2992.633] (-2999.176) (-2997.298) (-2993.391) * [-2994.231] (-3003.603) (-2996.478) (-2994.109) -- 0:04:19
      34000 -- (-2990.003) (-2998.328) [-2993.411] (-2996.634) * (-2992.730) (-2995.668) [-2999.052] (-2999.824) -- 0:04:15
      34500 -- (-2992.834) [-2994.692] (-2990.533) (-2995.563) * (-2999.948) (-3003.605) [-2998.389] (-2999.587) -- 0:04:11
      35000 -- [-2991.856] (-2990.328) (-2992.140) (-2997.971) * (-2992.742) (-2999.504) (-2995.506) [-2997.137] -- 0:04:08

      Average standard deviation of split frequencies: 0.052378

      35500 -- (-2990.752) [-2990.340] (-2993.237) (-2995.691) * [-2990.250] (-2995.708) (-2997.567) (-2996.210) -- 0:04:04
      36000 -- (-2994.221) [-2991.009] (-2994.502) (-2992.673) * [-2992.654] (-2997.591) (-2993.534) (-2994.803) -- 0:04:27
      36500 -- (-2990.077) (-2991.036) (-2994.583) [-2988.451] * [-2992.282] (-2996.303) (-2996.341) (-2998.045) -- 0:04:23
      37000 -- (-3002.273) (-2990.946) (-2991.936) [-2988.217] * (-2994.961) [-3000.930] (-2996.250) (-2997.218) -- 0:04:20
      37500 -- (-2996.267) [-2989.739] (-2992.378) (-2992.759) * (-2991.650) [-2996.022] (-2999.063) (-2995.895) -- 0:04:16
      38000 -- (-2997.675) (-2994.088) [-2992.158] (-2993.631) * (-2999.405) (-3002.828) (-2995.527) [-2999.506] -- 0:04:13
      38500 -- (-3002.196) [-2994.486] (-3007.251) (-2994.111) * (-2990.712) (-3005.944) [-2994.168] (-2994.794) -- 0:04:09
      39000 -- (-2994.573) (-2991.667) (-2993.439) [-2994.266] * [-2988.091] (-2994.828) (-2997.822) (-2996.720) -- 0:04:06
      39500 -- (-2992.006) [-2995.349] (-2996.631) (-2999.464) * (-2992.835) (-2996.156) [-2997.112] (-3001.104) -- 0:04:27
      40000 -- (-2988.073) (-3000.859) (-2991.619) [-2990.199] * [-3000.271] (-2994.232) (-2999.424) (-3002.079) -- 0:04:24

      Average standard deviation of split frequencies: 0.057960

      40500 -- (-2988.350) (-2997.356) [-2990.018] (-2995.182) * (-2996.659) (-2996.920) [-2992.509] (-3004.769) -- 0:04:20
      41000 -- (-2994.244) (-2992.463) [-2989.588] (-3001.305) * (-2991.094) [-2989.735] (-2999.175) (-2992.202) -- 0:04:17
      41500 -- (-2998.546) (-2995.823) (-2999.592) [-2990.859] * [-2992.434] (-2997.828) (-2995.507) (-2993.237) -- 0:04:14
      42000 -- (-2998.772) (-2991.656) (-2994.352) [-2994.345] * (-2995.108) (-2997.406) (-2995.708) [-2990.368] -- 0:04:10
      42500 -- (-2995.622) [-2993.867] (-2996.817) (-3002.657) * (-2989.622) (-2993.887) [-2999.572] (-2994.101) -- 0:04:07
      43000 -- (-2995.119) [-2988.837] (-2997.147) (-2997.003) * (-2988.183) [-2988.584] (-2998.870) (-2991.248) -- 0:04:04
      43500 -- (-2989.741) [-2991.946] (-2995.259) (-2992.437) * (-2991.015) [-2991.104] (-2995.033) (-2994.107) -- 0:04:23
      44000 -- (-2994.895) (-2990.540) [-2988.616] (-2993.387) * [-2992.498] (-2995.027) (-2999.627) (-2990.088) -- 0:04:20
      44500 -- (-2996.849) (-2991.901) (-2991.454) [-2992.936] * (-2993.220) [-2998.376] (-2998.472) (-2998.884) -- 0:04:17
      45000 -- (-3002.320) (-2994.061) [-2994.188] (-2989.946) * [-2990.330] (-2997.195) (-3000.163) (-2993.928) -- 0:04:14

      Average standard deviation of split frequencies: 0.046116

      45500 -- (-2993.197) (-2993.009) [-2993.921] (-2995.799) * (-2993.177) (-2995.929) (-2994.534) [-2992.577] -- 0:04:11
      46000 -- (-2992.206) (-2992.493) [-2990.578] (-2995.413) * (-2994.868) [-2994.921] (-2991.885) (-2994.416) -- 0:04:08
      46500 -- [-3000.174] (-2994.196) (-2988.899) (-2989.103) * (-2996.698) (-2989.839) (-2990.912) [-2989.420] -- 0:04:06
      47000 -- (-2997.722) (-2997.241) [-2988.563] (-2993.503) * (-2997.746) (-3007.892) (-2993.205) [-2991.064] -- 0:04:23
      47500 -- [-2992.848] (-2994.655) (-2989.023) (-2995.210) * [-2994.760] (-2995.474) (-2993.885) (-2994.989) -- 0:04:20
      48000 -- (-2991.492) (-2997.289) [-2992.676] (-2998.344) * [-2993.830] (-2993.032) (-2994.870) (-2988.093) -- 0:04:17
      48500 -- (-2993.537) (-3005.995) (-3001.241) [-2991.380] * (-3000.773) (-2991.465) [-2990.170] (-2990.572) -- 0:04:15
      49000 -- (-2994.955) [-2994.469] (-2997.139) (-2996.314) * (-2993.293) (-2995.458) (-2997.001) [-2993.386] -- 0:04:12
      49500 -- (-2994.743) (-2995.018) (-2992.076) [-2987.864] * [-2994.021] (-2992.108) (-2993.519) (-2993.272) -- 0:04:09
      50000 -- (-2993.734) [-2990.053] (-2994.995) (-2991.508) * (-2993.473) [-2990.767] (-2998.986) (-2988.116) -- 0:04:06

      Average standard deviation of split frequencies: 0.046520

      50500 -- (-2997.317) (-2990.140) [-2995.305] (-2991.677) * (-2999.616) (-2993.365) [-2991.692] (-2988.028) -- 0:04:23
      51000 -- [-2990.410] (-2991.977) (-2991.756) (-2992.432) * (-2995.638) (-2993.287) (-2992.883) [-2999.131] -- 0:04:20
      51500 -- [-2992.595] (-2996.421) (-2995.291) (-3001.851) * (-2993.137) (-2998.521) (-2992.002) [-2993.574] -- 0:04:17
      52000 -- (-2992.380) (-3001.317) [-2996.311] (-3001.518) * (-2998.504) (-2993.166) [-2991.287] (-3001.037) -- 0:04:15
      52500 -- (-2992.637) [-2991.840] (-3003.001) (-2994.381) * (-2991.667) [-2995.547] (-2999.490) (-2997.947) -- 0:04:12
      53000 -- [-2993.772] (-2996.209) (-2997.806) (-2992.861) * (-2994.182) (-2995.607) [-2990.759] (-2995.770) -- 0:04:10
      53500 -- (-2995.995) [-2991.591] (-2995.687) (-2995.244) * (-2995.560) (-2995.794) (-2990.089) [-2989.079] -- 0:04:07
      54000 -- (-2994.459) [-2994.964] (-2991.432) (-2996.844) * (-2992.007) (-2989.561) [-2992.668] (-2993.558) -- 0:04:22
      54500 -- (-2998.193) (-2996.282) [-2996.954] (-2996.672) * [-2992.386] (-2988.791) (-2997.495) (-2998.602) -- 0:04:20
      55000 -- (-2991.515) [-2991.567] (-2994.915) (-2991.456) * [-2992.499] (-2991.090) (-2994.450) (-2990.660) -- 0:04:17

      Average standard deviation of split frequencies: 0.042090

      55500 -- [-2994.678] (-2995.236) (-2992.241) (-2999.277) * (-2988.330) (-2992.516) (-2993.194) [-2993.259] -- 0:04:15
      56000 -- (-2998.293) (-2993.768) [-2988.843] (-2994.546) * [-2994.804] (-2997.974) (-2995.083) (-2998.054) -- 0:04:12
      56500 -- (-2990.367) (-2991.621) [-2990.364] (-2991.257) * (-2996.657) (-3000.640) [-2994.379] (-2989.695) -- 0:04:10
      57000 -- (-2992.098) (-2994.071) [-2992.237] (-2995.669) * (-2992.500) (-2994.247) [-2994.072] (-2997.315) -- 0:04:08
      57500 -- (-3000.115) (-2989.115) [-2996.662] (-2990.669) * (-2996.024) [-3001.673] (-2990.564) (-2996.733) -- 0:04:05
      58000 -- [-2992.324] (-2991.266) (-2997.351) (-2990.823) * (-2989.230) (-2992.238) [-2990.611] (-2997.564) -- 0:04:19
      58500 -- (-2994.027) [-2992.303] (-2993.980) (-2992.452) * (-2989.878) (-2996.795) (-2990.938) [-2990.762] -- 0:04:17
      59000 -- [-2995.151] (-2994.192) (-2997.228) (-3003.680) * (-2994.760) [-2988.169] (-2996.094) (-2996.410) -- 0:04:15
      59500 -- (-2992.285) (-2989.654) (-2998.203) [-2994.837] * (-2993.531) [-2997.257] (-2997.305) (-2999.085) -- 0:04:12
      60000 -- (-2999.808) [-2992.010] (-2997.329) (-2992.171) * (-2993.793) (-2995.081) (-2995.036) [-2990.107] -- 0:04:10

      Average standard deviation of split frequencies: 0.042737

      60500 -- (-2995.596) [-2993.694] (-2991.466) (-2996.000) * (-2996.310) (-2989.268) [-2996.216] (-2994.144) -- 0:04:08
      61000 -- (-2996.804) [-2991.391] (-2994.911) (-2994.506) * (-3002.933) (-2993.482) [-2995.431] (-2992.316) -- 0:04:06
      61500 -- (-2994.318) [-2992.915] (-2992.953) (-2988.100) * (-2999.853) (-2993.692) (-3001.245) [-2997.758] -- 0:04:19
      62000 -- [-2993.105] (-3001.512) (-2997.125) (-2987.944) * (-2996.486) (-2990.891) [-3001.709] (-2992.754) -- 0:04:17
      62500 -- [-2987.938] (-2998.980) (-2993.802) (-2993.415) * (-2995.494) (-2995.926) [-2993.605] (-3000.340) -- 0:04:15
      63000 -- (-2999.288) (-2996.162) [-2989.348] (-2996.077) * (-2994.989) (-2991.677) [-2996.135] (-2997.109) -- 0:04:12
      63500 -- [-2990.068] (-2992.870) (-2997.053) (-2993.307) * (-3002.295) (-2991.041) [-2992.843] (-2991.842) -- 0:04:10
      64000 -- (-2994.270) [-2995.009] (-2994.466) (-2992.026) * [-2999.105] (-3000.090) (-2994.370) (-2998.273) -- 0:04:08
      64500 -- (-2989.410) [-2992.681] (-2993.244) (-2993.400) * (-3008.263) (-2996.418) [-2991.338] (-3006.651) -- 0:04:06
      65000 -- (-2993.836) (-2997.900) (-2994.704) [-2992.939] * (-3000.100) (-2993.524) (-2996.123) [-2989.806] -- 0:04:18

      Average standard deviation of split frequencies: 0.041069

      65500 -- (-2996.967) (-2994.098) [-2995.592] (-2988.542) * (-3003.104) (-2999.870) [-2997.149] (-3000.492) -- 0:04:16
      66000 -- (-2988.821) [-3000.352] (-2999.431) (-3001.996) * (-2992.822) (-2995.863) [-2989.241] (-3003.922) -- 0:04:14
      66500 -- (-2993.472) (-2992.923) [-2992.788] (-2990.265) * [-2995.469] (-2994.503) (-2995.392) (-2991.243) -- 0:04:12
      67000 -- (-2997.154) (-2988.708) [-2992.487] (-2991.411) * (-2994.956) [-2993.974] (-2995.412) (-2988.254) -- 0:04:10
      67500 -- (-2998.002) [-2995.652] (-2993.491) (-2989.855) * (-2995.027) [-2991.823] (-2989.312) (-2989.278) -- 0:04:08
      68000 -- (-3001.363) (-2994.122) [-2989.456] (-2991.798) * (-2996.344) (-2990.718) (-3005.533) [-2991.329] -- 0:04:06
      68500 -- (-3002.844) (-2996.839) (-2997.410) [-2996.333] * (-2999.960) [-2995.783] (-2994.052) (-2990.631) -- 0:04:04
      69000 -- (-2999.463) [-2995.349] (-2997.932) (-2999.377) * [-2993.183] (-2997.224) (-2996.769) (-2994.598) -- 0:04:16
      69500 -- (-2996.206) (-2989.056) [-2996.836] (-2993.422) * (-2990.479) (-2998.702) (-2994.272) [-2995.371] -- 0:04:14
      70000 -- (-2991.345) (-2997.038) (-2997.518) [-2992.988] * (-2995.883) (-2989.063) (-2990.301) [-2991.014] -- 0:04:12

      Average standard deviation of split frequencies: 0.041693

      70500 -- (-2992.405) (-2992.180) (-3000.405) [-2992.329] * (-2999.743) (-2995.945) (-2997.503) [-2989.642] -- 0:04:10
      71000 -- (-2991.277) (-3003.133) (-2992.088) [-2994.594] * [-2995.843] (-2995.152) (-2991.092) (-2994.393) -- 0:04:08
      71500 -- (-2994.856) (-2996.020) (-2990.013) [-2993.726] * (-2996.576) [-2994.134] (-2988.763) (-2999.273) -- 0:04:06
      72000 -- [-2995.601] (-2997.316) (-2991.187) (-2993.536) * (-2992.780) (-2992.304) (-2992.673) [-2999.074] -- 0:04:04
      72500 -- [-2993.463] (-2989.867) (-2991.847) (-2991.256) * (-2997.165) [-2988.843] (-2993.319) (-2998.976) -- 0:04:15
      73000 -- (-2996.475) (-2992.735) [-2990.251] (-2994.376) * [-2991.478] (-2992.994) (-2994.656) (-2991.525) -- 0:04:13
      73500 -- (-2997.583) (-2993.904) (-2997.781) [-2996.032] * (-2988.933) [-2989.780] (-3001.931) (-2996.358) -- 0:04:12
      74000 -- (-2995.282) [-2995.401] (-2992.539) (-2991.984) * [-2994.344] (-2994.340) (-2994.502) (-3002.796) -- 0:04:10
      74500 -- (-3002.476) (-2988.572) [-2990.770] (-2991.190) * [-2996.554] (-2996.658) (-2994.403) (-2995.857) -- 0:04:08
      75000 -- [-3000.595] (-2995.743) (-2997.261) (-2992.641) * (-2995.893) (-2995.802) (-2992.661) [-2990.831] -- 0:04:06

      Average standard deviation of split frequencies: 0.054274

      75500 -- (-2996.503) [-2989.867] (-3002.928) (-2990.651) * [-2991.862] (-2993.979) (-2995.467) (-2996.562) -- 0:04:04
      76000 -- (-3004.678) (-2996.484) (-2996.770) [-2989.683] * (-2989.078) (-2989.727) [-2994.076] (-2989.817) -- 0:04:15
      76500 -- (-2996.417) [-2992.206] (-2995.945) (-2989.977) * (-2996.313) (-2989.943) [-2995.930] (-2996.218) -- 0:04:13
      77000 -- (-2996.694) (-2993.335) (-2993.242) [-3000.212] * (-2996.581) (-2989.357) (-2996.582) [-2988.551] -- 0:04:11
      77500 -- (-2996.339) (-2993.985) (-2997.066) [-2989.363] * [-3000.085] (-2993.378) (-2998.990) (-2992.733) -- 0:04:09
      78000 -- [-2994.597] (-2997.096) (-2996.622) (-2991.097) * (-3001.603) (-2996.353) [-2989.587] (-2989.363) -- 0:04:08
      78500 -- [-2988.425] (-2991.512) (-2992.918) (-3003.361) * [-2992.774] (-2994.035) (-3001.098) (-2996.355) -- 0:04:06
      79000 -- (-2992.609) [-2995.337] (-2996.556) (-2996.180) * (-2998.039) (-2995.886) (-2995.846) [-2990.195] -- 0:04:04
      79500 -- (-2995.501) (-2999.733) (-2992.686) [-2990.635] * (-3003.703) (-2988.989) (-2997.407) [-2994.387] -- 0:04:03
      80000 -- (-2994.631) (-2996.653) [-2993.349] (-2992.318) * (-3000.797) [-2992.113] (-3000.541) (-2986.854) -- 0:04:13

      Average standard deviation of split frequencies: 0.054056

      80500 -- (-2995.762) [-2991.996] (-2993.522) (-2990.033) * (-2994.561) (-2992.872) [-2997.617] (-2991.578) -- 0:04:11
      81000 -- (-2994.974) [-2994.805] (-2995.789) (-2993.378) * (-2994.764) [-2998.947] (-2991.212) (-2997.151) -- 0:04:09
      81500 -- (-2993.740) [-2994.063] (-3005.666) (-2995.054) * [-2995.217] (-2995.776) (-2997.054) (-3001.855) -- 0:04:07
      82000 -- (-2993.275) (-2988.168) (-2999.719) [-2998.112] * (-2998.052) [-2995.369] (-2996.342) (-2992.367) -- 0:04:06
      82500 -- (-2997.849) (-3001.952) (-3006.141) [-2995.206] * (-3004.701) (-2992.546) [-2993.846] (-2992.777) -- 0:04:04
      83000 -- (-2997.961) (-2995.454) [-2998.063] (-2997.132) * (-2990.926) (-2989.370) [-2994.140] (-2991.760) -- 0:04:03
      83500 -- (-2994.593) (-2994.662) (-2996.838) [-2995.195] * [-2993.002] (-2995.886) (-2991.057) (-2995.125) -- 0:04:12
      84000 -- [-2994.782] (-2991.584) (-2996.792) (-2992.736) * (-2996.238) (-2992.581) (-2994.133) [-2993.914] -- 0:04:10
      84500 -- (-2998.061) [-2989.599] (-2992.657) (-2994.095) * [-2995.870] (-2991.180) (-2992.956) (-2993.613) -- 0:04:09
      85000 -- [-2997.095] (-2986.291) (-2991.999) (-2994.169) * (-2992.289) (-2994.318) [-2989.815] (-2998.886) -- 0:04:07

      Average standard deviation of split frequencies: 0.061666

      85500 -- (-2994.644) [-2994.123] (-2991.256) (-2993.347) * (-2996.383) [-2989.879] (-2996.619) (-2997.079) -- 0:04:06
      86000 -- (-2999.733) (-2996.315) (-2996.753) [-2995.304] * (-2993.792) (-2991.913) [-2994.326] (-3000.384) -- 0:04:04
      86500 -- (-2995.757) [-2999.929] (-2996.058) (-2992.539) * (-2995.970) (-2997.740) (-2986.325) [-2997.490] -- 0:04:02
      87000 -- (-2990.844) (-2993.300) [-2996.778] (-2997.615) * (-2992.527) (-2992.430) [-2988.534] (-2988.861) -- 0:04:11
      87500 -- [-2994.517] (-2997.367) (-2997.228) (-2996.228) * (-2993.036) (-2997.182) [-2994.582] (-2987.919) -- 0:04:10
      88000 -- (-2997.694) [-2990.778] (-2999.317) (-2997.356) * [-2992.825] (-2995.484) (-2987.166) (-2996.990) -- 0:04:08
      88500 -- (-2997.547) (-2995.819) (-2990.329) [-2994.383] * [-2994.558] (-2996.476) (-2994.244) (-2988.668) -- 0:04:07
      89000 -- (-2996.135) [-2994.655] (-2995.934) (-2999.378) * (-2997.386) (-2997.882) [-2991.220] (-2990.566) -- 0:04:05
      89500 -- [-3004.324] (-2994.798) (-2994.090) (-2996.642) * [-2996.506] (-2990.933) (-2989.529) (-2990.037) -- 0:04:04
      90000 -- (-2997.855) [-2994.259] (-2996.652) (-3003.611) * (-2988.032) (-2990.608) [-2993.684] (-2997.968) -- 0:04:02

      Average standard deviation of split frequencies: 0.045494

      90500 -- (-2993.133) (-2992.355) [-2998.007] (-2995.785) * (-2994.711) [-2992.895] (-2988.187) (-2995.152) -- 0:04:01
      91000 -- (-2995.995) (-2996.611) [-2990.937] (-3002.269) * [-2991.589] (-2995.432) (-2992.973) (-2993.584) -- 0:04:09
      91500 -- (-2996.590) (-2990.838) (-2999.217) [-2998.919] * (-2990.789) (-2989.804) [-2990.597] (-2988.005) -- 0:04:08
      92000 -- (-2998.784) (-2993.091) (-3002.150) [-2993.080] * (-2990.626) (-2992.486) [-2991.595] (-2994.280) -- 0:04:06
      92500 -- (-2991.485) [-2993.225] (-3004.030) (-2993.852) * (-2994.029) [-2991.578] (-2994.466) (-2995.684) -- 0:04:05
      93000 -- [-2992.100] (-2992.388) (-3001.974) (-2994.210) * (-2989.844) (-2996.709) [-2993.494] (-2994.172) -- 0:04:03
      93500 -- (-2990.496) (-2996.970) (-3002.094) [-2991.290] * (-2991.106) [-2994.177] (-3001.882) (-2995.153) -- 0:04:02
      94000 -- (-2989.193) [-2990.989] (-2998.066) (-2992.428) * [-2990.739] (-2993.507) (-2992.471) (-2994.099) -- 0:04:00
      94500 -- (-2992.753) (-2995.995) [-2992.808] (-2991.233) * (-2990.973) [-2996.488] (-3001.954) (-2992.193) -- 0:04:09
      95000 -- (-2991.660) (-2994.263) (-2993.618) [-2992.429] * [-2990.642] (-2994.700) (-2990.849) (-3000.124) -- 0:04:07

      Average standard deviation of split frequencies: 0.038056

      95500 -- (-2993.285) [-2998.863] (-2988.062) (-2989.997) * [-2991.314] (-2996.042) (-2999.346) (-2994.985) -- 0:04:06
      96000 -- (-2989.105) (-2994.299) (-2995.632) [-2989.785] * (-2997.809) [-2996.417] (-2993.915) (-2990.768) -- 0:04:04
      96500 -- [-2994.448] (-2997.268) (-2993.665) (-2997.712) * (-2996.319) (-2991.108) [-2993.140] (-2987.741) -- 0:04:03
      97000 -- (-2992.275) (-2990.974) [-2990.756] (-2992.601) * (-2996.638) (-2993.474) (-2989.329) [-2989.966] -- 0:04:02
      97500 -- (-2994.333) (-2990.246) (-2993.488) [-2992.809] * (-3001.346) (-3002.464) [-2990.316] (-2991.799) -- 0:04:00
      98000 -- (-2990.272) (-2991.808) [-2994.698] (-2990.586) * (-2988.896) (-2999.545) [-2993.132] (-2992.074) -- 0:03:59
      98500 -- (-2987.367) (-2991.608) (-2999.187) [-2995.166] * (-2997.386) (-3006.495) [-2992.296] (-2988.875) -- 0:04:07
      99000 -- [-2988.056] (-2997.225) (-2992.848) (-2994.501) * (-2999.103) [-3003.414] (-2989.665) (-2995.337) -- 0:04:05
      99500 -- [-2988.811] (-2996.174) (-2994.189) (-2993.688) * [-2991.632] (-2993.086) (-2992.441) (-2994.455) -- 0:04:04
      100000 -- [-2988.890] (-2990.685) (-2995.095) (-3000.999) * (-2996.405) [-2997.819] (-2991.900) (-2991.258) -- 0:04:03

      Average standard deviation of split frequencies: 0.036292

      100500 -- [-2994.682] (-3003.042) (-2991.963) (-2989.824) * (-2990.729) [-2999.879] (-2993.370) (-2989.988) -- 0:04:01
      101000 -- (-2995.569) (-2995.008) (-2996.182) [-2991.008] * (-3002.692) (-2999.778) (-2990.722) [-2993.340] -- 0:04:00
      101500 -- (-2991.534) (-2998.770) (-2996.409) [-2992.291] * (-2997.839) (-2991.508) (-2987.771) [-2989.205] -- 0:03:59
      102000 -- [-2994.297] (-2997.204) (-2992.917) (-2994.638) * [-2992.074] (-2990.622) (-2992.408) (-2992.765) -- 0:04:06
      102500 -- (-2990.950) [-2994.507] (-2995.084) (-2994.513) * [-2996.410] (-2989.897) (-2993.916) (-2996.002) -- 0:04:05
      103000 -- [-2990.267] (-3004.954) (-2995.602) (-2992.520) * (-2999.822) [-2994.663] (-2996.829) (-2991.598) -- 0:04:03
      103500 -- [-2996.134] (-2990.830) (-2995.813) (-2994.803) * (-2990.317) [-2997.239] (-2989.583) (-2988.936) -- 0:04:02
      104000 -- (-3003.071) [-2992.411] (-2993.080) (-2994.037) * (-2990.759) [-2993.383] (-2995.433) (-2994.015) -- 0:04:01
      104500 -- (-3001.619) (-2997.432) [-2991.541] (-2992.793) * (-2990.340) (-2993.003) [-2991.929] (-2992.547) -- 0:03:59
      105000 -- (-2999.039) (-2996.831) [-2996.550] (-2992.063) * (-2994.766) [-3005.087] (-2992.565) (-2991.756) -- 0:03:58

      Average standard deviation of split frequencies: 0.043360

      105500 -- [-2996.800] (-2994.692) (-2991.556) (-2991.094) * (-2999.814) [-2998.638] (-2998.580) (-3000.860) -- 0:03:57
      106000 -- (-2997.410) [-2990.641] (-2994.330) (-2992.576) * (-2993.089) [-2990.943] (-2990.849) (-3000.899) -- 0:04:04
      106500 -- [-2995.884] (-2989.673) (-2995.086) (-2989.652) * (-2992.696) [-2995.407] (-2997.750) (-2997.753) -- 0:04:03
      107000 -- (-2992.530) (-2990.836) [-2992.034] (-2988.718) * (-2995.378) (-2989.746) [-2995.524] (-3002.157) -- 0:04:02
      107500 -- (-2994.077) (-2996.561) [-2993.269] (-2990.577) * (-2993.795) (-2997.243) [-3000.477] (-2994.764) -- 0:04:00
      108000 -- (-2996.375) (-2996.598) (-2999.259) [-2990.770] * [-2996.965] (-2996.941) (-3007.955) (-2991.058) -- 0:03:59
      108500 -- (-3002.383) [-2989.544] (-2992.045) (-3002.844) * [-2995.001] (-2999.209) (-2995.950) (-2989.040) -- 0:03:58
      109000 -- (-3000.540) [-2990.334] (-2990.530) (-2993.217) * (-2995.601) [-2992.816] (-2995.159) (-3009.813) -- 0:03:57
      109500 -- (-2991.150) (-2993.741) [-2996.228] (-2991.808) * [-3000.487] (-2991.437) (-2994.763) (-2999.950) -- 0:04:03
      110000 -- (-2991.550) [-2991.256] (-2991.497) (-2991.463) * (-2988.223) [-2992.580] (-2998.537) (-2996.850) -- 0:04:02

      Average standard deviation of split frequencies: 0.028753

      110500 -- (-2992.208) (-2992.207) (-2996.931) [-2989.453] * (-2994.059) (-2998.553) (-2996.580) [-2989.803] -- 0:04:01
      111000 -- (-2993.566) [-2993.072] (-2994.270) (-2995.267) * (-2992.405) (-3002.041) [-2991.412] (-2997.043) -- 0:04:00
      111500 -- (-2997.383) [-2990.876] (-2994.570) (-2993.391) * [-2991.315] (-2995.963) (-2994.900) (-2994.338) -- 0:03:59
      112000 -- (-2997.036) (-2991.782) [-2986.863] (-2995.673) * (-2994.145) (-3004.490) [-2994.446] (-2995.819) -- 0:03:57
      112500 -- (-2994.688) (-2990.335) [-2994.673] (-3000.672) * (-2994.078) (-2993.965) (-2993.459) [-2998.288] -- 0:03:56
      113000 -- (-2994.911) [-2991.681] (-2994.833) (-3000.214) * (-3003.633) (-2994.619) (-2994.562) [-2998.088] -- 0:03:55
      113500 -- (-2993.010) (-2990.013) (-2990.429) [-2991.658] * (-3001.551) (-3000.032) [-2989.645] (-2997.364) -- 0:04:02
      114000 -- [-2997.918] (-2994.778) (-2990.384) (-2993.156) * (-2995.092) [-2992.408] (-2993.948) (-2994.832) -- 0:04:00
      114500 -- (-2992.568) (-2997.058) [-2993.247] (-3001.443) * (-2989.709) (-2989.879) [-2988.107] (-2992.117) -- 0:03:59
      115000 -- [-2993.427] (-2998.356) (-2992.905) (-2996.763) * (-2985.897) (-2987.766) [-2987.228] (-2993.158) -- 0:03:58

      Average standard deviation of split frequencies: 0.027431

      115500 -- (-3000.201) [-2995.770] (-2993.771) (-2999.344) * (-2995.985) (-2995.031) [-2996.524] (-2999.102) -- 0:03:57
      116000 -- [-2994.744] (-2998.289) (-3004.116) (-2994.293) * (-2992.635) (-2996.825) (-2993.003) [-2992.044] -- 0:03:56
      116500 -- (-2992.001) (-2995.813) (-2991.898) [-2991.759] * (-2996.986) [-2994.352] (-3006.738) (-2994.521) -- 0:03:55
      117000 -- (-2993.914) (-2993.467) (-2990.785) [-2994.000] * (-2996.650) (-2997.819) (-2997.770) [-2989.229] -- 0:04:01
      117500 -- (-2999.323) (-2999.612) [-2992.028] (-2992.991) * [-2999.295] (-2992.888) (-2996.020) (-2994.859) -- 0:04:00
      118000 -- (-2994.231) [-2996.002] (-2997.520) (-2990.677) * (-2995.738) (-2992.878) [-2995.739] (-2999.211) -- 0:03:59
      118500 -- (-2995.686) (-2994.112) (-2998.446) [-2993.959] * (-2999.145) [-2987.530] (-2994.098) (-2993.773) -- 0:03:58
      119000 -- (-2996.905) (-2992.958) [-2994.572] (-2992.642) * (-2993.020) (-2992.793) (-2994.545) [-2991.152] -- 0:03:56
      119500 -- (-2998.681) [-2992.597] (-2993.820) (-2991.331) * (-2995.971) (-2989.750) [-2990.528] (-2994.070) -- 0:03:55
      120000 -- (-2993.781) [-2992.086] (-2993.397) (-2994.317) * (-3001.290) [-2992.329] (-2999.238) (-2990.999) -- 0:03:54

      Average standard deviation of split frequencies: 0.022463

      120500 -- (-2989.881) (-2996.228) (-2988.361) [-2993.870] * (-3004.752) (-2993.482) (-2993.068) [-2993.093] -- 0:04:00
      121000 -- [-2994.673] (-2990.275) (-2996.196) (-2993.784) * (-3002.058) (-2994.255) (-2991.842) [-3000.044] -- 0:03:59
      121500 -- (-2995.710) (-2998.252) (-2990.956) [-3000.091] * (-2991.952) (-2994.547) [-2993.460] (-2992.173) -- 0:03:58
      122000 -- (-2992.913) (-2997.695) (-2992.889) [-3002.704] * (-2995.415) (-2999.429) (-2993.999) [-2991.187] -- 0:03:57
      122500 -- [-2994.413] (-2996.997) (-2992.603) (-2993.158) * [-2995.255] (-2995.223) (-2994.777) (-2995.582) -- 0:03:56
      123000 -- (-2991.686) (-2994.596) (-2990.758) [-2994.546] * (-2989.736) [-2994.466] (-2995.175) (-2989.457) -- 0:03:55
      123500 -- (-2994.477) (-2994.385) (-2995.057) [-2991.404] * (-2992.670) (-2995.553) [-2994.988] (-2989.393) -- 0:03:54
      124000 -- (-2994.111) [-2991.569] (-2991.703) (-2998.851) * (-2993.603) (-2992.834) (-2998.947) [-2990.955] -- 0:03:53
      124500 -- [-2991.026] (-2994.110) (-2992.456) (-2997.921) * (-2990.830) [-2993.348] (-2994.184) (-2991.225) -- 0:03:59
      125000 -- (-2989.614) (-2993.326) (-2993.362) [-2991.208] * (-2996.279) (-2990.864) (-2995.189) [-2991.882] -- 0:03:58

      Average standard deviation of split frequencies: 0.018707

      125500 -- [-2990.650] (-2990.340) (-2995.592) (-2992.061) * [-2992.109] (-2992.265) (-2991.865) (-3000.064) -- 0:03:56
      126000 -- (-2998.088) (-2997.796) [-2992.086] (-2989.725) * (-2997.926) [-2993.123] (-2993.582) (-3001.584) -- 0:03:55
      126500 -- (-2995.108) [-2987.939] (-2997.982) (-2998.972) * (-2996.766) (-2993.442) [-2998.220] (-2991.456) -- 0:03:54
      127000 -- [-2997.210] (-2993.753) (-2998.499) (-2994.409) * [-2993.249] (-2995.858) (-2991.202) (-2993.421) -- 0:03:53
      127500 -- (-2994.584) [-2992.735] (-3000.823) (-2997.075) * (-2991.499) (-3003.009) [-2998.857] (-2997.930) -- 0:03:52
      128000 -- (-2988.880) (-2996.136) (-2998.719) [-3004.892] * (-2992.249) (-3000.744) [-2993.507] (-2995.768) -- 0:03:58
      128500 -- (-2998.762) (-2991.128) (-3000.148) [-2994.645] * (-2991.083) (-3001.550) (-2987.569) [-2993.365] -- 0:03:57
      129000 -- (-2990.513) [-2995.724] (-2999.483) (-2997.055) * (-2992.630) (-3003.762) [-2988.171] (-2987.153) -- 0:03:56
      129500 -- (-3005.757) [-2989.379] (-2993.037) (-2997.627) * (-2992.236) (-2992.731) (-2998.739) [-2990.409] -- 0:03:55
      130000 -- (-2991.989) (-2995.314) [-2994.269] (-2995.365) * (-2988.255) (-2995.210) [-2991.106] (-2992.338) -- 0:03:54

      Average standard deviation of split frequencies: 0.016235

      130500 -- (-2995.059) [-2995.869] (-2993.561) (-2998.929) * (-2990.655) [-2998.015] (-2990.673) (-2998.647) -- 0:03:53
      131000 -- (-2997.178) (-2995.219) (-2999.981) [-2991.073] * (-3002.353) (-2995.362) [-2990.110] (-2998.856) -- 0:03:52
      131500 -- (-2992.930) (-2991.630) [-2994.186] (-2990.466) * (-2994.507) (-3003.222) [-2992.676] (-2997.459) -- 0:03:57
      132000 -- [-2996.570] (-2991.021) (-2998.114) (-2997.780) * (-2995.843) [-2998.168] (-2994.495) (-2996.674) -- 0:03:56
      132500 -- (-2995.101) (-2991.843) (-2990.464) [-2990.133] * (-2992.807) (-2994.930) [-2994.086] (-2997.346) -- 0:03:55
      133000 -- (-3000.649) [-2989.817] (-2997.858) (-2993.676) * (-2996.676) (-2996.948) [-2992.915] (-2993.017) -- 0:03:54
      133500 -- (-2994.584) [-2990.514] (-2996.549) (-2997.073) * (-2993.702) (-2996.444) (-3000.042) [-2992.175] -- 0:03:53
      134000 -- (-2993.794) [-2993.773] (-2990.397) (-2994.668) * (-2992.555) (-2995.507) [-2992.862] (-2998.713) -- 0:03:52
      134500 -- [-2995.429] (-2991.025) (-2993.389) (-2993.362) * (-2988.847) (-2991.508) (-2994.949) [-3003.031] -- 0:03:51
      135000 -- (-2994.127) (-2993.251) (-2994.471) [-2997.380] * (-2992.699) (-3003.891) [-2994.831] (-2999.070) -- 0:03:50

      Average standard deviation of split frequencies: 0.012132

      135500 -- (-2991.733) (-2993.232) (-3000.459) [-2992.786] * (-2993.828) (-2994.407) [-3000.499] (-3007.048) -- 0:03:56
      136000 -- (-2992.097) [-2989.833] (-2996.697) (-2997.289) * [-2995.395] (-2993.499) (-2992.275) (-3007.940) -- 0:03:55
      136500 -- [-2992.164] (-2993.690) (-2996.264) (-2994.339) * (-2989.860) [-2998.789] (-3001.093) (-2996.895) -- 0:03:54
      137000 -- (-2992.086) (-2994.173) [-2991.953] (-2993.777) * (-2994.114) (-3005.676) (-2991.952) [-2992.174] -- 0:03:53
      137500 -- (-2990.965) (-2990.443) [-2991.084] (-2999.134) * (-2995.125) (-2997.714) [-2994.838] (-3000.414) -- 0:03:52
      138000 -- (-2998.925) [-2991.841] (-2991.138) (-2989.727) * (-2988.776) (-2994.759) (-2992.519) [-2994.695] -- 0:03:51
      138500 -- (-3000.080) [-2996.939] (-2994.201) (-2999.885) * (-2992.635) (-2993.092) [-2991.758] (-2998.827) -- 0:03:50
      139000 -- (-2991.887) (-2994.077) (-2994.501) [-2994.363] * (-2994.423) (-2992.187) [-2990.348] (-2997.038) -- 0:03:55
      139500 -- (-2993.212) [-2995.551] (-3001.795) (-2993.586) * (-3000.529) (-2991.383) [-2990.258] (-2995.142) -- 0:03:54
      140000 -- (-2991.609) (-3000.869) (-2995.100) [-2992.010] * (-2995.125) (-3009.121) [-2990.468] (-3006.729) -- 0:03:53

      Average standard deviation of split frequencies: 0.010054

      140500 -- (-2992.144) (-3005.936) (-2994.771) [-2989.448] * [-2995.485] (-2992.033) (-2991.212) (-2993.733) -- 0:03:52
      141000 -- (-2990.745) [-2995.011] (-2991.218) (-2998.691) * (-2995.202) (-2997.015) (-2990.996) [-2994.717] -- 0:03:51
      141500 -- [-2994.001] (-2998.173) (-2993.427) (-2993.245) * [-2997.160] (-2997.352) (-2996.100) (-2988.539) -- 0:03:50
      142000 -- (-2993.676) (-2995.271) (-2996.725) [-2995.763] * (-2991.313) (-2998.281) (-2997.510) [-2992.536] -- 0:03:49
      142500 -- (-2995.544) (-2998.554) (-3002.975) [-2993.173] * (-3000.753) [-2995.720] (-2998.958) (-2994.932) -- 0:03:54
      143000 -- [-2991.136] (-2997.236) (-2994.166) (-2991.178) * (-3016.008) [-2993.483] (-2991.871) (-2993.489) -- 0:03:53
      143500 -- [-2998.582] (-2992.262) (-2991.002) (-2992.391) * (-3001.553) (-2998.772) (-2991.189) [-2993.414] -- 0:03:52
      144000 -- (-2993.886) (-2991.762) (-2993.063) [-2997.245] * (-2993.884) [-2993.676] (-2999.908) (-2998.155) -- 0:03:51
      144500 -- (-2998.376) (-2994.549) (-2992.675) [-2992.787] * [-2993.734] (-2994.312) (-2997.215) (-2988.378) -- 0:03:50
      145000 -- (-2991.483) [-2998.679] (-2993.217) (-2993.625) * (-2994.778) [-2997.467] (-3002.507) (-2993.464) -- 0:03:49

      Average standard deviation of split frequencies: 0.009686

      145500 -- (-3003.646) [-2992.722] (-2991.254) (-2991.180) * [-2989.924] (-2990.432) (-2996.511) (-2992.063) -- 0:03:49
      146000 -- [-2990.313] (-2999.746) (-2997.090) (-2992.335) * [-2989.065] (-2991.224) (-3000.609) (-2994.541) -- 0:03:53
      146500 -- (-2996.180) (-2992.014) [-2999.890] (-2996.495) * (-2994.247) [-2989.300] (-2992.005) (-2996.465) -- 0:03:53
      147000 -- [-2997.238] (-2988.358) (-3000.434) (-2995.796) * [-2995.817] (-2995.870) (-2995.043) (-2995.171) -- 0:03:52
      147500 -- (-2993.966) (-2990.438) [-2995.053] (-2990.903) * [-2992.317] (-2993.015) (-2991.572) (-2990.358) -- 0:03:51
      148000 -- (-2995.315) (-2997.259) [-2991.401] (-2990.363) * (-2990.526) (-2995.126) (-2997.718) [-2991.882] -- 0:03:50
      148500 -- (-2997.777) (-2991.981) (-2989.405) [-2990.407] * [-2994.362] (-2992.222) (-3000.445) (-2993.360) -- 0:03:49
      149000 -- (-2999.163) (-2994.795) [-2988.464] (-2996.993) * (-2995.512) (-2992.993) (-2994.320) [-2993.853] -- 0:03:48
      149500 -- (-2999.615) [-2996.704] (-2995.774) (-2990.925) * (-2994.802) (-2989.942) (-2993.997) [-2989.423] -- 0:03:47
      150000 -- (-2996.592) (-2997.838) (-2995.049) [-2990.381] * [-2991.356] (-2993.756) (-2989.282) (-2987.135) -- 0:03:52

      Average standard deviation of split frequencies: 0.007822

      150500 -- (-3004.336) [-2996.326] (-2995.600) (-2993.333) * (-2995.965) [-2989.397] (-2991.015) (-2992.229) -- 0:03:51
      151000 -- (-3001.818) (-2999.015) [-2997.770] (-2993.500) * (-2999.836) [-2989.870] (-2994.843) (-2990.243) -- 0:03:50
      151500 -- (-3007.660) (-2997.702) (-2992.489) [-2994.394] * (-3000.572) (-2999.705) [-2992.023] (-2992.070) -- 0:03:49
      152000 -- [-2992.589] (-2992.269) (-2996.094) (-2990.118) * [-2992.691] (-2994.834) (-2995.567) (-2994.335) -- 0:03:48
      152500 -- (-2995.748) (-2990.224) [-2993.414] (-2995.858) * (-2997.422) (-2991.613) (-2995.447) [-2988.706] -- 0:03:47
      153000 -- (-3006.176) (-2997.353) (-2993.116) [-2994.092] * [-2991.262] (-2993.835) (-2996.526) (-2990.686) -- 0:03:46
      153500 -- (-2989.859) [-2996.824] (-3000.004) (-2997.115) * [-2999.406] (-2994.195) (-2996.491) (-2992.730) -- 0:03:51
      154000 -- (-2993.249) (-3000.022) (-2992.854) [-2991.884] * (-2997.285) (-2993.345) [-2995.816] (-2990.155) -- 0:03:50
      154500 -- (-2992.951) [-2992.702] (-2989.054) (-2989.285) * [-2989.927] (-2987.664) (-2996.695) (-2989.893) -- 0:03:49
      155000 -- (-2996.512) (-2997.062) [-2993.712] (-2996.169) * (-2990.884) [-2994.951] (-2995.870) (-2988.492) -- 0:03:48

      Average standard deviation of split frequencies: 0.010576

      155500 -- [-2994.989] (-2994.141) (-2997.481) (-2996.538) * (-2990.329) (-2990.303) [-2990.625] (-2996.036) -- 0:03:48
      156000 -- (-3006.774) (-2990.036) (-2999.819) [-2988.960] * (-2992.419) (-2992.580) [-2996.266] (-2998.429) -- 0:03:47
      156500 -- (-3001.599) (-2993.254) (-2992.998) [-2991.647] * (-2990.899) (-2992.383) (-2996.851) [-3007.490] -- 0:03:46
      157000 -- [-2994.310] (-2997.426) (-3001.645) (-2999.326) * (-2989.679) [-2991.067] (-2999.541) (-2999.688) -- 0:03:50
      157500 -- (-2996.468) (-3004.973) [-2995.829] (-2992.590) * [-2995.169] (-2989.795) (-2993.570) (-2994.863) -- 0:03:50
      158000 -- (-2998.065) (-2994.493) (-2998.393) [-2992.578] * (-2995.659) (-2990.912) [-2992.398] (-2991.775) -- 0:03:49
      158500 -- (-2991.734) (-2996.082) (-3007.455) [-2991.705] * (-2993.447) (-2995.414) [-2992.326] (-2996.636) -- 0:03:48
      159000 -- [-2994.234] (-2991.095) (-3000.675) (-2996.062) * [-2995.090] (-2994.406) (-2996.455) (-2995.324) -- 0:03:47
      159500 -- (-2999.128) (-2988.480) (-3002.789) [-2993.426] * (-2994.276) [-2989.490] (-2996.739) (-2998.574) -- 0:03:46
      160000 -- (-2998.533) (-2989.109) (-3001.375) [-2996.891] * (-3000.937) [-2988.570] (-2995.931) (-2997.402) -- 0:03:45

      Average standard deviation of split frequencies: 0.010269

      160500 -- (-2998.982) [-2990.600] (-3002.903) (-3001.491) * (-2990.840) (-2990.224) [-2994.518] (-2992.397) -- 0:03:44
      161000 -- (-2995.173) (-2988.559) (-3003.177) [-2999.003] * (-2989.442) (-2991.544) (-2990.839) [-2990.524] -- 0:03:49
      161500 -- [-2995.802] (-2990.849) (-3005.940) (-3000.783) * (-2993.350) (-2997.900) [-2989.301] (-2990.446) -- 0:03:48
      162000 -- (-2992.443) (-2997.101) [-2990.831] (-2991.475) * (-2995.624) (-2995.178) [-2995.141] (-3000.496) -- 0:03:47
      162500 -- (-2993.919) (-2992.711) (-2995.211) [-2994.868] * (-2995.144) (-2992.329) [-2993.450] (-2989.752) -- 0:03:46
      163000 -- (-2993.364) (-2993.228) (-2990.291) [-2992.796] * (-2997.490) (-2989.401) [-2993.388] (-2993.823) -- 0:03:45
      163500 -- (-2996.225) (-2996.456) (-2993.726) [-2989.349] * [-2990.487] (-2996.073) (-2990.191) (-2998.578) -- 0:03:45
      164000 -- (-2992.111) (-2995.377) [-2995.295] (-2990.920) * [-2996.469] (-2990.540) (-2994.294) (-2993.593) -- 0:03:44
      164500 -- (-2991.204) (-2997.724) (-2997.555) [-2996.270] * (-2997.514) [-2992.809] (-2990.576) (-2993.139) -- 0:03:48
      165000 -- (-2996.275) (-2992.436) (-2988.547) [-3000.094] * (-2995.077) (-2997.736) (-2995.899) [-2993.018] -- 0:03:47

      Average standard deviation of split frequencies: 0.009939

      165500 -- (-2994.189) [-2997.644] (-2994.804) (-2995.673) * (-2994.399) (-2994.267) [-2993.626] (-2994.917) -- 0:03:46
      166000 -- (-3000.825) [-2990.139] (-2999.829) (-2998.510) * (-2995.495) (-3001.756) [-2993.735] (-2993.460) -- 0:03:46
      166500 -- (-2997.041) [-2994.442] (-2989.025) (-3002.828) * (-2997.095) (-2994.503) (-2994.204) [-2994.222] -- 0:03:45
      167000 -- [-2989.143] (-2990.603) (-2996.081) (-2999.813) * (-2996.303) (-2991.992) (-2997.196) [-2993.982] -- 0:03:44
      167500 -- [-2988.375] (-2998.557) (-2992.303) (-2999.924) * (-3000.092) [-2991.408] (-2990.598) (-2993.642) -- 0:03:43
      168000 -- (-2997.347) (-2994.934) [-2995.153] (-3000.871) * (-2991.827) [-2993.613] (-2989.029) (-2993.690) -- 0:03:47
      168500 -- (-3004.332) (-2998.215) (-2991.206) [-2989.303] * (-2991.559) (-2992.716) (-2991.308) [-2991.849] -- 0:03:46
      169000 -- (-2997.444) (-2993.886) (-2991.044) [-2990.384] * [-2990.911] (-2996.205) (-2999.702) (-2989.253) -- 0:03:46
      169500 -- (-2994.146) (-2995.688) [-2992.354] (-2991.650) * [-2992.072] (-2992.503) (-3000.063) (-2997.794) -- 0:03:45
      170000 -- (-2998.658) [-3000.164] (-2998.902) (-2991.911) * [-2988.329] (-2994.578) (-2995.326) (-2992.666) -- 0:03:44

      Average standard deviation of split frequencies: 0.012430

      170500 -- (-2991.590) (-3002.364) (-2989.623) [-2988.628] * (-2994.375) (-2991.849) (-2991.679) [-2992.962] -- 0:03:43
      171000 -- (-2994.139) (-2998.783) (-2996.396) [-2987.084] * (-2993.005) (-2990.384) [-2997.595] (-2992.268) -- 0:03:43
      171500 -- (-2994.299) [-2997.108] (-2990.413) (-2997.970) * [-2992.978] (-2996.380) (-2990.383) (-2999.988) -- 0:03:42
      172000 -- (-2990.255) [-2992.688] (-2996.760) (-2996.868) * [-2990.783] (-2993.635) (-2994.430) (-2989.592) -- 0:03:46
      172500 -- (-2994.421) [-2992.873] (-2992.758) (-2995.683) * [-2994.285] (-2995.035) (-3002.992) (-2992.589) -- 0:03:45
      173000 -- (-2996.509) [-2990.626] (-2997.692) (-2997.288) * (-2992.134) (-2998.318) [-2992.319] (-2998.161) -- 0:03:44
      173500 -- (-2994.642) (-2995.666) [-2996.751] (-2994.614) * [-2994.557] (-3008.603) (-2996.299) (-2992.530) -- 0:03:43
      174000 -- (-2997.027) (-2995.151) [-2996.711] (-2994.321) * (-2989.222) (-2995.726) [-2990.082] (-2992.268) -- 0:03:43
      174500 -- (-2991.376) (-2992.831) [-2991.677] (-2993.348) * (-2995.607) (-2994.770) [-2990.289] (-2999.551) -- 0:03:42
      175000 -- [-2992.643] (-2991.123) (-2993.801) (-2995.907) * (-2995.177) (-2996.528) [-2991.937] (-3006.045) -- 0:03:41

      Average standard deviation of split frequencies: 0.009375

      175500 -- (-2993.295) [-2992.475] (-2998.139) (-2990.982) * (-3001.635) (-2993.016) [-2991.640] (-3003.464) -- 0:03:45
      176000 -- (-2990.655) (-2990.828) (-2995.604) [-2989.435] * (-3003.653) [-2989.274] (-2998.603) (-3000.345) -- 0:03:44
      176500 -- (-2989.165) [-2995.265] (-2994.059) (-2999.871) * (-2994.258) (-2997.184) (-2994.612) [-2999.361] -- 0:03:43
      177000 -- [-2990.149] (-2990.208) (-2991.882) (-2997.769) * (-2997.375) (-2992.495) [-2996.255] (-2998.772) -- 0:03:43
      177500 -- (-2990.656) (-2993.046) (-2995.236) [-2989.556] * [-2994.286] (-2994.620) (-3000.314) (-2990.993) -- 0:03:42
      178000 -- [-2990.504] (-2995.116) (-2996.402) (-2993.178) * (-2992.459) (-2991.781) (-3003.094) [-2993.290] -- 0:03:41
      178500 -- (-2996.141) (-2991.818) (-2990.019) [-2986.040] * (-2998.893) (-2997.129) (-3001.222) [-2994.071] -- 0:03:40
      179000 -- (-2989.354) [-2991.881] (-2993.218) (-2990.738) * (-3000.395) (-2996.589) (-2992.378) [-2993.785] -- 0:03:44
      179500 -- (-2993.321) [-2994.268] (-2993.500) (-2998.059) * (-2997.956) [-2995.199] (-2999.850) (-3001.388) -- 0:03:43
      180000 -- (-3002.797) (-2998.259) (-2996.671) [-2989.447] * [-2991.060] (-3007.480) (-2993.368) (-2998.476) -- 0:03:43

      Average standard deviation of split frequencies: 0.010437

      180500 -- (-3000.425) (-2989.474) (-2996.815) [-2988.345] * (-2991.813) (-3000.567) [-2994.657] (-2994.334) -- 0:03:42
      181000 -- [-2998.619] (-2993.707) (-2998.246) (-3001.363) * (-2991.271) (-3001.400) (-2998.701) [-2991.461] -- 0:03:41
      181500 -- (-3001.586) (-3000.144) [-2990.407] (-2991.988) * (-2995.591) (-2994.872) (-2991.229) [-2990.670] -- 0:03:40
      182000 -- (-2992.137) (-2995.724) [-2990.965] (-2993.000) * (-3005.394) (-2992.371) (-3000.236) [-2998.724] -- 0:03:40
      182500 -- (-2993.067) (-2994.703) [-2988.833] (-2989.151) * (-2992.150) (-2995.685) [-3001.629] (-2994.219) -- 0:03:43
      183000 -- (-2995.751) (-2998.372) [-2991.860] (-2997.634) * [-2994.842] (-2997.812) (-2995.905) (-2991.059) -- 0:03:43
      183500 -- [-2995.615] (-3003.123) (-2988.832) (-2992.788) * (-2993.484) [-2993.821] (-2996.432) (-2993.246) -- 0:03:42
      184000 -- (-2999.232) [-2993.862] (-2991.627) (-2996.289) * [-2987.307] (-2992.751) (-2994.938) (-2991.249) -- 0:03:41
      184500 -- (-2994.764) [-2995.522] (-2995.312) (-2995.692) * (-2991.981) (-2989.629) (-2993.573) [-2991.986] -- 0:03:41
      185000 -- [-2994.287] (-2992.453) (-2994.743) (-2996.863) * (-2990.851) [-2992.774] (-2992.855) (-2993.386) -- 0:03:40

      Average standard deviation of split frequencies: 0.007603

      185500 -- (-2995.228) (-2994.271) (-2991.593) [-2992.498] * (-2996.808) (-2991.636) (-2991.644) [-2991.230] -- 0:03:39
      186000 -- (-2995.109) (-2995.660) [-2991.587] (-2996.407) * [-2991.969] (-2991.346) (-2997.207) (-2992.618) -- 0:03:38
      186500 -- [-2992.661] (-2992.078) (-2998.665) (-2997.739) * (-2994.050) (-2998.223) [-2993.625] (-2993.832) -- 0:03:42
      187000 -- (-2994.304) [-3001.027] (-2994.908) (-2992.984) * (-3000.665) (-2994.498) [-2990.336] (-2990.741) -- 0:03:41
      187500 -- [-2990.384] (-3000.074) (-2996.607) (-2994.316) * (-2998.462) (-2997.184) [-2991.509] (-2996.644) -- 0:03:41
      188000 -- [-2992.359] (-2994.558) (-2998.879) (-2999.139) * (-2992.075) (-3010.434) (-2990.644) [-2992.065] -- 0:03:40
      188500 -- (-2992.520) [-2990.380] (-2994.250) (-3000.462) * (-2996.208) (-3002.026) (-2995.174) [-2996.763] -- 0:03:39
      189000 -- (-2997.549) (-2994.674) [-2993.770] (-2994.367) * [-3005.943] (-2990.292) (-2996.075) (-2995.080) -- 0:03:38
      189500 -- (-2993.608) (-2990.958) (-2994.353) [-2991.988] * (-2996.588) [-2990.389] (-2991.135) (-3003.195) -- 0:03:38
      190000 -- (-2989.871) [-2991.588] (-2992.140) (-2995.834) * (-2991.682) (-2996.877) [-2989.117] (-3012.072) -- 0:03:41

      Average standard deviation of split frequencies: 0.004327

      190500 -- (-2990.451) (-2992.879) [-2990.051] (-2998.367) * [-2997.824] (-3005.423) (-2999.972) (-3005.104) -- 0:03:40
      191000 -- (-2995.478) (-2996.753) [-2997.583] (-2994.392) * (-2992.257) (-2996.010) [-2996.373] (-2996.341) -- 0:03:40
      191500 -- (-2993.628) (-2995.659) (-2991.449) [-2995.112] * [-2989.153] (-2997.775) (-3002.223) (-2998.596) -- 0:03:39
      192000 -- (-2992.464) (-2993.236) (-2993.429) [-2990.507] * [-2992.439] (-2994.915) (-2991.197) (-2991.852) -- 0:03:38
      192500 -- (-2996.054) (-2991.672) (-2995.582) [-2995.883] * (-2994.570) [-2993.248] (-2991.635) (-2991.925) -- 0:03:38
      193000 -- (-2995.192) (-2992.606) (-2996.125) [-2996.447] * (-2987.163) (-2993.802) [-2991.086] (-2994.374) -- 0:03:37
      193500 -- (-2996.483) [-2991.265] (-2990.830) (-3001.845) * (-2990.179) (-2997.421) [-2988.786] (-2995.620) -- 0:03:40
      194000 -- (-2993.833) (-2992.608) [-2996.199] (-2998.011) * (-2997.211) (-2994.570) (-2992.217) [-2996.891] -- 0:03:40
      194500 -- (-2996.731) (-2994.291) [-2992.400] (-2996.393) * (-2994.033) (-2994.182) (-2992.610) [-2994.943] -- 0:03:39
      195000 -- (-2990.701) (-2995.313) [-2994.244] (-3000.408) * (-2992.232) (-2995.971) [-2991.334] (-2997.514) -- 0:03:38

      Average standard deviation of split frequencies: 0.003006

      195500 -- (-2996.438) (-2995.753) (-2996.639) [-2993.227] * (-3003.956) [-2991.488] (-2997.570) (-3004.096) -- 0:03:38
      196000 -- (-2992.738) (-2994.544) [-2991.252] (-2996.596) * [-2988.213] (-2999.779) (-2996.605) (-3000.886) -- 0:03:37
      196500 -- (-2998.290) (-2994.132) [-2991.674] (-2989.578) * (-3000.969) [-2992.243] (-2995.829) (-2995.334) -- 0:03:36
      197000 -- (-2990.658) [-2997.329] (-2989.675) (-2995.444) * [-2991.294] (-2991.114) (-2999.158) (-2996.960) -- 0:03:36
      197500 -- (-2995.826) (-2997.451) [-2988.953] (-2995.666) * (-2994.363) [-2990.201] (-2991.548) (-2997.866) -- 0:03:39
      198000 -- (-2999.807) (-2994.420) [-2990.475] (-2992.144) * (-2995.459) (-2997.889) (-3000.698) [-2993.252] -- 0:03:38
      198500 -- (-2996.590) [-2991.362] (-2992.862) (-2993.365) * [-2996.995] (-3003.034) (-2995.020) (-2992.378) -- 0:03:38
      199000 -- [-2995.284] (-2992.450) (-2993.669) (-2989.860) * (-2993.533) (-2997.779) [-2991.953] (-2997.670) -- 0:03:37
      199500 -- (-2998.706) (-2992.233) (-2991.250) [-2990.579] * [-3001.256] (-2995.003) (-2988.313) (-3004.772) -- 0:03:36
      200000 -- (-2993.978) (-2996.553) (-2990.576) [-2993.472] * (-2992.611) (-2995.321) [-2992.087] (-2997.923) -- 0:03:36

      Average standard deviation of split frequencies: 0.003524

      200500 -- (-2995.783) (-2992.265) [-2990.248] (-2999.464) * [-2994.619] (-3003.386) (-2999.504) (-3000.362) -- 0:03:35
      201000 -- (-2999.339) (-2988.021) [-2992.621] (-3001.579) * (-3003.616) (-2991.723) (-2999.601) [-2992.112] -- 0:03:38
      201500 -- (-2999.877) [-2992.750] (-2999.609) (-2989.618) * (-2993.791) [-2990.062] (-2993.755) (-2994.454) -- 0:03:37
      202000 -- (-3002.702) (-2999.332) (-2990.215) [-2994.141] * (-3001.113) (-2996.160) [-2990.944] (-2995.349) -- 0:03:37
      202500 -- (-3001.143) (-2998.219) (-2990.232) [-2992.013] * (-2994.299) (-2991.703) (-3000.484) [-2990.766] -- 0:03:36
      203000 -- (-2996.670) [-2998.242] (-2993.109) (-2993.667) * (-2992.879) (-2989.037) (-3003.419) [-2997.075] -- 0:03:35
      203500 -- (-3000.682) (-2999.693) (-2996.258) [-2996.036] * (-2998.971) [-2995.733] (-2991.889) (-3002.099) -- 0:03:35
      204000 -- (-2998.293) (-2999.362) (-2989.533) [-2988.579] * (-3003.632) [-2990.165] (-2994.747) (-2995.675) -- 0:03:34
      204500 -- (-2991.578) [-2994.477] (-2994.786) (-2997.177) * (-3005.743) (-2990.742) (-2995.565) [-2997.881] -- 0:03:33
      205000 -- (-2993.722) (-2999.627) (-2997.281) [-2992.649] * (-2990.677) [-2993.035] (-2993.316) (-2991.753) -- 0:03:37

      Average standard deviation of split frequencies: 0.004577

      205500 -- (-2997.978) (-3000.190) (-2999.105) [-2993.559] * (-2996.263) [-2992.287] (-2989.715) (-2992.349) -- 0:03:36
      206000 -- [-2992.509] (-3001.495) (-2998.252) (-2990.678) * (-2996.363) (-2990.052) [-2994.645] (-2994.620) -- 0:03:35
      206500 -- (-2994.809) [-2999.082] (-2993.316) (-2991.524) * (-3000.063) [-2992.217] (-2994.600) (-2990.003) -- 0:03:35
      207000 -- [-2991.591] (-2997.637) (-2997.111) (-2995.204) * (-2995.248) [-2990.107] (-2995.333) (-2990.541) -- 0:03:34
      207500 -- [-2990.311] (-2997.919) (-2987.447) (-2998.997) * [-3000.926] (-2993.244) (-2998.566) (-2988.154) -- 0:03:33
      208000 -- (-2993.760) [-2993.222] (-3001.201) (-2999.277) * (-2998.309) (-2995.782) [-2993.942] (-2994.894) -- 0:03:33
      208500 -- (-2992.686) (-2994.057) [-2997.621] (-2993.344) * (-2998.023) (-2993.580) (-3000.623) [-2991.488] -- 0:03:36
      209000 -- [-2993.466] (-3001.067) (-2995.374) (-2996.022) * (-2995.188) (-2991.603) [-2996.179] (-2994.710) -- 0:03:35
      209500 -- (-2993.552) [-2997.099] (-2997.324) (-2999.848) * (-2995.853) (-2999.228) [-2989.543] (-2996.994) -- 0:03:35
      210000 -- [-3001.649] (-2997.475) (-2996.360) (-2993.746) * (-2996.256) (-2996.707) (-2991.563) [-2999.390] -- 0:03:34

      Average standard deviation of split frequencies: 0.005594

      210500 -- (-2996.627) [-2999.814] (-2997.202) (-3000.177) * (-2994.681) [-2994.678] (-2994.092) (-3002.394) -- 0:03:33
      211000 -- (-3006.108) [-2993.159] (-2995.711) (-3003.492) * (-2998.114) (-2997.920) (-2993.089) [-2991.991] -- 0:03:33
      211500 -- (-3000.467) (-2995.438) [-2996.257] (-3002.582) * [-2994.009] (-2993.246) (-3000.049) (-2994.390) -- 0:03:32
      212000 -- (-2999.182) [-2989.967] (-2998.338) (-2995.341) * (-2995.218) [-2993.682] (-2992.336) (-2988.051) -- 0:03:35
      212500 -- (-2993.778) (-2990.484) (-2996.946) [-2996.114] * (-2995.355) [-2992.459] (-2996.070) (-2995.407) -- 0:03:34
      213000 -- [-2993.333] (-2992.267) (-2995.291) (-2993.430) * (-2992.762) [-2992.807] (-2991.658) (-2990.529) -- 0:03:34
      213500 -- [-2991.556] (-2996.498) (-2999.233) (-2992.149) * (-3000.718) [-2992.459] (-2992.781) (-2993.536) -- 0:03:33
      214000 -- (-2993.725) (-2990.320) (-2994.770) [-2990.857] * (-3001.429) [-2993.817] (-2996.262) (-2991.735) -- 0:03:33
      214500 -- (-2993.280) [-3000.465] (-2990.349) (-2994.403) * (-2990.246) (-2992.129) (-2995.708) [-2991.944] -- 0:03:32
      215000 -- (-2989.332) (-2999.549) [-2995.830] (-2990.805) * [-2999.108] (-2992.492) (-2998.769) (-3000.885) -- 0:03:31

      Average standard deviation of split frequencies: 0.002182

      215500 -- (-2991.033) (-2994.023) (-2996.039) [-2994.747] * (-2991.801) (-2993.511) [-2998.914] (-2994.809) -- 0:03:31
      216000 -- [-2989.559] (-2995.348) (-2999.832) (-2996.052) * (-2991.644) (-2992.484) [-2994.867] (-2992.777) -- 0:03:34
      216500 -- [-2994.767] (-2987.964) (-2993.295) (-2991.353) * (-2999.385) (-2993.364) [-2997.609] (-2996.046) -- 0:03:33
      217000 -- (-2993.527) (-2993.752) [-2995.945] (-3001.773) * (-2998.093) [-2990.339] (-2999.952) (-2991.994) -- 0:03:32
      217500 -- [-2991.670] (-2995.966) (-2999.461) (-3000.395) * (-2999.008) (-2997.750) [-3004.238] (-2994.634) -- 0:03:32
      218000 -- (-2999.810) (-2996.551) (-2996.013) [-2988.018] * (-3003.221) (-2997.925) (-2991.371) [-2998.033] -- 0:03:31
      218500 -- (-2996.785) (-2997.339) [-2994.746] (-2991.545) * (-3001.029) [-2996.664] (-2991.985) (-2991.428) -- 0:03:31
      219000 -- [-2992.042] (-2996.590) (-2994.345) (-2993.022) * (-2989.566) (-2996.886) [-2994.503] (-2993.720) -- 0:03:30
      219500 -- [-2991.848] (-2997.152) (-2999.142) (-2989.971) * [-2986.832] (-2994.664) (-2989.055) (-2993.560) -- 0:03:33
      220000 -- [-2987.559] (-2995.107) (-2993.502) (-3002.291) * [-2989.676] (-3002.864) (-2992.210) (-2992.898) -- 0:03:32

      Average standard deviation of split frequencies: 0.003204

      220500 -- (-2992.879) (-2998.364) [-2990.229] (-2989.063) * (-2989.617) (-2993.297) [-2995.185] (-2992.711) -- 0:03:32
      221000 -- (-2989.926) (-2998.892) [-2986.419] (-2994.525) * [-2990.226] (-2992.239) (-2999.298) (-2987.721) -- 0:03:31
      221500 -- (-2991.932) (-3000.034) (-3000.760) [-2992.238] * [-2989.319] (-2994.341) (-2999.780) (-2992.127) -- 0:03:30
      222000 -- (-2992.893) (-2997.105) (-2993.008) [-2990.897] * (-2992.644) (-2992.023) (-3001.246) [-2988.775] -- 0:03:30
      222500 -- (-2994.213) (-2999.074) (-2992.411) [-2991.499] * (-2992.910) (-2995.412) (-2998.051) [-2989.277] -- 0:03:29
      223000 -- (-2986.392) (-2999.275) [-2992.947] (-2995.431) * (-2991.295) (-2994.036) [-2996.762] (-2992.193) -- 0:03:32
      223500 -- (-2990.815) (-2994.264) (-2986.284) [-2994.230] * (-3002.428) [-2994.608] (-2997.129) (-2996.166) -- 0:03:31
      224000 -- (-2992.976) (-2994.858) [-2989.790] (-2996.699) * [-2994.372] (-2993.566) (-2993.381) (-2990.487) -- 0:03:31
      224500 -- (-2998.810) [-2999.595] (-2993.344) (-3000.053) * (-2992.591) (-2993.355) [-2994.819] (-2990.619) -- 0:03:30
      225000 -- [-2993.053] (-3000.677) (-2991.779) (-3001.958) * [-2994.106] (-2994.022) (-2993.441) (-2995.258) -- 0:03:30

      Average standard deviation of split frequencies: 0.005215

      225500 -- [-2990.274] (-2993.848) (-2996.242) (-3000.266) * (-2995.583) (-2993.316) (-2988.749) [-2993.529] -- 0:03:29
      226000 -- (-2994.689) [-2997.653] (-2998.984) (-3000.976) * (-2994.027) (-2989.166) (-2997.378) [-2990.410] -- 0:03:28
      226500 -- (-2993.631) (-2995.336) (-2993.567) [-2990.039] * (-2993.081) [-2991.236] (-2993.819) (-2996.265) -- 0:03:28
      227000 -- (-2997.701) [-2993.376] (-3000.034) (-2990.510) * (-2994.395) (-2997.562) [-2996.219] (-2993.828) -- 0:03:31
      227500 -- (-2997.452) [-2993.617] (-2993.559) (-2991.733) * (-2992.447) [-2989.346] (-2997.792) (-2993.499) -- 0:03:30
      228000 -- (-2994.574) (-2994.412) [-2988.622] (-2988.922) * [-2997.194] (-2994.518) (-2989.951) (-2996.353) -- 0:03:29
      228500 -- [-2990.762] (-3004.039) (-2993.194) (-2993.360) * [-2996.840] (-2998.236) (-2996.710) (-2997.361) -- 0:03:29
      229000 -- (-2994.625) (-3003.058) (-2997.085) [-2994.582] * [-2991.824] (-2994.633) (-2997.626) (-2998.495) -- 0:03:28
      229500 -- (-2989.863) (-2995.016) [-2993.100] (-2994.001) * [-3001.332] (-2993.430) (-2992.770) (-2998.319) -- 0:03:28
      230000 -- (-2995.091) [-2991.291] (-2995.937) (-2993.246) * (-2997.583) [-2992.458] (-3002.084) (-2992.914) -- 0:03:27

      Average standard deviation of split frequencies: 0.006131

      230500 -- (-2996.045) [-2997.998] (-2987.490) (-2996.295) * (-2994.447) (-3002.462) [-3005.416] (-2994.074) -- 0:03:30
      231000 -- (-3005.153) (-3000.023) [-2996.621] (-2993.337) * [-2987.600] (-3001.746) (-2998.944) (-3001.497) -- 0:03:29
      231500 -- (-3003.231) [-2992.192] (-2997.071) (-2993.922) * (-2994.809) (-2999.204) (-2999.561) [-2997.216] -- 0:03:29
      232000 -- [-3003.298] (-2992.074) (-2996.583) (-2992.640) * (-2994.299) [-2999.405] (-3000.563) (-2989.961) -- 0:03:28
      232500 -- (-2998.982) [-2990.457] (-2990.782) (-2992.811) * (-2992.278) (-2994.092) (-2991.156) [-2995.280] -- 0:03:27
      233000 -- (-3000.512) (-2996.624) (-2994.194) [-2997.646] * [-2990.083] (-2992.858) (-2995.899) (-2997.671) -- 0:03:27
      233500 -- (-2999.991) [-2993.741] (-2993.632) (-3003.092) * [-2988.387] (-2995.764) (-2996.577) (-2999.755) -- 0:03:26
      234000 -- (-2992.028) (-2994.690) (-2996.181) [-3000.330] * [-2990.668] (-2990.460) (-3001.159) (-3003.415) -- 0:03:26
      234500 -- [-2992.484] (-2990.223) (-2995.508) (-2996.091) * [-2991.364] (-2993.193) (-2991.965) (-2997.511) -- 0:03:28
      235000 -- [-2990.658] (-2994.411) (-2988.950) (-2994.496) * (-2996.814) [-2996.117] (-2991.710) (-2997.178) -- 0:03:28

      Average standard deviation of split frequencies: 0.003995

      235500 -- (-2999.083) [-2994.915] (-2993.023) (-2996.811) * (-2992.142) [-2991.767] (-2994.096) (-2993.774) -- 0:03:27
      236000 -- (-2996.747) (-3001.175) (-2993.146) [-2990.839] * (-2993.771) (-2991.355) [-2989.095] (-2991.757) -- 0:03:27
      236500 -- (-2994.421) (-2995.587) [-2994.046] (-2997.324) * (-2995.002) [-2996.013] (-2998.630) (-2994.262) -- 0:03:26
      237000 -- (-2995.408) [-2994.006] (-2991.235) (-2995.028) * (-2995.488) (-3000.073) (-2995.912) [-2989.139] -- 0:03:26
      237500 -- (-2995.556) (-2994.909) (-2993.356) [-3000.991] * [-2992.892] (-2993.386) (-2996.663) (-2993.558) -- 0:03:25
      238000 -- (-2992.479) (-3001.847) (-2994.843) [-2992.300] * [-2992.071] (-3001.151) (-2990.721) (-2995.768) -- 0:03:28
      238500 -- (-2995.097) (-2992.386) (-2991.604) [-2995.938] * (-2993.659) (-3001.053) (-2992.248) [-2994.172] -- 0:03:27
      239000 -- [-2993.584] (-2990.100) (-2992.541) (-2991.944) * [-2992.076] (-2993.432) (-2993.274) (-3002.358) -- 0:03:26
      239500 -- [-2993.990] (-2998.010) (-3003.534) (-2997.041) * [-2991.750] (-2996.610) (-2992.725) (-2999.846) -- 0:03:26
      240000 -- (-2994.940) (-2993.148) (-2998.024) [-2993.050] * [-2990.017] (-2995.114) (-2989.490) (-2996.950) -- 0:03:25

      Average standard deviation of split frequencies: 0.004897

      240500 -- (-3002.497) [-2992.937] (-2990.753) (-2992.479) * [-2994.203] (-2994.585) (-2989.911) (-2994.216) -- 0:03:25
      241000 -- (-2995.801) [-2991.969] (-2993.515) (-2995.877) * [-2992.619] (-2992.739) (-2993.925) (-2999.295) -- 0:03:24
      241500 -- (-3001.147) [-2992.175] (-2993.601) (-3003.080) * (-3000.159) [-2999.190] (-2998.757) (-3001.629) -- 0:03:27
      242000 -- (-3005.063) (-2990.667) (-2988.616) [-2995.359] * [-2988.853] (-2996.261) (-2989.301) (-2996.996) -- 0:03:26
      242500 -- (-2999.181) [-2992.558] (-2992.337) (-2996.189) * [-2988.914] (-2993.584) (-2993.170) (-2991.104) -- 0:03:26
      243000 -- (-2995.966) (-2991.417) (-2993.660) [-2993.421] * (-2990.514) (-2995.507) (-2995.479) [-2996.446] -- 0:03:25
      243500 -- (-2993.832) (-2991.581) [-2992.612] (-2995.477) * (-2998.586) (-2997.370) (-2997.635) [-2997.318] -- 0:03:25
      244000 -- (-2992.313) [-2992.733] (-2991.008) (-2992.072) * (-2991.305) [-2991.790] (-2994.058) (-2991.352) -- 0:03:24
      244500 -- (-2992.955) (-2993.171) (-2998.768) [-2987.880] * (-2993.331) (-2995.010) (-2990.685) [-2993.734] -- 0:03:23
      245000 -- [-2990.671] (-2990.159) (-2991.347) (-2997.186) * (-2989.543) (-3002.937) (-2992.880) [-2991.988] -- 0:03:23

      Average standard deviation of split frequencies: 0.004791

      245500 -- (-2993.895) [-2999.844] (-2991.824) (-2992.091) * (-2988.967) (-2998.292) [-3003.881] (-2997.778) -- 0:03:25
      246000 -- [-2991.887] (-2995.496) (-2990.375) (-2997.344) * [-2991.072] (-2995.541) (-2994.477) (-2989.076) -- 0:03:25
      246500 -- (-2993.739) (-2997.777) [-2990.975] (-2989.480) * (-2998.808) (-3003.300) (-2993.269) [-2993.497] -- 0:03:24
      247000 -- (-2994.878) (-2995.585) [-2992.457] (-2997.701) * (-2999.871) (-2992.672) [-2994.950] (-2996.299) -- 0:03:24
      247500 -- (-2999.600) [-3000.939] (-2993.381) (-2994.884) * [-2989.712] (-2996.052) (-2991.196) (-2997.216) -- 0:03:23
      248000 -- (-2994.879) (-3002.401) [-2988.278] (-2992.479) * (-3000.386) (-2990.364) [-2991.502] (-2994.347) -- 0:03:23
      248500 -- [-2996.706] (-3002.247) (-2992.519) (-2993.011) * (-3000.779) [-2993.519] (-2991.683) (-2996.605) -- 0:03:22
      249000 -- (-2996.882) [-3005.150] (-2996.958) (-2993.002) * (-2992.867) (-3009.429) (-2990.622) [-2997.067] -- 0:03:25
      249500 -- [-2993.012] (-3000.401) (-2988.708) (-2989.843) * (-2993.169) (-2995.353) (-2994.524) [-2998.065] -- 0:03:24
      250000 -- (-2991.422) (-2993.844) (-3001.615) [-2998.315] * (-2997.557) (-2995.974) (-2993.111) [-2991.943] -- 0:03:24

      Average standard deviation of split frequencies: 0.003761

      250500 -- (-2995.948) [-2991.764] (-2989.414) (-2990.055) * [-2988.375] (-2997.692) (-2996.049) (-2997.540) -- 0:03:23
      251000 -- (-3000.022) [-2989.008] (-2991.896) (-2997.485) * [-2991.504] (-2993.407) (-2998.369) (-3003.410) -- 0:03:22
      251500 -- (-2996.471) [-2996.113] (-2996.150) (-3005.258) * (-2998.020) (-2994.305) [-2993.986] (-2994.411) -- 0:03:22
      252000 -- (-3001.015) [-2993.865] (-2994.542) (-3000.927) * (-2991.658) (-2994.603) [-2991.795] (-3003.656) -- 0:03:21
      252500 -- [-2994.359] (-2994.158) (-2992.592) (-2999.679) * (-2994.966) [-3001.715] (-2993.721) (-2999.009) -- 0:03:24
      253000 -- [-2994.105] (-2997.094) (-2991.811) (-2996.574) * (-2999.696) (-3005.229) (-2992.244) [-2997.330] -- 0:03:23
      253500 -- (-3007.102) (-3009.305) (-2994.147) [-2992.809] * (-2992.198) (-2993.521) (-2992.631) [-2990.224] -- 0:03:23
      254000 -- (-2990.440) [-2991.468] (-2995.254) (-2994.614) * [-2995.099] (-2994.248) (-2994.708) (-2996.452) -- 0:03:22
      254500 -- [-2989.303] (-2994.093) (-2991.718) (-2992.417) * [-2993.733] (-2998.674) (-2998.981) (-2993.348) -- 0:03:22
      255000 -- [-2993.306] (-2991.202) (-2990.057) (-2987.571) * [-2995.596] (-2999.342) (-3006.233) (-2990.737) -- 0:03:21

      Average standard deviation of split frequencies: 0.001841

      255500 -- [-2988.871] (-2993.746) (-2990.235) (-2995.494) * (-2996.299) (-2999.824) [-2994.946] (-3002.961) -- 0:03:21
      256000 -- (-2997.447) (-2995.618) [-2988.133] (-2993.698) * (-2999.830) (-2991.743) [-2995.390] (-2999.725) -- 0:03:20
      256500 -- (-2996.739) (-2995.066) [-2992.737] (-2998.605) * (-2995.563) [-2998.484] (-2999.353) (-2992.520) -- 0:03:22
      257000 -- (-2998.021) (-2995.673) (-2991.475) [-2990.745] * (-2997.674) (-2995.579) (-2990.270) [-2997.270] -- 0:03:22
      257500 -- (-2995.453) (-2996.326) [-2993.488] (-2999.471) * (-2994.894) [-2993.986] (-2995.854) (-2995.901) -- 0:03:21
      258000 -- (-2995.316) (-3003.005) (-2992.951) [-2994.047] * (-2996.002) (-2995.906) [-2993.540] (-3005.910) -- 0:03:21
      258500 -- (-2999.522) [-2992.945] (-2997.045) (-2993.723) * [-2994.922] (-2991.639) (-3001.214) (-2998.045) -- 0:03:20
      259000 -- (-2992.328) (-2988.943) (-2991.709) [-2993.156] * [-2991.761] (-2991.832) (-2992.418) (-2998.519) -- 0:03:20
      259500 -- (-3003.909) [-2996.638] (-2993.210) (-2988.150) * [-2993.232] (-3002.413) (-2997.434) (-2990.804) -- 0:03:19
      260000 -- (-2995.593) (-2991.754) (-2993.557) [-2995.545] * (-2994.847) [-2997.239] (-2993.046) (-2998.705) -- 0:03:22

      Average standard deviation of split frequencies: 0.002713

      260500 -- [-2990.939] (-2989.659) (-2994.367) (-2991.081) * [-2994.742] (-2995.060) (-2997.063) (-2994.284) -- 0:03:21
      261000 -- (-2992.708) (-2994.191) (-2998.997) [-2987.009] * (-2993.572) (-2994.340) (-2989.830) [-2992.262] -- 0:03:21
      261500 -- (-2993.585) (-3001.746) [-2994.617] (-2994.256) * (-3000.301) (-2992.332) (-2991.894) [-2992.953] -- 0:03:20
      262000 -- (-2997.961) (-2993.300) (-2997.473) [-2998.393] * (-2997.523) (-2995.916) [-2999.135] (-2992.841) -- 0:03:19
      262500 -- (-2996.771) (-2994.991) (-2989.443) [-2991.835] * (-3003.185) (-2995.795) [-2993.439] (-2997.254) -- 0:03:19
      263000 -- (-2995.068) [-2993.473] (-2997.436) (-2993.996) * (-2995.689) (-2994.201) (-2999.944) [-2996.354] -- 0:03:18
      263500 -- (-2994.269) (-2991.196) (-2992.339) [-2989.796] * [-2995.595] (-2991.708) (-2987.603) (-2997.101) -- 0:03:18
      264000 -- [-2994.886] (-3003.323) (-2992.648) (-2990.666) * (-2995.260) (-2997.761) [-2991.981] (-2998.671) -- 0:03:20
      264500 -- (-2995.375) (-2997.466) [-2994.641] (-2996.615) * (-2996.411) [-2989.709] (-2990.543) (-2993.148) -- 0:03:20
      265000 -- [-2995.517] (-2994.436) (-3000.695) (-2992.105) * (-3004.592) (-2993.086) (-2995.706) [-2995.126] -- 0:03:19

      Average standard deviation of split frequencies: 0.003987

      265500 -- [-2991.575] (-2989.728) (-2996.937) (-2989.776) * (-2993.676) (-2995.410) [-2993.828] (-2998.374) -- 0:03:19
      266000 -- (-2994.965) (-2991.573) (-2993.835) [-2995.075] * (-2992.036) (-3006.039) [-2991.533] (-2992.813) -- 0:03:18
      266500 -- [-2995.530] (-2995.511) (-3004.824) (-2990.524) * (-2997.623) [-2991.452] (-2992.957) (-2999.290) -- 0:03:18
      267000 -- (-2993.604) (-2995.993) [-2996.984] (-2996.466) * [-2989.799] (-2994.321) (-2992.286) (-2995.586) -- 0:03:17
      267500 -- (-2992.922) [-2988.820] (-2997.132) (-2995.547) * (-2995.830) (-3003.743) [-2988.955] (-2994.441) -- 0:03:19
      268000 -- (-2994.972) [-2994.388] (-2996.067) (-2990.777) * (-2999.667) (-2990.825) [-2991.365] (-2996.574) -- 0:03:19
      268500 -- [-2994.803] (-2997.735) (-2994.096) (-2991.198) * (-3002.068) (-2993.974) (-2997.047) [-2993.733] -- 0:03:18
      269000 -- (-2992.779) (-2994.026) (-2999.049) [-2992.491] * (-3000.511) [-2989.590] (-2994.831) (-2995.374) -- 0:03:18
      269500 -- [-2994.826] (-3003.129) (-2992.065) (-2989.826) * (-2998.985) (-2988.623) (-2996.177) [-2990.786] -- 0:03:17
      270000 -- (-2989.247) (-2998.137) (-2994.268) [-2994.623] * (-2994.491) [-2990.255] (-2997.848) (-2994.463) -- 0:03:17

      Average standard deviation of split frequencies: 0.003919

      270500 -- (-3003.268) [-2992.475] (-2998.809) (-2992.742) * (-2997.816) (-2993.245) [-2992.017] (-2994.600) -- 0:03:16
      271000 -- (-2991.606) (-2995.372) [-2994.260] (-2994.308) * (-2991.927) (-2996.919) (-2998.092) [-2992.822] -- 0:03:19
      271500 -- (-2999.599) (-2997.475) [-2998.880] (-2994.838) * [-2990.915] (-2993.804) (-2993.362) (-2993.777) -- 0:03:18
      272000 -- (-2992.462) (-2989.069) [-2997.391] (-3002.447) * (-2995.506) (-3002.300) (-2992.002) [-2990.907] -- 0:03:18
      272500 -- (-3004.306) [-2987.505] (-2996.372) (-2992.004) * (-2992.869) [-2992.611] (-2996.354) (-2993.627) -- 0:03:17
      273000 -- (-2999.543) (-2990.664) (-2998.619) [-2993.790] * [-2991.647] (-2991.650) (-2995.733) (-2998.498) -- 0:03:17
      273500 -- (-3002.689) (-2988.747) (-2993.222) [-2991.133] * (-2993.357) (-2989.273) (-2993.906) [-2996.731] -- 0:03:16
      274000 -- (-2997.709) (-2992.787) [-2993.602] (-2999.080) * [-2995.300] (-2991.408) (-2990.967) (-2998.487) -- 0:03:16
      274500 -- (-3005.374) [-2990.187] (-2990.110) (-2994.414) * (-2995.749) [-2987.253] (-2995.517) (-2999.785) -- 0:03:15
      275000 -- (-2997.785) (-2993.737) [-2991.628] (-2992.036) * (-2995.721) [-2995.098] (-2995.692) (-2998.038) -- 0:03:17

      Average standard deviation of split frequencies: 0.004697

      275500 -- [-3001.574] (-2990.997) (-2989.451) (-2994.177) * [-2994.399] (-2996.668) (-2995.485) (-2998.287) -- 0:03:17
      276000 -- (-3000.630) (-2998.205) [-2994.433] (-2998.707) * [-2999.918] (-2989.358) (-3000.405) (-2988.318) -- 0:03:16
      276500 -- [-2993.921] (-2997.672) (-2994.592) (-2994.718) * (-2993.021) [-2989.076] (-2999.370) (-2994.146) -- 0:03:16
      277000 -- [-2994.610] (-2993.932) (-2997.551) (-2992.267) * (-2995.307) (-2991.777) (-3005.433) [-2993.011] -- 0:03:15
      277500 -- (-2997.943) (-2999.677) [-2993.918] (-2990.572) * (-2996.841) (-2991.035) [-2998.171] (-2990.500) -- 0:03:15
      278000 -- (-2993.305) (-2994.513) [-2992.862] (-2995.490) * [-2994.927] (-2995.236) (-2995.589) (-2996.436) -- 0:03:14
      278500 -- [-2989.074] (-2993.078) (-2993.927) (-3001.504) * (-2993.762) [-2990.696] (-2993.704) (-2998.379) -- 0:03:16
      279000 -- (-2996.351) (-2993.713) [-2996.464] (-2997.773) * (-2992.129) [-2997.412] (-2994.849) (-2994.521) -- 0:03:16
      279500 -- [-2992.226] (-2997.458) (-2991.282) (-2997.960) * (-2994.289) (-2998.547) (-2992.252) [-2992.421] -- 0:03:15
      280000 -- (-2991.056) (-2991.617) (-2994.308) [-2993.652] * [-2991.266] (-2998.688) (-2996.097) (-2990.249) -- 0:03:15

      Average standard deviation of split frequencies: 0.007138

      280500 -- (-2996.518) [-2991.017] (-2995.798) (-2997.100) * [-2994.435] (-2992.184) (-2998.632) (-2992.116) -- 0:03:14
      281000 -- (-2993.597) (-2992.716) [-2989.539] (-2993.726) * (-2995.661) (-2994.134) (-2994.925) [-2992.528] -- 0:03:14
      281500 -- (-2992.484) (-2991.599) [-2992.267] (-2991.829) * (-2991.146) [-2997.048] (-2998.917) (-2996.997) -- 0:03:13
      282000 -- (-2989.286) (-3000.278) [-2992.755] (-2997.720) * [-2991.738] (-2990.857) (-2997.638) (-2993.340) -- 0:03:16
      282500 -- (-2988.344) (-2993.274) (-2994.701) [-2998.657] * (-2991.616) (-2997.804) (-2989.832) [-2990.672] -- 0:03:15
      283000 -- [-3002.267] (-2998.561) (-2994.247) (-2999.164) * (-2990.010) [-2993.759] (-2992.776) (-2996.247) -- 0:03:15
      283500 -- (-2987.160) (-2997.793) [-3000.832] (-2994.887) * [-2999.086] (-2999.633) (-2994.601) (-2994.208) -- 0:03:14
      284000 -- [-2992.450] (-2993.438) (-2990.806) (-2993.888) * (-2997.709) (-2999.915) [-2993.680] (-2991.122) -- 0:03:14
      284500 -- [-2996.782] (-2992.017) (-2995.877) (-2996.460) * (-2990.193) [-2997.452] (-2997.289) (-2992.543) -- 0:03:13
      285000 -- (-2992.572) [-2993.057] (-2992.263) (-2997.667) * (-2995.700) (-2988.867) [-2997.039] (-2997.128) -- 0:03:13

      Average standard deviation of split frequencies: 0.007005

      285500 -- (-2999.750) (-2995.699) [-2988.957] (-2992.382) * [-2997.928] (-2998.115) (-2991.177) (-2999.816) -- 0:03:12
      286000 -- (-2993.265) (-2995.900) (-2999.545) [-2990.281] * (-2996.839) (-2995.326) (-2993.521) [-2993.232] -- 0:03:14
      286500 -- [-2994.867] (-2989.715) (-2992.525) (-2995.364) * (-2990.067) [-2999.001] (-2993.175) (-2993.714) -- 0:03:14
      287000 -- (-2997.256) (-2995.066) [-2994.037] (-2992.685) * [-2993.910] (-2999.600) (-2998.656) (-2995.136) -- 0:03:13
      287500 -- (-2992.679) (-2993.013) (-2989.028) [-2992.178] * (-2993.662) (-2997.002) (-2995.797) [-2994.745] -- 0:03:13
      288000 -- (-2994.173) (-3000.537) [-2995.120] (-2993.777) * (-3000.688) [-2998.185] (-2995.398) (-2995.037) -- 0:03:12
      288500 -- (-2998.851) (-2990.213) [-2994.144] (-2992.673) * (-2995.683) [-2992.094] (-3000.156) (-2990.316) -- 0:03:12
      289000 -- [-2992.376] (-2991.580) (-2991.963) (-2988.802) * [-2989.407] (-2996.468) (-2996.204) (-2997.964) -- 0:03:11
      289500 -- (-2996.340) (-2998.972) (-2991.165) [-2994.224] * (-2997.725) (-3000.953) (-2995.261) [-2994.962] -- 0:03:13
      290000 -- (-2991.545) (-2993.158) [-2991.329] (-2996.060) * [-3000.790] (-3000.205) (-2995.630) (-2991.389) -- 0:03:13

      Average standard deviation of split frequencies: 0.006893

      290500 -- (-2993.596) (-2995.891) (-2990.676) [-2997.783] * (-2997.044) [-2993.527] (-2990.194) (-2993.605) -- 0:03:12
      291000 -- (-2998.479) (-2995.150) [-2993.900] (-2989.474) * (-2993.760) (-2993.418) (-2999.410) [-2994.153] -- 0:03:12
      291500 -- (-2992.251) (-2994.730) (-2997.910) [-2989.113] * (-2999.299) [-2992.792] (-2989.872) (-2992.311) -- 0:03:12
      292000 -- (-2999.736) (-2990.368) [-2993.527] (-2996.040) * (-2994.208) (-2990.311) (-2994.451) [-2990.994] -- 0:03:11
      292500 -- (-2996.800) (-2990.997) (-2999.598) [-2993.589] * (-2995.773) (-2995.196) [-2991.762] (-2999.475) -- 0:03:11
      293000 -- (-2993.588) (-2992.272) [-2991.864] (-2999.384) * (-2996.136) [-2991.354] (-2992.637) (-2995.056) -- 0:03:13
      293500 -- (-2998.344) (-2989.809) (-2999.180) [-2999.439] * (-2997.479) (-2990.903) [-2993.127] (-2994.207) -- 0:03:12
      294000 -- (-2992.484) (-2993.397) [-2994.051] (-2988.770) * (-2994.296) [-2992.964] (-2991.014) (-3009.712) -- 0:03:12
      294500 -- [-2991.139] (-2990.583) (-2991.098) (-2993.735) * [-2994.331] (-2992.331) (-2994.985) (-2991.462) -- 0:03:11
      295000 -- (-2990.458) [-2993.341] (-2990.747) (-2995.016) * (-2988.443) (-2988.525) (-2997.070) [-2992.961] -- 0:03:11

      Average standard deviation of split frequencies: 0.009157

      295500 -- (-2993.189) (-2991.197) [-2986.869] (-2992.515) * [-2992.228] (-2994.732) (-2992.427) (-2994.567) -- 0:03:10
      296000 -- (-2997.621) (-2994.604) (-2996.362) [-2994.844] * (-2992.552) [-2990.912] (-2990.597) (-2993.096) -- 0:03:10
      296500 -- (-2996.767) (-2987.102) (-2999.197) [-3002.140] * (-2990.667) [-2990.659] (-2998.409) (-2994.923) -- 0:03:09
      297000 -- [-2989.011] (-2996.845) (-2993.793) (-2996.001) * (-2992.821) [-2991.817] (-2992.955) (-2995.002) -- 0:03:11
      297500 -- (-2990.195) (-2990.510) (-2992.074) [-2995.819] * (-2998.361) (-2994.344) [-2999.831] (-2993.561) -- 0:03:11
      298000 -- (-2995.781) (-2988.562) (-2989.935) [-2991.932] * [-2992.541] (-2987.525) (-2997.463) (-2991.946) -- 0:03:10
      298500 -- (-2999.970) (-2992.026) (-2993.207) [-2996.737] * (-2994.551) (-2993.185) [-2993.864] (-2988.263) -- 0:03:10
      299000 -- [-2995.484] (-2992.491) (-2992.900) (-2990.568) * (-2991.659) [-2991.593] (-2992.070) (-2993.434) -- 0:03:09
      299500 -- (-2990.572) (-2992.392) [-2992.996] (-2989.749) * [-2992.792] (-2995.702) (-2993.385) (-2991.246) -- 0:03:09
      300000 -- [-2989.783] (-2993.212) (-2994.972) (-2991.072) * (-2996.974) (-2991.429) [-2992.232] (-2989.166) -- 0:03:09

      Average standard deviation of split frequencies: 0.010583

      300500 -- (-2992.906) (-2993.376) (-2990.130) [-2990.440] * (-2995.847) (-2992.794) (-2988.894) [-2992.520] -- 0:03:10
      301000 -- (-2993.783) (-2998.321) (-2998.017) [-2992.659] * (-2993.935) (-2994.555) (-2989.811) [-2989.239] -- 0:03:10
      301500 -- (-2992.096) (-2992.737) [-2995.398] (-2996.723) * (-2999.253) (-2992.897) (-2992.212) [-2993.219] -- 0:03:09
      302000 -- [-2989.936] (-2995.038) (-2986.919) (-2992.260) * [-2992.930] (-2993.072) (-2998.447) (-2998.703) -- 0:03:09
      302500 -- [-2991.294] (-2993.759) (-2989.388) (-2997.800) * (-2991.347) (-2993.644) [-2990.164] (-2996.715) -- 0:03:09
      303000 -- (-2986.824) (-2989.497) [-2992.438] (-2996.192) * (-2992.463) (-3001.146) (-2990.472) [-3000.013] -- 0:03:08
      303500 -- (-2991.399) (-2997.007) [-2995.519] (-2995.594) * [-2992.910] (-2997.095) (-2997.673) (-2997.135) -- 0:03:08
      304000 -- (-2988.365) [-2997.640] (-2993.964) (-2999.335) * [-2992.970] (-2992.841) (-2993.214) (-2991.637) -- 0:03:10
      304500 -- (-2996.969) (-2998.610) [-3000.516] (-3000.746) * (-2995.971) (-2990.152) [-2991.528] (-2991.239) -- 0:03:09
      305000 -- [-2995.389] (-2996.727) (-3001.255) (-2990.932) * (-2999.802) (-2991.592) (-2992.622) [-2990.415] -- 0:03:09

      Average standard deviation of split frequencies: 0.010399

      305500 -- (-3002.720) (-3004.046) [-2993.381] (-2996.031) * (-2995.290) (-2997.092) [-2990.480] (-2997.110) -- 0:03:08
      306000 -- (-2998.880) (-2992.391) [-2990.634] (-2992.410) * (-2994.778) [-2998.199] (-2992.460) (-2996.094) -- 0:03:08
      306500 -- (-2997.145) (-2992.276) [-2989.973] (-2995.456) * [-2989.947] (-2996.383) (-2994.619) (-2995.215) -- 0:03:07
      307000 -- (-2994.141) [-2995.620] (-2994.630) (-2997.119) * (-2989.795) [-2992.324] (-2997.113) (-2989.952) -- 0:03:07
      307500 -- (-2995.903) [-2991.062] (-2991.235) (-2994.938) * (-2997.309) [-2987.063] (-2994.084) (-2994.928) -- 0:03:06
      308000 -- (-2993.934) (-2993.870) (-2989.956) [-2995.637] * (-2998.656) [-2998.917] (-2994.294) (-2997.041) -- 0:03:08
      308500 -- (-2991.312) (-2995.332) [-2991.818] (-2994.577) * (-2995.554) [-2991.489] (-2994.561) (-2989.150) -- 0:03:08
      309000 -- [-2993.832] (-2996.585) (-2991.318) (-2996.079) * (-2996.925) (-2994.374) [-2989.396] (-2989.380) -- 0:03:07
      309500 -- (-2990.259) (-2993.609) [-2999.822] (-2992.611) * (-2999.000) [-2997.875] (-2990.075) (-2992.550) -- 0:03:07
      310000 -- (-2993.552) (-2990.056) (-2994.674) [-2990.401] * (-3003.321) (-2993.433) (-2990.023) [-2988.310] -- 0:03:06

      Average standard deviation of split frequencies: 0.011001

      310500 -- [-2993.351] (-2996.007) (-2992.918) (-2998.357) * (-2992.924) (-2997.748) [-2989.134] (-2993.409) -- 0:03:06
      311000 -- (-2990.044) (-2996.618) [-2987.819] (-2995.428) * (-2990.040) [-2994.003] (-2993.420) (-2994.382) -- 0:03:06
      311500 -- (-3002.610) (-2995.891) (-2991.478) [-2992.392] * [-2990.920] (-2998.577) (-2987.936) (-2992.375) -- 0:03:07
      312000 -- (-2992.817) (-2989.462) [-2995.960] (-2992.052) * (-2991.338) (-2998.134) (-2993.606) [-2992.498] -- 0:03:07
      312500 -- [-2990.065] (-2995.679) (-2996.532) (-2998.672) * (-2993.492) [-2996.739] (-2994.826) (-2991.884) -- 0:03:07
      313000 -- [-2990.359] (-2995.279) (-2990.751) (-2995.053) * (-3000.160) [-2993.283] (-2993.315) (-2994.535) -- 0:03:06
      313500 -- (-2992.593) [-2994.159] (-2988.759) (-2998.650) * [-2993.167] (-3006.272) (-2993.846) (-2994.765) -- 0:03:06
      314000 -- [-2995.494] (-2994.951) (-2990.110) (-2993.135) * [-2990.594] (-2999.472) (-3005.445) (-2996.065) -- 0:03:05
      314500 -- (-2993.735) (-2994.843) (-2995.036) [-2994.952] * (-2999.872) (-3000.869) (-2991.638) [-2992.718] -- 0:03:05
      315000 -- (-3000.870) (-2992.207) [-2991.649] (-2992.546) * (-2997.935) [-2994.657] (-2994.554) (-2999.369) -- 0:03:07

      Average standard deviation of split frequencies: 0.009697

      315500 -- [-2993.842] (-2993.384) (-2992.227) (-2989.739) * (-2994.211) [-2992.149] (-2991.092) (-2997.791) -- 0:03:06
      316000 -- (-2996.238) (-2993.460) (-2993.346) [-2993.751] * (-2999.702) [-2994.054] (-2992.846) (-3000.264) -- 0:03:06
      316500 -- (-2998.769) (-2993.305) [-2987.731] (-2993.571) * (-3002.040) (-2991.439) (-2998.421) [-2990.970] -- 0:03:05
      317000 -- [-2993.979] (-3002.112) (-2991.375) (-2992.788) * [-2997.274] (-2997.315) (-2993.285) (-2992.169) -- 0:03:05
      317500 -- (-2990.162) (-2993.336) (-2991.985) [-2987.980] * (-2996.856) (-2991.002) (-2996.724) [-2989.553] -- 0:03:04
      318000 -- (-2989.121) [-2991.564] (-2994.355) (-2990.150) * (-2990.475) [-2997.016] (-2994.539) (-2993.827) -- 0:03:04
      318500 -- (-2995.206) (-2990.434) [-2995.948] (-2993.783) * [-2993.796] (-2995.212) (-2994.644) (-2999.438) -- 0:03:04
      319000 -- (-2994.563) (-2989.824) (-2997.826) [-2996.178] * (-2999.686) (-2993.031) (-2997.592) [-2993.040] -- 0:03:05
      319500 -- (-3001.244) (-2997.439) (-2999.927) [-2993.706] * (-2993.115) [-2991.551] (-2988.346) (-2995.204) -- 0:03:05
      320000 -- (-2988.178) (-2989.410) (-2997.175) [-2994.880] * (-2987.716) (-2989.208) (-2989.200) [-2985.981] -- 0:03:04

      Average standard deviation of split frequencies: 0.010291

      320500 -- [-2989.885] (-2993.762) (-2995.005) (-2994.899) * (-2996.690) (-2990.982) [-2994.673] (-2997.355) -- 0:03:04
      321000 -- (-2994.984) (-2995.633) (-2999.530) [-2991.154] * (-2990.848) (-2993.173) (-3002.897) [-2992.662] -- 0:03:04
      321500 -- [-2997.458] (-2988.403) (-2987.443) (-2992.089) * (-2998.031) [-2988.516] (-2993.841) (-2995.309) -- 0:03:03
      322000 -- (-3000.232) [-2990.086] (-3000.266) (-2994.119) * (-3000.948) (-2992.248) [-2995.770] (-2992.834) -- 0:03:03
      322500 -- (-2999.525) [-2998.250] (-2991.085) (-2996.574) * (-2996.426) [-2992.832] (-2991.404) (-2993.106) -- 0:03:04
      323000 -- (-2997.733) (-2990.319) [-2990.843] (-2995.226) * (-3001.435) [-2991.675] (-2991.215) (-2992.504) -- 0:03:04
      323500 -- (-2996.902) (-2995.040) (-2992.458) [-2990.274] * (-2994.217) (-2990.594) (-2996.830) [-2993.866] -- 0:03:04
      324000 -- (-2999.377) (-2993.221) (-2996.918) [-2991.026] * (-3003.452) (-2989.478) (-2994.687) [-2999.159] -- 0:03:03
      324500 -- (-2996.530) (-2995.701) [-2989.538] (-2996.910) * (-3001.896) (-2993.015) [-2995.165] (-2996.408) -- 0:03:03
      325000 -- (-3001.178) (-2993.240) [-2989.305] (-3001.075) * [-2990.668] (-2994.766) (-2995.501) (-2994.205) -- 0:03:02

      Average standard deviation of split frequencies: 0.009399

      325500 -- [-2991.069] (-3000.329) (-2995.029) (-2996.221) * [-2989.926] (-2993.192) (-2990.805) (-3000.807) -- 0:03:02
      326000 -- (-3002.283) [-3002.102] (-2989.309) (-2989.380) * (-2995.913) (-2999.066) [-2994.129] (-2996.833) -- 0:03:01
      326500 -- (-2991.926) (-2994.840) [-2995.954] (-2993.621) * (-2999.675) (-2995.283) (-2992.779) [-2998.114] -- 0:03:03
      327000 -- [-2991.892] (-2992.915) (-2992.869) (-2992.329) * (-2994.299) (-2992.320) [-2993.528] (-3003.149) -- 0:03:03
      327500 -- (-2993.194) (-2995.042) [-2989.039] (-2994.923) * (-2993.979) (-2995.362) (-3001.632) [-2998.320] -- 0:03:02
      328000 -- (-2992.504) (-2996.566) (-2997.931) [-2990.823] * (-2990.816) (-2996.371) [-2994.238] (-2990.733) -- 0:03:02
      328500 -- [-2989.492] (-2994.703) (-2990.257) (-2998.335) * (-2991.373) [-2992.048] (-2993.555) (-2991.836) -- 0:03:01
      329000 -- [-2992.610] (-2993.572) (-2990.254) (-2999.651) * (-3000.487) [-2991.883] (-2997.054) (-2989.408) -- 0:03:01
      329500 -- (-2995.173) (-3002.519) [-2987.765] (-2992.178) * (-2997.504) (-2994.309) [-2988.756] (-3000.653) -- 0:03:01
      330000 -- (-2996.157) (-2993.581) [-2995.403] (-2997.620) * (-3000.694) [-2994.585] (-2995.588) (-2996.837) -- 0:03:02

      Average standard deviation of split frequencies: 0.008554

      330500 -- [-2995.480] (-2997.306) (-2994.952) (-2994.621) * (-2993.841) [-2994.587] (-2992.844) (-2990.723) -- 0:03:02
      331000 -- [-2991.489] (-3011.203) (-2989.071) (-2996.737) * (-2991.848) [-2993.729] (-2995.438) (-3000.008) -- 0:03:01
      331500 -- (-2990.556) (-2993.691) [-2990.915] (-2995.576) * (-2990.266) [-2989.523] (-2995.232) (-2997.207) -- 0:03:01
      332000 -- (-2994.232) (-2990.925) [-2994.946] (-2994.049) * (-2991.786) (-2989.666) (-2995.209) [-2995.114] -- 0:03:01
      332500 -- [-2998.364] (-2995.262) (-2990.514) (-2991.725) * (-2990.472) [-3000.145] (-2995.633) (-2994.934) -- 0:03:00
      333000 -- (-2993.064) (-2994.685) [-2989.805] (-2997.018) * (-2990.630) (-2991.457) (-2989.452) [-2992.455] -- 0:03:00
      333500 -- (-2993.513) [-2996.098] (-2994.130) (-2994.556) * (-3001.344) [-2992.922] (-2998.252) (-2999.013) -- 0:03:01
      334000 -- (-3001.289) (-2990.094) [-2993.151] (-2989.596) * (-2999.922) [-2992.286] (-3000.869) (-3001.618) -- 0:03:01
      334500 -- (-3003.155) (-2990.295) (-2997.711) [-2994.799] * (-2992.934) (-2992.214) (-2994.058) [-2997.167] -- 0:03:01
      335000 -- (-2996.784) (-2997.023) [-2999.515] (-2994.738) * [-2996.336] (-2994.276) (-2991.859) (-2997.624) -- 0:03:00

      Average standard deviation of split frequencies: 0.010522

      335500 -- (-2996.949) (-2992.726) [-2991.685] (-2995.209) * (-2991.804) [-2993.648] (-2995.551) (-2995.596) -- 0:03:00
      336000 -- [-2988.256] (-2990.270) (-2993.829) (-2990.353) * [-2998.611] (-2996.135) (-2988.884) (-3001.222) -- 0:02:59
      336500 -- (-2997.472) (-2994.873) (-2995.505) [-2996.005] * (-3000.080) [-2993.972] (-2998.867) (-3000.438) -- 0:02:59
      337000 -- (-2999.646) [-2993.359] (-2991.840) (-2988.308) * (-2997.187) (-2995.531) (-2997.130) [-2991.407] -- 0:02:59
      337500 -- (-2991.390) [-2993.358] (-2991.463) (-2989.792) * (-2998.004) (-2987.107) [-2990.814] (-2989.765) -- 0:03:00
      338000 -- [-2992.327] (-2988.595) (-2994.988) (-2997.522) * (-2993.526) [-2996.619] (-2992.031) (-2992.688) -- 0:03:00
      338500 -- (-2992.557) (-2990.136) (-2999.229) [-2990.738] * (-2996.525) [-2990.468] (-2993.137) (-2994.216) -- 0:02:59
      339000 -- [-2993.992] (-2993.370) (-2991.945) (-2993.854) * (-2992.520) [-2992.371] (-2996.676) (-2990.884) -- 0:02:59
      339500 -- (-2992.975) (-2997.648) [-2996.622] (-2995.487) * (-2989.763) (-2993.845) (-2994.641) [-2994.175] -- 0:02:58
      340000 -- [-2991.856] (-2996.848) (-2996.761) (-2989.346) * [-2988.936] (-2988.865) (-2997.271) (-3005.218) -- 0:02:58

      Average standard deviation of split frequencies: 0.011070

      340500 -- (-2989.958) (-2992.331) (-2998.372) [-2998.876] * (-2993.967) (-3000.174) [-2992.424] (-3001.169) -- 0:02:58
      341000 -- [-2989.138] (-2999.230) (-2998.937) (-2991.698) * [-2988.976] (-2994.865) (-3001.434) (-2996.365) -- 0:02:59
      341500 -- (-2998.268) (-2992.581) (-2993.351) [-2994.778] * (-2988.983) (-3001.498) (-2995.862) [-2994.075] -- 0:02:59
      342000 -- (-2996.991) (-2990.940) [-2994.051] (-3000.888) * (-2993.949) [-2995.387] (-2994.908) (-2995.468) -- 0:02:58
      342500 -- (-2989.780) (-2994.671) [-2989.720] (-2993.085) * (-2998.118) [-2995.666] (-3002.649) (-2992.310) -- 0:02:58
      343000 -- (-2989.576) (-2993.175) [-2989.215] (-2991.350) * (-2995.064) (-2998.365) [-2992.940] (-2995.852) -- 0:02:58
      343500 -- (-2992.047) [-2991.481] (-2997.815) (-2994.982) * (-2995.994) (-2993.081) (-2998.494) [-2996.563] -- 0:02:57
      344000 -- (-2995.654) (-2994.395) (-3005.282) [-2991.496] * (-2993.281) (-2995.470) [-2996.544] (-2998.444) -- 0:02:57
      344500 -- (-2992.861) (-2996.190) (-2990.622) [-2993.856] * (-2996.297) (-2997.009) [-2997.803] (-2994.104) -- 0:02:58
      345000 -- (-2994.337) (-2995.678) (-2991.959) [-2991.872] * (-2997.407) (-2992.954) (-2989.863) [-2998.640] -- 0:02:58

      Average standard deviation of split frequencies: 0.010218

      345500 -- (-2992.911) (-3001.725) [-2989.153] (-2990.221) * (-2993.038) [-2990.157] (-2991.833) (-2998.161) -- 0:02:58
      346000 -- (-2995.835) [-2996.985] (-3000.269) (-2992.775) * (-2993.834) [-2994.255] (-2988.441) (-2994.243) -- 0:02:57
      346500 -- (-2999.163) (-2992.287) (-2988.449) [-3000.073] * [-2990.822] (-2992.072) (-2994.672) (-2996.512) -- 0:02:57
      347000 -- (-2999.101) [-2993.421] (-2990.927) (-2993.212) * (-2994.192) (-2990.967) [-2995.786] (-2990.933) -- 0:02:56
      347500 -- [-2999.126] (-2991.665) (-2991.324) (-2993.885) * (-2995.052) (-2989.020) [-2994.657] (-3001.718) -- 0:02:56
      348000 -- (-2993.657) (-2998.511) [-2988.334] (-2999.664) * (-2992.381) (-2990.242) (-2992.221) [-2990.150] -- 0:02:56
      348500 -- (-2997.552) (-3000.946) (-2993.500) [-2992.230] * (-2989.755) [-3005.668] (-2993.649) (-2998.099) -- 0:02:57
      349000 -- (-2996.549) (-2993.937) (-2992.658) [-2992.367] * [-2991.006] (-2991.939) (-2995.027) (-2994.332) -- 0:02:57
      349500 -- (-2997.047) (-2999.974) [-2991.404] (-2999.084) * [-2994.336] (-2992.479) (-2998.143) (-2996.924) -- 0:02:56
      350000 -- [-2996.151] (-2991.172) (-2992.854) (-3002.764) * (-2993.715) [-2990.901] (-2994.820) (-2998.861) -- 0:02:56

      Average standard deviation of split frequencies: 0.009410

      350500 -- [-2994.633] (-2997.628) (-3000.403) (-3003.803) * [-2987.946] (-2994.816) (-3001.933) (-2995.595) -- 0:02:56
      351000 -- (-2997.256) (-2993.954) (-2993.134) [-2995.233] * (-2989.888) (-2990.675) (-3005.801) [-2997.263] -- 0:02:55
      351500 -- [-2995.021] (-2995.745) (-2995.526) (-2994.416) * (-2995.386) (-2994.081) (-2992.602) [-2993.304] -- 0:02:55
      352000 -- (-2997.309) (-2992.734) [-2992.572] (-2995.969) * [-2996.708] (-2997.617) (-2994.758) (-2995.714) -- 0:02:56
      352500 -- (-2995.332) [-2990.256] (-2993.097) (-2999.143) * (-2998.827) (-2996.174) (-2998.462) [-2993.223] -- 0:02:56
      353000 -- (-2991.645) [-2994.608] (-2995.175) (-3003.377) * (-2990.517) (-3001.440) (-2998.692) [-2994.400] -- 0:02:55
      353500 -- [-2993.550] (-2995.471) (-2992.567) (-2993.382) * (-2992.608) (-3003.673) [-2992.581] (-2991.493) -- 0:02:55
      354000 -- (-2993.964) (-2995.746) [-2989.944] (-2991.028) * (-2994.616) (-3004.693) [-2993.560] (-2992.816) -- 0:02:55
      354500 -- (-2991.646) [-2996.685] (-2991.949) (-2996.255) * (-2997.955) (-2995.044) [-2989.233] (-2994.627) -- 0:02:54
      355000 -- (-2990.831) [-2997.130] (-2996.133) (-2991.990) * (-2998.998) (-2991.055) (-2990.386) [-2993.415] -- 0:02:54

      Average standard deviation of split frequencies: 0.009931

      355500 -- [-2996.990] (-2998.316) (-2998.097) (-2992.656) * (-2997.287) (-3001.595) [-2993.921] (-2997.570) -- 0:02:55
      356000 -- (-2994.241) (-2992.923) (-2993.519) [-2994.338] * (-3000.214) (-2998.102) (-2996.424) [-2997.989] -- 0:02:55
      356500 -- (-2994.505) [-2989.802] (-2995.812) (-3000.879) * (-3005.164) [-2998.110] (-3002.457) (-2999.980) -- 0:02:55
      357000 -- (-2993.497) (-2995.897) (-2994.370) [-3003.814] * (-2999.213) [-2997.876] (-2988.118) (-2997.792) -- 0:02:54
      357500 -- [-2992.327] (-2992.233) (-2997.020) (-2995.197) * (-3004.848) (-2999.979) (-2994.948) [-2993.314] -- 0:02:54
      358000 -- (-2999.442) (-2994.674) [-2993.220] (-2991.066) * (-3003.591) (-2989.514) (-2996.347) [-3000.277] -- 0:02:53
      358500 -- (-2996.971) (-3006.589) (-2993.358) [-2992.134] * (-2994.483) [-2989.975] (-2992.951) (-2990.232) -- 0:02:53
      359000 -- [-2993.340] (-2995.146) (-2997.019) (-2995.746) * (-2995.700) (-2989.419) [-2990.992] (-2992.384) -- 0:02:53
      359500 -- (-2992.600) (-2997.392) [-2993.182] (-2990.720) * (-2998.385) [-2996.304] (-2998.577) (-3001.044) -- 0:02:54
      360000 -- (-2997.428) (-2996.223) (-2997.621) [-2989.259] * [-2993.160] (-2991.602) (-2994.673) (-2997.299) -- 0:02:54

      Average standard deviation of split frequencies: 0.011110

      360500 -- (-2991.307) (-2998.411) (-2993.709) [-2991.393] * (-2996.412) [-2992.405] (-2990.542) (-2992.746) -- 0:02:53
      361000 -- (-2998.483) [-2992.473] (-2992.598) (-2996.930) * (-2997.147) [-2990.072] (-3001.391) (-2994.217) -- 0:02:53
      361500 -- (-2994.244) [-2994.920] (-2988.693) (-2993.952) * (-2994.431) (-2997.285) [-2995.995] (-2993.274) -- 0:02:53
      362000 -- (-2994.635) (-2995.063) (-2990.816) [-2989.425] * (-2991.216) (-3000.367) [-2989.523] (-2990.465) -- 0:02:52
      362500 -- [-2993.947] (-2995.901) (-2991.444) (-2992.353) * (-2991.961) [-2994.521] (-2997.129) (-2992.854) -- 0:02:52
      363000 -- [-2991.004] (-2999.620) (-2997.066) (-2993.105) * [-2993.184] (-2994.977) (-2991.041) (-2991.206) -- 0:02:53
      363500 -- (-2993.962) (-2997.925) (-2991.743) [-2990.610] * (-2990.260) (-2992.816) (-2991.458) [-2991.564] -- 0:02:53
      364000 -- (-2994.231) [-2998.736] (-2995.368) (-2996.148) * (-2999.019) (-2991.724) [-2995.468] (-2993.717) -- 0:02:52
      364500 -- [-2988.673] (-2995.484) (-2993.733) (-2995.241) * [-2994.137] (-2998.033) (-2989.254) (-2992.213) -- 0:02:52
      365000 -- (-2992.405) (-2991.619) [-2997.509] (-2990.924) * [-2995.407] (-2990.933) (-2996.252) (-2991.455) -- 0:02:52

      Average standard deviation of split frequencies: 0.009660

      365500 -- (-2993.618) (-2994.023) (-2991.265) [-2990.430] * (-2992.680) (-2990.717) (-2995.981) [-2993.572] -- 0:02:51
      366000 -- (-2997.377) [-2993.277] (-2995.019) (-2990.598) * (-2993.471) (-2991.535) (-2993.159) [-2995.781] -- 0:02:51
      366500 -- (-2989.271) (-2994.616) [-2994.807] (-3003.450) * (-2999.606) (-2989.266) (-2991.533) [-2993.106] -- 0:02:51
      367000 -- [-2994.614] (-3002.543) (-2992.938) (-2993.117) * [-2991.411] (-2990.047) (-2988.677) (-2991.814) -- 0:02:52
      367500 -- [-2992.349] (-2991.385) (-2994.882) (-2989.508) * (-2986.767) (-2990.437) [-2991.513] (-2994.643) -- 0:02:52
      368000 -- (-2989.462) (-2992.753) [-2993.264] (-2994.371) * (-2993.737) [-2992.248] (-3000.078) (-2998.692) -- 0:02:51
      368500 -- [-2991.319] (-2989.157) (-2993.317) (-2998.428) * (-2993.016) [-2990.222] (-2994.867) (-2993.670) -- 0:02:51
      369000 -- (-2992.185) [-2991.283] (-2991.520) (-2991.471) * (-3000.119) [-3001.961] (-2994.364) (-2990.180) -- 0:02:51
      369500 -- (-2998.649) (-2992.651) [-2989.904] (-2994.725) * (-2997.914) (-2996.601) (-3005.342) [-2992.097] -- 0:02:50
      370000 -- (-2990.225) (-2997.060) (-2995.716) [-2991.124] * (-2999.025) (-3001.491) [-2994.081] (-2993.085) -- 0:02:50

      Average standard deviation of split frequencies: 0.010174

      370500 -- (-2993.466) (-2990.702) (-2992.001) [-2995.774] * (-2996.360) [-2993.848] (-2992.726) (-2991.858) -- 0:02:51
      371000 -- (-2989.019) (-2993.172) (-2992.039) [-2991.580] * (-3000.469) (-2988.039) (-3001.493) [-2988.118] -- 0:02:51
      371500 -- [-2993.972] (-2992.504) (-2991.002) (-2988.697) * [-3000.604] (-2989.602) (-2995.674) (-2987.832) -- 0:02:50
      372000 -- (-2999.856) [-2998.667] (-2994.699) (-2998.472) * (-2999.513) (-2991.753) (-2992.148) [-2995.017] -- 0:02:50
      372500 -- (-2992.558) (-2995.333) [-2989.793] (-2994.330) * [-2994.880] (-2993.194) (-2999.962) (-2999.803) -- 0:02:50
      373000 -- (-2992.556) (-2991.449) [-2992.749] (-2999.047) * (-2995.098) (-2993.029) (-2993.943) [-2989.354] -- 0:02:49
      373500 -- (-2990.502) [-2996.085] (-2992.628) (-2991.067) * (-2995.496) [-2999.861] (-3002.014) (-2988.161) -- 0:02:49
      374000 -- (-2990.750) (-2994.586) [-2995.905] (-2997.954) * [-2993.241] (-2990.755) (-2993.192) (-2991.155) -- 0:02:49
      374500 -- (-2992.237) (-2995.115) [-2988.725] (-2994.205) * (-3005.787) [-2991.808] (-2994.325) (-2997.966) -- 0:02:50
      375000 -- (-2996.842) (-2999.313) [-2991.076] (-2994.911) * (-2991.729) (-2994.033) (-2993.671) [-3000.518] -- 0:02:50

      Average standard deviation of split frequencies: 0.011284

      375500 -- [-2995.899] (-2991.949) (-2988.266) (-2993.564) * [-2991.215] (-2993.742) (-2994.959) (-2997.341) -- 0:02:49
      376000 -- (-2994.120) (-2993.927) (-2992.217) [-2992.678] * (-2992.195) (-2992.560) (-2998.111) [-2992.810] -- 0:02:49
      376500 -- (-2989.854) (-2993.409) (-2992.014) [-2994.493] * (-2993.478) (-3000.132) [-2991.853] (-2993.911) -- 0:02:48
      377000 -- (-2996.972) (-2991.945) [-2991.374] (-2993.797) * (-2990.194) (-2999.050) [-2990.281] (-2990.388) -- 0:02:48
      377500 -- [-2992.731] (-2994.706) (-2995.769) (-2994.072) * (-2992.872) (-2996.847) [-2988.661] (-2997.167) -- 0:02:49
      378000 -- (-2995.892) [-2994.710] (-2995.086) (-2994.340) * (-2999.984) (-2997.654) [-2989.949] (-2994.166) -- 0:02:49
      378500 -- (-2990.101) (-2993.029) (-2994.485) [-2994.054] * (-2992.635) (-2993.392) (-2993.626) [-2994.060] -- 0:02:49
      379000 -- (-2994.791) [-2991.263] (-2991.567) (-2997.086) * (-2995.810) (-2990.599) [-2990.368] (-2989.450) -- 0:02:48
      379500 -- [-2988.895] (-2993.567) (-2988.319) (-2991.344) * (-2989.420) [-2995.770] (-2993.587) (-2992.590) -- 0:02:48
      380000 -- (-2992.750) [-2993.837] (-2991.362) (-2992.153) * (-2990.077) (-2992.656) [-2995.010] (-2992.180) -- 0:02:48

      Average standard deviation of split frequencies: 0.011145

      380500 -- (-2996.611) [-2994.619] (-2996.222) (-2994.781) * (-2998.766) (-2989.435) (-2991.151) [-2990.432] -- 0:02:47
      381000 -- (-2994.591) (-2994.390) (-2990.803) [-2996.693] * (-2994.731) (-2992.893) [-2994.213] (-3003.402) -- 0:02:48
      381500 -- (-2994.265) (-2989.881) [-2991.654] (-2998.123) * (-2993.880) (-2998.860) [-2997.845] (-3000.934) -- 0:02:48
      382000 -- [-2995.036] (-2988.882) (-2993.916) (-2995.250) * (-2992.361) (-2990.097) [-2994.942] (-2993.537) -- 0:02:48
      382500 -- (-2993.638) (-2995.805) [-2995.005] (-2996.800) * (-2993.035) [-2993.791] (-2990.734) (-2996.031) -- 0:02:47
      383000 -- (-2996.373) (-2994.540) (-2992.392) [-2993.771] * [-2997.740] (-2998.016) (-2991.207) (-2997.163) -- 0:02:47
      383500 -- (-3000.819) (-2991.198) [-2996.385] (-2996.297) * (-2995.454) (-2995.629) [-2991.449] (-2994.210) -- 0:02:47
      384000 -- (-2998.509) (-2993.971) (-3003.071) [-2989.564] * (-2993.361) (-2994.397) (-2992.857) [-2992.116] -- 0:02:46
      384500 -- (-2996.096) (-2991.584) (-3002.452) [-2992.948] * (-2995.717) (-2994.107) (-2993.131) [-2989.478] -- 0:02:48
      385000 -- (-2994.859) [-2991.199] (-2991.525) (-2989.158) * (-2995.190) [-2993.653] (-2991.183) (-3000.067) -- 0:02:47

      Average standard deviation of split frequencies: 0.010991

      385500 -- (-2996.511) [-2993.588] (-2991.209) (-2994.460) * (-3004.278) (-2997.515) [-2992.064] (-2993.928) -- 0:02:47
      386000 -- (-2998.645) [-2993.941] (-2995.686) (-2988.864) * (-2992.189) (-2994.544) (-2998.032) [-2991.550] -- 0:02:47
      386500 -- (-3002.191) (-2992.170) [-2994.089] (-2987.638) * (-2996.229) (-2996.780) [-3000.205] (-2994.513) -- 0:02:46
      387000 -- (-2996.246) [-3001.638] (-2997.811) (-2992.951) * [-2991.106] (-2992.778) (-3004.946) (-2991.374) -- 0:02:46
      387500 -- (-2993.976) (-2995.181) (-2994.790) [-2988.853] * (-2996.811) (-2998.543) (-2995.493) [-2994.436] -- 0:02:45
      388000 -- (-2997.522) [-2991.473] (-2995.227) (-2992.760) * (-3003.082) (-2991.383) (-2999.630) [-2991.225] -- 0:02:47
      388500 -- [-2995.162] (-2994.253) (-2991.399) (-2993.785) * (-2997.168) [-2994.439] (-2997.172) (-2994.669) -- 0:02:46
      389000 -- (-3000.970) (-2994.958) [-2991.237] (-2992.043) * (-2995.728) (-2988.940) (-2996.336) [-2991.327] -- 0:02:46
      389500 -- (-2995.468) (-2993.806) [-2989.029] (-2991.533) * [-2996.007] (-2995.034) (-2997.668) (-2991.903) -- 0:02:46
      390000 -- (-2998.045) [-2999.704] (-3000.802) (-2993.163) * [-2992.023] (-2993.976) (-2992.595) (-2995.863) -- 0:02:45

      Average standard deviation of split frequencies: 0.012670

      390500 -- (-2998.432) [-2994.380] (-2995.636) (-2998.695) * (-2999.539) [-2993.739] (-2989.756) (-2991.722) -- 0:02:45
      391000 -- (-2990.061) (-2992.254) (-2995.867) [-2992.886] * [-2988.125] (-3001.134) (-2990.454) (-2998.281) -- 0:02:45
      391500 -- (-2994.800) (-3002.811) (-2992.387) [-2992.197] * (-2991.236) [-2992.605] (-2996.951) (-2995.541) -- 0:02:46
      392000 -- (-2998.857) [-2994.666] (-2990.684) (-2993.542) * (-2993.973) (-2998.656) (-2992.226) [-2996.937] -- 0:02:45
      392500 -- [-2994.158] (-2995.045) (-2993.761) (-2995.289) * (-2990.381) (-2991.454) [-2998.208] (-2996.846) -- 0:02:45
      393000 -- (-2990.438) (-2995.151) [-2995.685] (-2997.759) * (-2991.783) [-2996.089] (-2993.674) (-2997.613) -- 0:02:45
      393500 -- [-2993.423] (-2994.206) (-2997.231) (-2995.815) * [-2990.970] (-2992.237) (-2990.945) (-2998.285) -- 0:02:44
      394000 -- (-2993.452) [-2987.828] (-2995.577) (-2995.697) * [-2994.018] (-2990.837) (-2988.415) (-2993.927) -- 0:02:44
      394500 -- (-2991.618) (-2991.249) [-2995.800] (-2997.474) * [-2992.147] (-2999.191) (-2993.788) (-3004.286) -- 0:02:44
      395000 -- (-2995.422) (-2992.043) [-3003.023] (-2993.220) * (-2996.565) (-3000.255) [-2989.035] (-2991.215) -- 0:02:43

      Average standard deviation of split frequencies: 0.012797

      395500 -- (-2993.712) (-2998.060) (-2995.153) [-2993.492] * (-2996.348) (-2991.807) [-2990.573] (-2988.671) -- 0:02:45
      396000 -- (-2992.529) [-2990.003] (-2997.032) (-3002.365) * (-2988.989) [-2990.731] (-3003.052) (-2993.231) -- 0:02:44
      396500 -- (-2991.170) [-2992.462] (-3005.459) (-2990.844) * (-2990.549) (-2989.514) (-2994.485) [-2997.411] -- 0:02:44
      397000 -- (-2994.280) (-2994.875) [-2995.059] (-2991.244) * (-2989.931) (-2995.447) (-2995.085) [-2995.337] -- 0:02:44
      397500 -- (-2997.290) (-2997.602) [-2996.455] (-2989.547) * (-2992.027) (-2996.899) [-2997.482] (-2995.190) -- 0:02:43
      398000 -- (-2994.856) (-2996.484) (-2995.558) [-2991.319] * [-2991.240] (-2994.107) (-2995.527) (-2997.660) -- 0:02:43
      398500 -- (-2992.570) (-2990.679) [-2998.267] (-2991.632) * [-2992.745] (-2995.776) (-2992.346) (-2994.175) -- 0:02:43
      399000 -- (-2999.828) (-2989.417) [-2993.886] (-2997.555) * (-3001.327) (-2991.198) [-2996.059] (-2996.242) -- 0:02:44
      399500 -- (-2995.639) (-2992.499) (-2997.751) [-2997.336] * (-2989.764) [-2992.872] (-2990.495) (-2996.926) -- 0:02:43
      400000 -- [-2991.712] (-2992.519) (-2995.004) (-2991.219) * (-2994.349) (-2994.693) (-2995.320) [-2991.959] -- 0:02:43

      Average standard deviation of split frequencies: 0.010883

      400500 -- (-2997.065) (-2994.206) (-2998.953) [-2994.564] * (-2996.592) (-2989.836) [-2994.774] (-2995.005) -- 0:02:43
      401000 -- [-2995.938] (-2994.585) (-2998.988) (-2989.099) * [-2998.853] (-3000.992) (-2996.402) (-2999.670) -- 0:02:42
      401500 -- [-2995.876] (-2991.435) (-2990.493) (-2995.347) * (-3005.593) [-2992.161] (-2987.625) (-2996.238) -- 0:02:42
      402000 -- [-2995.327] (-3000.653) (-2995.758) (-2995.758) * (-3000.243) [-2993.212] (-2996.291) (-2995.384) -- 0:02:42
      402500 -- (-2994.110) (-2996.739) (-2992.110) [-2995.177] * (-2993.313) [-2999.837] (-2995.111) (-2998.661) -- 0:02:41
      403000 -- [-2995.623] (-3001.839) (-3001.016) (-2989.945) * [-2992.720] (-2995.236) (-2997.545) (-2992.724) -- 0:02:42
      403500 -- (-2997.895) (-2989.380) [-2995.725] (-2990.836) * (-2988.946) (-2999.305) [-2996.262] (-2992.866) -- 0:02:42
      404000 -- (-2990.924) [-2995.983] (-3003.936) (-2996.188) * (-2988.853) [-2994.113] (-2994.429) (-2997.312) -- 0:02:42
      404500 -- (-2992.844) [-2991.300] (-3000.851) (-2993.606) * (-2992.183) [-2997.008] (-2996.480) (-2993.139) -- 0:02:41
      405000 -- [-2991.375] (-2993.655) (-2995.285) (-2992.996) * (-2994.952) (-2991.989) [-2990.033] (-2996.931) -- 0:02:41

      Average standard deviation of split frequencies: 0.008128

      405500 -- (-2995.570) (-2993.682) (-3000.580) [-2995.463] * [-2990.765] (-2995.600) (-2990.343) (-2999.324) -- 0:02:41
      406000 -- (-3000.135) (-2990.496) [-2992.344] (-2994.298) * (-2991.283) (-2995.941) (-2993.798) [-2996.124] -- 0:02:40
      406500 -- (-2990.440) (-2998.793) [-2994.825] (-2990.569) * (-2997.495) (-2996.362) [-2993.642] (-2992.122) -- 0:02:42
      407000 -- (-2991.807) (-3001.837) [-2994.138] (-2991.787) * [-2998.595] (-2994.525) (-2992.214) (-2996.112) -- 0:02:41
      407500 -- [-2994.044] (-3000.282) (-3001.464) (-2995.264) * (-2994.547) (-2994.400) [-2995.276] (-2996.487) -- 0:02:41
      408000 -- [-2993.134] (-2998.271) (-2998.559) (-2992.395) * (-2992.024) (-2999.796) [-2992.000] (-2992.446) -- 0:02:41
      408500 -- (-2997.248) (-2997.951) [-2993.703] (-2995.577) * [-2999.834] (-2997.664) (-2996.802) (-2992.349) -- 0:02:40
      409000 -- (-2991.500) (-2995.273) (-2996.580) [-2993.490] * (-2993.094) (-2997.782) [-2993.371] (-3001.615) -- 0:02:40
      409500 -- (-2999.181) (-2998.436) (-2993.416) [-2991.724] * (-2993.117) [-2991.913] (-2988.826) (-3000.165) -- 0:02:40
      410000 -- [-2992.562] (-2995.154) (-2993.600) (-2991.894) * (-2997.293) (-2999.575) [-2991.653] (-3001.212) -- 0:02:41

      Average standard deviation of split frequencies: 0.008609

      410500 -- [-2989.158] (-2991.135) (-2993.345) (-2996.947) * (-2991.749) (-2992.387) [-3000.668] (-2995.417) -- 0:02:40
      411000 -- (-2994.326) (-2993.625) (-2994.658) [-2993.842] * (-2996.748) [-2996.031] (-2992.464) (-2991.922) -- 0:02:40
      411500 -- (-2992.273) (-2990.986) (-2996.436) [-2989.913] * [-2994.327] (-2997.320) (-2996.267) (-2994.143) -- 0:02:40
      412000 -- [-2988.490] (-2998.068) (-2992.568) (-2992.970) * (-2994.752) (-3003.003) [-2993.235] (-2993.461) -- 0:02:39
      412500 -- (-2992.573) (-2989.792) (-2991.915) [-2996.442] * (-2993.995) (-2996.912) (-2998.594) [-2990.173] -- 0:02:39
      413000 -- [-2991.017] (-2993.276) (-2996.347) (-2997.426) * (-2998.290) [-2995.463] (-2992.115) (-2994.620) -- 0:02:39
      413500 -- (-2992.926) [-2989.807] (-2999.773) (-2993.912) * (-3001.808) (-2993.097) [-2993.766] (-2989.074) -- 0:02:40
      414000 -- (-2991.287) (-3000.023) [-2996.102] (-2997.993) * (-2998.106) (-2992.465) (-2988.256) [-2994.186] -- 0:02:39
      414500 -- (-2998.211) (-2993.949) (-2995.527) [-2999.478] * (-2990.778) (-2992.443) [-2990.119] (-2989.585) -- 0:02:39
      415000 -- (-2990.827) (-2993.148) (-2994.917) [-2990.918] * (-2995.027) (-2994.015) (-2991.329) [-2991.770] -- 0:02:39

      Average standard deviation of split frequencies: 0.009632

      415500 -- (-2998.438) [-2997.406] (-2992.916) (-2997.574) * (-3000.334) (-2994.554) (-2995.438) [-2996.545] -- 0:02:38
      416000 -- (-2989.865) (-2992.909) (-2993.326) [-2994.491] * [-2994.693] (-2995.664) (-2993.731) (-2998.698) -- 0:02:38
      416500 -- [-2991.870] (-2990.895) (-2993.626) (-2993.011) * (-2997.085) (-2996.179) (-2994.821) [-3000.905] -- 0:02:38
      417000 -- (-2991.928) (-2990.594) [-2994.717] (-3000.649) * (-2995.019) (-2997.448) [-2996.055] (-2993.077) -- 0:02:37
      417500 -- [-2992.589] (-2994.140) (-2999.292) (-2995.055) * (-2992.645) [-2994.376] (-2987.009) (-2993.660) -- 0:02:39
      418000 -- (-2992.283) (-2992.288) (-2996.975) [-2995.442] * (-2998.354) [-2991.860] (-2992.366) (-2994.081) -- 0:02:38
      418500 -- [-2995.704] (-2989.379) (-2994.594) (-2992.581) * [-2989.571] (-2993.380) (-2991.198) (-2990.979) -- 0:02:38
      419000 -- (-2994.187) [-2987.911] (-2991.846) (-2992.937) * (-2997.155) [-2997.780] (-2992.072) (-2997.568) -- 0:02:38
      419500 -- (-2997.977) [-2991.584] (-3004.372) (-2990.132) * (-2994.885) (-2996.484) [-2992.103] (-3003.085) -- 0:02:37
      420000 -- (-2997.263) (-2990.744) (-2994.685) [-2990.014] * (-2990.720) (-2992.994) [-2990.512] (-2992.044) -- 0:02:37

      Average standard deviation of split frequencies: 0.009525

      420500 -- [-2998.988] (-2998.446) (-2996.039) (-2991.478) * (-2994.461) [-3000.751] (-2994.135) (-2993.668) -- 0:02:37
      421000 -- (-3005.112) [-2989.852] (-2995.926) (-2995.603) * (-2990.233) (-2997.566) [-2993.840] (-2997.389) -- 0:02:38
      421500 -- (-2996.999) (-2988.458) [-2989.515] (-2990.899) * (-2999.092) (-2992.092) (-2994.337) [-2999.811] -- 0:02:37
      422000 -- (-2991.735) [-2990.220] (-2992.199) (-2995.255) * (-2992.714) [-2997.348] (-2997.808) (-2993.744) -- 0:02:37
      422500 -- (-2996.797) (-2995.156) (-3001.120) [-2995.308] * [-2990.216] (-2995.452) (-2995.164) (-3007.717) -- 0:02:37
      423000 -- (-3001.612) (-2999.048) [-2991.953] (-2994.025) * (-2990.946) (-2997.532) [-2994.417] (-2998.350) -- 0:02:36
      423500 -- (-2999.603) (-2996.381) [-2996.088] (-2987.110) * [-2999.482] (-2991.988) (-2993.253) (-2992.274) -- 0:02:36
      424000 -- (-2989.919) (-2995.171) [-2993.322] (-2994.411) * (-2991.191) (-2994.495) (-2995.322) [-2990.016] -- 0:02:36
      424500 -- (-2987.165) (-2990.913) [-2998.163] (-2988.821) * (-2993.940) (-2994.343) (-2992.203) [-2989.309] -- 0:02:37
      425000 -- [-2992.013] (-2990.944) (-2991.706) (-3002.114) * (-2992.674) [-2994.765] (-2991.916) (-2993.134) -- 0:02:36

      Average standard deviation of split frequencies: 0.009406

      425500 -- (-2994.242) (-2995.378) [-2991.500] (-2994.309) * (-2990.351) [-2989.335] (-2994.528) (-2993.624) -- 0:02:36
      426000 -- [-2991.067] (-2992.993) (-2990.250) (-2994.855) * (-2995.677) (-2994.854) [-2994.115] (-2989.868) -- 0:02:36
      426500 -- (-2993.894) [-2991.344] (-3003.629) (-2993.731) * (-2992.736) [-2993.745] (-2992.415) (-2998.224) -- 0:02:35
      427000 -- (-2997.169) (-2989.410) (-2999.021) [-2993.016] * (-2994.357) [-2990.092] (-2988.280) (-2997.771) -- 0:02:35
      427500 -- (-2996.254) [-2991.792] (-2996.658) (-2991.899) * (-3003.235) (-2994.372) (-2991.029) [-2991.427] -- 0:02:35
      428000 -- (-2997.295) (-2994.603) [-2992.094] (-2993.210) * (-2994.390) (-2995.052) [-2990.123] (-2995.579) -- 0:02:35
      428500 -- [-2993.523] (-3000.913) (-2992.630) (-2990.110) * (-3005.090) (-2998.969) [-2991.740] (-2995.218) -- 0:02:36
      429000 -- (-2990.839) [-2993.803] (-2989.956) (-2994.831) * (-2989.661) (-2995.638) [-2992.808] (-2990.500) -- 0:02:35
      429500 -- (-2990.214) (-2995.234) [-2992.881] (-2996.052) * (-2992.278) [-2991.753] (-2994.663) (-2993.377) -- 0:02:35
      430000 -- (-2991.189) [-3003.755] (-2989.720) (-2994.897) * (-2988.065) (-2993.510) (-2991.036) [-2995.034] -- 0:02:35

      Average standard deviation of split frequencies: 0.010946

      430500 -- (-2995.749) (-2994.978) [-2992.712] (-3002.669) * (-2991.860) (-2991.738) (-2996.281) [-2998.059] -- 0:02:34
      431000 -- (-2996.319) (-2993.688) [-3004.909] (-2996.422) * (-2991.671) [-2996.892] (-2999.082) (-2999.021) -- 0:02:34
      431500 -- [-2991.130] (-2998.827) (-2996.556) (-2994.579) * (-3000.722) (-2998.445) [-2989.056] (-2989.807) -- 0:02:34
      432000 -- (-2999.677) [-2997.443] (-2996.996) (-3001.672) * (-2994.715) (-2996.949) [-2990.925] (-2989.700) -- 0:02:35
      432500 -- (-2999.211) (-2997.812) [-2992.912] (-2994.405) * [-2992.278] (-2993.865) (-2991.172) (-2990.976) -- 0:02:34
      433000 -- (-2996.055) [-2992.826] (-2999.908) (-2994.109) * (-2993.915) (-2991.817) [-2990.932] (-2992.801) -- 0:02:34
      433500 -- (-2996.980) (-2996.619) (-2992.669) [-2996.439] * (-2990.113) (-2993.229) [-2993.498] (-2990.238) -- 0:02:34
      434000 -- (-2994.705) (-2989.300) (-2992.219) [-2990.316] * (-2996.695) (-3000.510) (-2992.742) [-2992.059] -- 0:02:33
      434500 -- (-2994.274) (-2989.498) (-2999.693) [-2991.997] * (-2992.972) (-3002.507) (-2994.697) [-2989.538] -- 0:02:33
      435000 -- (-2997.676) [-2989.728] (-2995.959) (-2994.010) * (-2992.820) [-2992.193] (-2989.884) (-2992.860) -- 0:02:33

      Average standard deviation of split frequencies: 0.012434

      435500 -- (-2993.518) [-3000.348] (-2989.098) (-2990.143) * [-2990.616] (-2997.117) (-2992.357) (-2994.218) -- 0:02:32
      436000 -- [-2992.264] (-2996.990) (-2987.075) (-2998.950) * [-2991.940] (-2986.002) (-2997.898) (-2993.159) -- 0:02:33
      436500 -- (-2991.310) [-2998.702] (-2999.622) (-2996.761) * (-2996.994) [-2989.174] (-2997.322) (-2992.572) -- 0:02:33
      437000 -- [-2991.002] (-2994.923) (-2991.119) (-2995.872) * (-2996.227) (-3001.857) [-2990.893] (-2994.923) -- 0:02:33
      437500 -- [-2998.983] (-2997.001) (-2996.302) (-2999.207) * (-2993.105) (-2996.435) (-2989.492) [-2993.210] -- 0:02:33
      438000 -- [-2994.445] (-2993.102) (-2995.054) (-2996.847) * (-2990.370) (-2997.819) [-2992.193] (-2990.674) -- 0:02:32
      438500 -- [-3002.419] (-3001.063) (-3000.999) (-2996.910) * (-2994.003) (-2992.776) (-2996.936) [-2995.168] -- 0:02:32
      439000 -- (-3000.320) (-2992.226) [-2994.582] (-2997.902) * (-2993.953) (-2991.519) [-2997.638] (-2992.909) -- 0:02:32
      439500 -- (-3002.222) [-2996.118] (-2993.337) (-3002.655) * [-2990.587] (-2991.980) (-2992.392) (-2990.862) -- 0:02:33
      440000 -- [-2993.540] (-2991.279) (-2989.148) (-2995.861) * (-2996.313) [-2989.999] (-2991.596) (-2999.338) -- 0:02:32

      Average standard deviation of split frequencies: 0.011767

      440500 -- (-2998.057) [-2995.092] (-2990.971) (-2995.978) * (-2988.673) [-2991.375] (-2994.687) (-2993.391) -- 0:02:32
      441000 -- (-2999.022) (-2991.905) [-2989.330] (-2991.736) * (-2989.427) [-2987.965] (-2990.903) (-2998.568) -- 0:02:32
      441500 -- (-3001.421) [-2989.397] (-2989.115) (-2995.272) * [-2993.284] (-2992.242) (-2991.195) (-2992.612) -- 0:02:31
      442000 -- [-2994.933] (-2997.189) (-2994.433) (-2995.718) * (-2992.167) [-2996.835] (-2994.536) (-2993.737) -- 0:02:31
      442500 -- (-2995.833) [-2998.223] (-2991.536) (-2995.264) * [-2990.590] (-2999.694) (-2993.072) (-2992.035) -- 0:02:31
      443000 -- (-2995.871) (-2992.578) (-2995.363) [-2998.015] * (-3003.066) (-3004.237) [-2996.595] (-2987.912) -- 0:02:32
      443500 -- (-2996.848) (-2993.351) [-2994.773] (-3006.121) * (-2989.188) (-3003.175) (-2996.558) [-2987.821] -- 0:02:31
      444000 -- [-2992.504] (-3001.481) (-2991.406) (-2993.098) * [-2992.610] (-3000.750) (-2997.351) (-2990.580) -- 0:02:31
      444500 -- (-2988.567) (-2992.305) (-2992.811) [-2994.628] * (-2995.471) [-2994.061] (-2993.826) (-2991.606) -- 0:02:31
      445000 -- (-2995.042) [-2991.874] (-2990.338) (-3002.975) * [-2990.570] (-2994.337) (-2995.648) (-2999.841) -- 0:02:30

      Average standard deviation of split frequencies: 0.011891

      445500 -- [-2992.578] (-2995.283) (-2995.719) (-2994.706) * (-2996.351) (-3000.918) [-2990.020] (-2990.820) -- 0:02:30
      446000 -- (-2999.341) [-2995.532] (-2994.324) (-2998.343) * (-2988.082) (-2997.717) [-2992.730] (-3001.078) -- 0:02:30
      446500 -- (-2998.035) [-2993.726] (-2998.302) (-3005.089) * (-2992.500) (-2995.005) (-2991.980) [-2992.200] -- 0:02:29
      447000 -- (-2998.002) (-2990.214) [-2989.356] (-3001.609) * (-2993.122) [-2993.753] (-2993.138) (-2991.439) -- 0:02:30
      447500 -- (-2991.504) (-2991.880) (-2989.118) [-2998.779] * [-2994.329] (-2997.240) (-2992.796) (-2994.079) -- 0:02:30
      448000 -- (-2987.426) [-2996.724] (-2993.794) (-2995.815) * (-2994.418) (-2999.239) (-2997.957) [-2995.943] -- 0:02:30
      448500 -- (-2992.819) [-2990.345] (-2989.199) (-2993.559) * [-2994.308] (-2999.754) (-2999.787) (-2997.643) -- 0:02:30
      449000 -- (-2994.301) (-2996.786) (-2989.803) [-2995.970] * (-2989.878) [-2990.545] (-2990.221) (-2997.356) -- 0:02:29
      449500 -- (-2993.791) [-2990.665] (-2991.497) (-2990.246) * (-2992.246) (-2995.247) [-2993.300] (-2996.977) -- 0:02:29
      450000 -- (-2992.450) [-2997.323] (-2994.999) (-2994.830) * [-2995.240] (-2989.476) (-2991.716) (-2993.984) -- 0:02:29

      Average standard deviation of split frequencies: 0.012291

      450500 -- (-2994.369) (-2990.527) (-2995.269) [-2995.972] * (-2996.537) (-2992.253) [-2995.203] (-2994.585) -- 0:02:30
      451000 -- (-2995.499) [-2994.215] (-2994.782) (-2996.283) * [-2996.520] (-2996.364) (-2993.834) (-2991.758) -- 0:02:29
      451500 -- [-2992.343] (-2992.590) (-3003.785) (-2992.563) * (-2997.277) (-2992.102) [-2990.308] (-2999.563) -- 0:02:29
      452000 -- (-2990.871) (-2997.463) [-2995.879] (-2997.840) * (-2993.193) (-3001.588) [-2990.991] (-2998.300) -- 0:02:29
      452500 -- (-2991.149) (-2998.495) (-2992.756) [-2993.181] * (-2999.251) [-2990.283] (-2992.591) (-2997.947) -- 0:02:28
      453000 -- (-2993.777) (-2988.540) [-2990.469] (-2995.801) * (-3004.806) [-2992.331] (-2998.720) (-2994.222) -- 0:02:28
      453500 -- (-2993.563) (-2991.940) [-2996.665] (-2998.859) * (-2998.548) [-2993.581] (-2994.052) (-2995.278) -- 0:02:28
      454000 -- (-2988.802) [-2988.813] (-2994.173) (-3000.643) * (-2996.374) (-2992.281) (-2992.077) [-2994.303] -- 0:02:27
      454500 -- [-2994.122] (-2993.128) (-2992.517) (-2993.740) * (-2987.858) (-2994.655) [-2993.622] (-2996.220) -- 0:02:28
      455000 -- (-2991.607) (-2989.874) [-2994.815] (-2994.670) * (-2992.923) (-2994.261) [-2997.112] (-2991.748) -- 0:02:28

      Average standard deviation of split frequencies: 0.010596

      455500 -- (-2989.605) (-2998.310) [-2992.347] (-2999.451) * (-2990.597) (-2994.153) [-2995.229] (-2992.433) -- 0:02:28
      456000 -- (-2998.064) (-2994.422) (-2991.253) [-2993.355] * (-3005.085) [-2995.900] (-2989.984) (-2992.588) -- 0:02:27
      456500 -- (-2997.337) (-2998.912) [-2993.649] (-2996.198) * [-2993.217] (-2994.701) (-2991.838) (-2994.796) -- 0:02:27
      457000 -- [-2997.587] (-2992.807) (-2993.286) (-2997.369) * (-2994.450) [-2993.251] (-2998.519) (-2992.851) -- 0:02:27
      457500 -- (-2993.580) [-2996.067] (-2993.923) (-2992.529) * (-2993.725) [-2990.784] (-2992.653) (-2999.333) -- 0:02:27
      458000 -- (-2994.551) (-2988.136) [-2990.066] (-2993.847) * (-2993.651) (-2989.864) (-2999.580) [-2991.110] -- 0:02:27
      458500 -- (-2993.770) (-2995.240) [-2992.356] (-2999.771) * (-3000.925) (-2995.220) [-2993.464] (-2990.511) -- 0:02:27
      459000 -- [-2992.472] (-2994.060) (-2989.748) (-2997.480) * [-2995.122] (-2992.250) (-2990.103) (-2988.976) -- 0:02:27
      459500 -- (-2992.774) (-2994.354) [-2992.013] (-2994.253) * [-2989.480] (-3003.923) (-2993.868) (-2995.381) -- 0:02:27
      460000 -- (-2992.629) [-2991.611] (-2997.239) (-2996.679) * (-2995.001) (-2997.242) (-2996.748) [-2992.712] -- 0:02:26

      Average standard deviation of split frequencies: 0.011512

      460500 -- [-2989.337] (-2995.555) (-3000.829) (-3000.079) * (-2998.373) (-2995.644) [-2995.566] (-2997.114) -- 0:02:26
      461000 -- (-2998.821) [-2995.848] (-2996.798) (-3000.628) * (-2989.925) (-2994.749) [-2995.458] (-2994.816) -- 0:02:26
      461500 -- [-3000.772] (-2992.306) (-2995.526) (-2992.120) * (-2994.303) (-3000.022) [-2991.067] (-2991.853) -- 0:02:27
      462000 -- (-2995.501) [-2996.065] (-3002.119) (-3004.548) * (-2996.293) [-2993.522] (-2990.343) (-2992.494) -- 0:02:26
      462500 -- [-2993.220] (-2997.381) (-2997.840) (-2989.865) * (-2994.347) (-2987.872) [-2996.145] (-2994.103) -- 0:02:26
      463000 -- (-3000.514) (-2991.692) (-2996.997) [-2991.276] * (-2997.528) (-2994.339) [-2993.692] (-2990.256) -- 0:02:26
      463500 -- (-2995.716) [-2992.635] (-2994.025) (-2995.651) * (-2992.760) [-2988.830] (-2993.548) (-2994.663) -- 0:02:25
      464000 -- (-2998.099) (-2998.411) [-2997.127] (-2995.024) * [-2993.972] (-2995.608) (-2991.984) (-3000.503) -- 0:02:25
      464500 -- (-2993.376) [-2994.365] (-2994.497) (-3001.701) * (-2998.075) [-2987.570] (-2993.114) (-3009.614) -- 0:02:25
      465000 -- (-2990.446) (-2991.684) (-2993.291) [-2997.527] * (-2995.875) (-2991.406) [-2995.938] (-2991.798) -- 0:02:26

      Average standard deviation of split frequencies: 0.011380

      465500 -- (-3000.380) (-2994.235) [-2990.958] (-2993.305) * (-2995.198) [-2994.474] (-2995.628) (-2991.503) -- 0:02:25
      466000 -- (-2998.717) (-3002.933) [-2995.683] (-3000.762) * (-2994.723) [-2992.042] (-2991.992) (-2988.629) -- 0:02:25
      466500 -- (-2989.278) (-2995.282) (-2996.994) [-2990.008] * (-2993.713) [-2993.466] (-2999.503) (-2996.117) -- 0:02:25
      467000 -- (-2989.630) (-2993.340) [-2988.896] (-2991.192) * [-2995.063] (-2992.200) (-2994.434) (-2993.669) -- 0:02:24
      467500 -- (-2995.561) [-2996.221] (-2993.113) (-2995.588) * [-2994.847] (-3001.623) (-2990.731) (-2997.292) -- 0:02:24
      468000 -- (-2990.109) (-2995.123) [-2987.590] (-3000.315) * (-2993.597) [-3000.239] (-2992.724) (-2991.187) -- 0:02:24
      468500 -- [-2993.191] (-2998.003) (-2987.894) (-2995.184) * (-2998.024) (-2993.726) (-2993.658) [-2996.586] -- 0:02:25
      469000 -- (-2992.659) [-2990.988] (-2991.776) (-2993.772) * (-3000.109) (-2992.333) [-2993.565] (-2996.518) -- 0:02:24
      469500 -- (-2993.193) (-2992.597) (-3000.883) [-2991.700] * [-2995.472] (-2994.779) (-2990.431) (-2993.462) -- 0:02:24
      470000 -- (-2996.564) [-2996.348] (-2992.996) (-2996.023) * (-2992.621) (-2996.389) [-2990.980] (-3002.559) -- 0:02:24

      Average standard deviation of split frequencies: 0.011268

      470500 -- (-2991.964) (-2999.530) [-2994.682] (-2999.647) * [-2990.399] (-2996.536) (-2994.491) (-2994.386) -- 0:02:24
      471000 -- (-2995.232) (-2996.110) [-2995.120] (-3000.267) * [-2997.647] (-2992.740) (-2997.917) (-2993.044) -- 0:02:23
      471500 -- (-2998.622) (-2995.272) [-2991.046] (-2998.343) * (-2990.955) (-2995.614) (-3002.634) [-2996.655] -- 0:02:23
      472000 -- (-2999.134) (-2994.463) (-2993.380) [-2995.402] * (-2995.853) [-2996.331] (-2998.814) (-2993.810) -- 0:02:24
      472500 -- (-2994.907) (-2998.227) [-2996.111] (-2993.680) * (-2995.640) [-2997.991] (-2998.337) (-2992.791) -- 0:02:24
      473000 -- (-2996.542) (-3001.583) (-2986.781) [-2994.237] * [-2992.100] (-2991.965) (-3003.194) (-2995.533) -- 0:02:23
      473500 -- (-3005.509) (-2995.049) [-2993.752] (-2995.539) * (-3003.508) [-2991.135] (-3003.545) (-2991.264) -- 0:02:23
      474000 -- (-3002.308) (-2993.777) (-2996.382) [-2996.320] * [-2988.286] (-2989.363) (-2994.863) (-2995.420) -- 0:02:23
      474500 -- [-2991.648] (-2998.773) (-2991.319) (-2994.660) * (-3000.312) [-2988.939] (-2990.959) (-2994.915) -- 0:02:22
      475000 -- (-2999.497) [-2994.125] (-2996.855) (-2994.974) * (-2990.673) (-2991.665) (-2989.128) [-2994.010] -- 0:02:22

      Average standard deviation of split frequencies: 0.011389

      475500 -- (-2991.489) [-2998.490] (-2987.866) (-2991.971) * (-2995.316) [-2988.944] (-3005.206) (-2991.569) -- 0:02:23
      476000 -- (-3002.886) (-2992.495) (-2991.907) [-2987.877] * [-2995.207] (-2994.862) (-2996.414) (-2991.635) -- 0:02:23
      476500 -- (-2995.623) (-2997.265) (-2992.029) [-2990.550] * (-2994.173) (-2999.106) [-2986.417] (-2994.858) -- 0:02:22
      477000 -- (-2996.840) (-3001.119) [-2996.192] (-2992.110) * [-2996.375] (-2996.868) (-2990.727) (-2992.792) -- 0:02:22
      477500 -- (-2990.624) (-2992.824) (-2990.022) [-2990.475] * (-2992.768) [-2994.158] (-3000.248) (-2993.151) -- 0:02:22
      478000 -- (-2989.997) (-2999.860) (-2993.817) [-2998.797] * (-2994.303) (-2999.573) [-2989.802] (-2990.697) -- 0:02:21
      478500 -- (-2989.770) (-2991.180) [-2997.827] (-2991.305) * (-2990.768) (-2993.311) [-2990.867] (-2996.790) -- 0:02:21
      479000 -- (-2998.777) (-2994.471) (-2998.427) [-2993.177] * (-2997.500) (-2992.205) [-2999.455] (-2997.284) -- 0:02:21
      479500 -- (-2996.802) [-2998.006] (-2995.079) (-3002.624) * (-2993.837) (-3002.979) [-2998.941] (-2997.317) -- 0:02:22
      480000 -- (-2991.488) (-2989.213) [-2993.177] (-2993.034) * (-2994.274) [-2992.534] (-2991.272) (-2996.676) -- 0:02:21

      Average standard deviation of split frequencies: 0.011769

      480500 -- (-2993.498) (-2990.918) [-2998.354] (-3000.323) * [-2990.600] (-2995.179) (-3003.089) (-2992.376) -- 0:02:21
      481000 -- (-3000.425) [-2996.022] (-2996.543) (-2998.479) * (-2991.251) (-2997.087) [-2996.701] (-2992.400) -- 0:02:21
      481500 -- [-2991.925] (-2992.814) (-2993.659) (-2997.821) * (-3003.007) (-3005.980) (-2996.684) [-2994.494] -- 0:02:21
      482