--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 11 16:27:21 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/2/AANATL2-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1484.94 -1494.53
2 -1484.95 -1493.99
--------------------------------------
TOTAL -1484.95 -1494.29
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.231392 0.001117 0.169930 0.293619 0.228649 1218.57 1219.97 1.000
r(A<->C){all} 0.084643 0.000871 0.034808 0.147252 0.081325 816.41 1005.45 1.000
r(A<->G){all} 0.201219 0.001870 0.119448 0.283015 0.198436 665.35 732.17 1.001
r(A<->T){all} 0.156534 0.002253 0.068148 0.248888 0.153326 804.07 863.29 1.000
r(C<->G){all} 0.121737 0.000879 0.069276 0.182365 0.119716 827.36 852.23 1.000
r(C<->T){all} 0.345141 0.003412 0.234909 0.458154 0.342609 531.66 598.45 1.000
r(G<->T){all} 0.090725 0.001065 0.033651 0.156954 0.087223 1015.22 1015.60 1.000
pi(A){all} 0.208111 0.000226 0.180470 0.239449 0.207801 1102.61 1108.55 1.000
pi(C){all} 0.297055 0.000285 0.263879 0.329969 0.296898 888.63 1030.16 1.000
pi(G){all} 0.314855 0.000305 0.280120 0.348069 0.314520 934.91 1117.15 1.000
pi(T){all} 0.179979 0.000202 0.152208 0.208811 0.179672 1162.88 1222.54 1.000
alpha{1,2} 0.245096 0.067406 0.000190 0.707010 0.172594 1165.36 1212.08 1.000
alpha{3} 1.366100 0.415777 0.310552 2.630068 1.251412 1235.16 1314.08 1.001
pinvar{all} 0.150071 0.012539 0.000012 0.365107 0.126820 1218.20 1293.60 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1389.016799
Model 2: PositiveSelection -1389.016799
Model 0: one-ratio -1391.937253
Model 3: discrete -1387.557753
Model 7: beta -1387.947843
Model 8: beta&w>1 -1387.947885
Model 0 vs 1 5.840908000000127
Model 2 vs 1 0.0
Model 8 vs 7 8.400000024266774E-5
>C1
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C2
MSAITIRAMTVGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGLVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C3
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C4
MSAISIRAMRMEDFDEVEAFLAEHFFKQEPLMLIPQEDPKQSEVIPAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEHKEAVCLL
DKIHKFLAGIERQANIFEHYGVKRALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYPLVTSTCTNMNSRRLMTALHMECVLTKDYADYKDEHGEIVL
QASEPHTSASVVAIRL
>C5
MSAITIRAMRMEDYEEVEAFLAVHFFKQEPLMLIPQEDPRQSEVIPAEAE
LHRSLIPQDLSLVAVDGQRIVGVALAGEQVPEDLEREYQEAEHKEVACLL
DKIHKFLAGIERQANIFEHYGVERALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYSVVTSTCTNMNSRRLMTALHMECVLSKDYADYKDEHGQIVL
RASEPHTSASVLAIRL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=216
C1 MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAE
C2 MSAITIRAMTVGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
C3 MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
C4 MSAISIRAMRMEDFDEVEAFLAEHFFKQEPLMLIPQEDPKQSEVIPAEAE
C5 MSAITIRAMRMEDYEEVEAFLAVHFFKQEPLMLIPQEDPRQSEVIPAEAE
****:**** : *::******* ****************:**** .**:*
C1 LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCLL
C2 LHRALIPQDLSLVAVDGQRIVGLVLAGELVPEDLEREYQEAEQKEITCLL
C3 LHRALIPQDLSLVAVDGQRIVGVVLAGELVPEDLEREYQEAEQKEITCLL
C4 LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEHKEAVCLL
C5 LHRSLIPQDLSLVAVDGQRIVGVALAGEQVPEDLEREYQEAEHKEVACLL
***:*************:****:.**** *************:** .***
C1 DKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEAT
C2 DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
C3 DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
C4 DKIHKFLAGIERQANIFEHYGVKRALYLYMLGVDTSVRRQRVGTRLVEAT
C5 DKIHKFLAGIERQANIFEHYGVERALYLYMLGVDTSVRRQRVGTRLVEAT
*********** *****:****.***********.*:*************
C1 IELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVL
C2 IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
C3 IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
C4 IELGRQRGYPLVTSTCTNMNSRRLMTALHMECVLTKDYADYKDEHGEIVL
C5 IELGRQRGYSVVTSTCTNMNSRRLMTALHMECVLSKDYADYKDEHGQIVL
********:.:*****:* **:******:***:*:***********:***
C1 RASEPHTSASVVAIRL
C2 RASEPHTSASVVAIRL
C3 RASEPHTSASVVAIRL
C4 QASEPHTSASVVAIRL
C5 RASEPHTSASVLAIRL
:**********:****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4320]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4320]--->[4320]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/2/AANATL2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.270 Mb, Max= 30.521 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C2
MSAITIRAMTVGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGLVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C3
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C4
MSAISIRAMRMEDFDEVEAFLAEHFFKQEPLMLIPQEDPKQSEVIPAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEHKEAVCLL
DKIHKFLAGIERQANIFEHYGVKRALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYPLVTSTCTNMNSRRLMTALHMECVLTKDYADYKDEHGEIVL
QASEPHTSASVVAIRL
>C5
MSAITIRAMRMEDYEEVEAFLAVHFFKQEPLMLIPQEDPRQSEVIPAEAE
LHRSLIPQDLSLVAVDGQRIVGVALAGEQVPEDLEREYQEAEHKEVACLL
DKIHKFLAGIERQANIFEHYGVERALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYSVVTSTCTNMNSRRLMTALHMECVLSKDYADYKDEHGQIVL
RASEPHTSASVLAIRL
FORMAT of file /tmp/tmp7405067174748472222aln Not Supported[FATAL:T-COFFEE]
>C1
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C2
MSAITIRAMTVGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGLVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C3
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C4
MSAISIRAMRMEDFDEVEAFLAEHFFKQEPLMLIPQEDPKQSEVIPAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEHKEAVCLL
DKIHKFLAGIERQANIFEHYGVKRALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYPLVTSTCTNMNSRRLMTALHMECVLTKDYADYKDEHGEIVL
QASEPHTSASVVAIRL
>C5
MSAITIRAMRMEDYEEVEAFLAVHFFKQEPLMLIPQEDPRQSEVIPAEAE
LHRSLIPQDLSLVAVDGQRIVGVALAGEQVPEDLEREYQEAEHKEVACLL
DKIHKFLAGIERQANIFEHYGVERALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYSVVTSTCTNMNSRRLMTALHMECVLSKDYADYKDEHGQIVL
RASEPHTSASVLAIRL
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:216 S:100 BS:216
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 95.37 C1 C2 95.37
TOP 1 0 95.37 C2 C1 95.37
BOT 0 2 96.30 C1 C3 96.30
TOP 2 0 96.30 C3 C1 96.30
BOT 0 3 88.89 C1 C4 88.89
TOP 3 0 88.89 C4 C1 88.89
BOT 0 4 88.43 C1 C5 88.43
TOP 4 0 88.43 C5 C1 88.43
BOT 1 2 99.07 C2 C3 99.07
TOP 2 1 99.07 C3 C2 99.07
BOT 1 3 87.50 C2 C4 87.50
TOP 3 1 87.50 C4 C2 87.50
BOT 1 4 87.50 C2 C5 87.50
TOP 4 1 87.50 C5 C2 87.50
BOT 2 3 87.96 C3 C4 87.96
TOP 3 2 87.96 C4 C3 87.96
BOT 2 4 87.96 C3 C5 87.96
TOP 4 2 87.96 C5 C3 87.96
BOT 3 4 92.13 C4 C5 92.13
TOP 4 3 92.13 C5 C4 92.13
AVG 0 C1 * 92.25
AVG 1 C2 * 92.36
AVG 2 C3 * 92.82
AVG 3 C4 * 89.12
AVG 4 C5 * 89.00
TOT TOT * 91.11
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCAGCGATCACCATACGCGCCATGACAATCGGGGATTACGAGGAGGT
C2 ATGTCAGCGATCACCATACGCGCCATGACAGTTGGGGATTACGAGGAGGT
C3 ATGTCAGCGATCACCATACGCGCCATGACAATTGGGGATTACGAGGAGGT
C4 ATGTCAGCGATCAGCATACGCGCCATGAGAATGGAGGACTTCGACGAGGT
C5 ATGTCAGCGATCACCATACGCGCCATGAGAATGGAGGATTACGAGGAGGT
************* ************** *.* *.*** *:*** *****
C1 CGAGGCCTTTCTCGCAGTGCACTTCTTCAAGCAGGAGCCGCTAATGCTGA
C2 CGAGGCCTTTCTCGCAGTGCATTTCTTCAAGCAGGAGCCGCTGATGCTGA
C3 CGAGGCCTTTCTCGCAGTGCATTTCTTCAAGCAGGAGCCGCTGATGCTGA
C4 CGAGGCCTTTCTCGCGGAGCACTTCTTCAAGCAGGAGCCGCTGATGCTGA
C5 CGAGGCCTTTCTCGCGGTGCACTTCTTCAAGCAGGAGCCGCTGATGCTGA
***************.*:*** ********************.*******
C1 TCCCCCAGGAGGATCCCAAGCAGAGCGAGGTGTCTTCCGCGGAGGCTGAG
C2 TCCCCCAGGAGGATCCCAAGCAGAGCGAAGTGTCTCCTGCGGAGACTGAG
C3 TCCCCCAGGAGGATCCCAAGCAGAGCGAAGTGTCTCCTGCGGAGACTGAG
C4 TCCCGCAGGAGGACCCCAAGCAGAGCGAGGTGATTCCCGCCGAGGCAGAG
C5 TCCCCCAGGAGGATCCCAGGCAGAGCGAGGTGATTCCCGCCGAGGCTGAG
**** ******** ****.*********.***: * * ** ***.*:***
C1 CTACACCGCTCGCTCATACCCCAGGATCTCTCCCTGGTGGCCGTCGACGG
C2 CTCCATCGTGCGCTCATACCCCAGGATCTTTCTCTGGTGGCCGTCGACGG
C3 CTCCATCGTGCGCTCATACCCCAGGATCTCTCCCTGGTGGCCGTCGACGG
C4 CTGCACCGCTCGCTCATACCCCAGGATCTCTCACTGGTGGCCGTCGACGG
C5 CTGCACCGCTCGCTCATTCCCCAGGATCTCTCCCTGGTGGCCGTCGACGG
** ** ** *******:*********** ** *****************
C1 GGAGCGCATTGTGGGCGTGGTTCTGGCCGGTGAATTGGTACCCGAGGATC
C2 GCAGCGCATTGTCGGCCTGGTTCTGGCCGGTGAACTGGTGCCCGAGGATC
C3 GCAGCGCATTGTGGGCGTGGTTCTGGCCGGTGAACTGGTGCCCGAGGATC
C4 GGAGCGCATTGTGGGCGTCGTTCTGGCCGGTGAACTGGTGCCCGAGGATC
C5 GCAGCGCATTGTGGGCGTGGCTCTGGCTGGGGAACAGGTGCCCGAGGACC
* ********** *** * * ****** ** *** :***.******** *
C1 TGGAGAGGGAGTACCAGGAGGCTGAGCAGAAGGAGATCACGTGCCTGCTG
C2 TGGAGAGGGAGTACCAGGAGGCGGAGCAGAAGGAGATCACGTGCCTGCTG
C3 TGGAGAGGGAGTACCAGGAGGCGGAGCAGAAGGAGATCACGTGCCTGCTG
C4 TGGAGCGGGAGTACCAGGAGGCTGAGCACAAGGAGGCGGTGTGCCTGCTG
C5 TGGAGAGGGAGTACCAGGAGGCTGAGCACAAGGAGGTCGCGTGCCTGCTG
*****.**************** ***** ******. . **********
C1 GACAAGATACACAAGTTTCTGGCCGGGATCGAGCGGCAGGCCAATATCTT
C2 GACAAGATACACAAGTTTCTGGCCGGGATCGAGCTGCAGGCTAACATATT
C3 GACAAGATACACAAGTTTCTGGCCGGGATCGAGCTGCAAGCCAACATATT
C4 GACAAGATACACAAGTTTCTGGCCGGCATCGAGCGGCAGGCCAACATCTT
C5 GACAAGATACACAAGTTTCTGGCCGGGATCGAGCGGCAGGCCAACATCTT
************************** ******* ***.** ** **.**
C1 CAAGCACTACGGAGTGGAGCGGGCGCTTTACCTGTACATGCTCGGTGTGG
C2 CAAGCACTACGGAGTGGATCGGGCGCTGTACCTCTACATGCTCGGTGTGG
C3 CAAGCACTACGGAGTGGATCGGGCGCTGTACCTCTACATGCTCGGTGTGG
C4 CGAGCACTACGGTGTGAAGCGGGCCCTCTACCTCTACATGCTCGGTGTGG
C5 CGAGCACTACGGAGTGGAGCGGGCCCTCTACCTCTACATGCTCGGTGTGG
*.**********:***.* ***** ** ***** ****************
C1 ACGTGTCCATTCGACGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
C2 ACACCTCCATTCGGCGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACA
C3 ACACGTCCATTCGGCGGCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
C4 ACACTTCCGTGCGGCGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
C5 ACACCTCCGTGCGGCGTCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
**. ***.* **.** ********************************.
C1 ATTGAGCTGGGTCGCCAGCGTGGATTTCCCGTCGTCACATCTACCTGCAG
C2 ATTGAGCTGGGTCGCCAGCGGGGATTCCCCGTCGTCACATCTACCTGCAG
C3 ATTGAGCTGGGTCGCCAGCGGGGATTCCCCGTCGTCACATCTACCTGCAG
C4 ATTGAGCTGGGTCGCCAGCGGGGCTACCCCCTTGTGACGTCTACCTGCAC
C5 ATTGAGCTGGGTCGCCAGCGGGGATACTCCGTTGTGACATCCACCTGCAC
******************** **.*: ** * ** **.** *******
C1 CAACCAGAACTCCAAACGCCTTATGACCGCCCTAAACATGGAGTGCATAC
C2 CAACCTGAACTCCAAACGCCTTATGACCGCCCTGAACATGGAGTGCATAC
C3 CAACCTGAACTCCAAACGCCTTATGACCGCCCTGAACATGGAGTGCATAC
C4 CAACATGAACTCCCGGCGCCTCATGACCGCCCTGCACATGGAGTGCGTCC
C5 CAACATGAACTCCAGGCGCCTCATGACCGCCCTGCACATGGAGTGCGTCC
****.:*******...***** ***********..***********.*.*
C1 TCACAAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG
C2 TCACGAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG
C3 TCACGAAGGATTACGCGGACTACAAGGATGAGCACGGGGAGATCGTCCTG
C4 TCACGAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG
C5 TCTCGAAGGACTACGCGGACTACAAGGACGAGCACGGGCAGATCGTCCTG
**:*.***** ***************** ********* ***********
C1 CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGACTG
C2 CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGGCTG
C3 CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGGCTG
C4 CAGGCATCCGAACCCCACACCTCCGCCAGTGTCGTGGCCATACGACTG
C5 CGGGCATCCGAACCCCACACCTCCGCCAGTGTCTTGGCCATACGACTG
*.*********.**.****************** **********.***
>C1
ATGTCAGCGATCACCATACGCGCCATGACAATCGGGGATTACGAGGAGGT
CGAGGCCTTTCTCGCAGTGCACTTCTTCAAGCAGGAGCCGCTAATGCTGA
TCCCCCAGGAGGATCCCAAGCAGAGCGAGGTGTCTTCCGCGGAGGCTGAG
CTACACCGCTCGCTCATACCCCAGGATCTCTCCCTGGTGGCCGTCGACGG
GGAGCGCATTGTGGGCGTGGTTCTGGCCGGTGAATTGGTACCCGAGGATC
TGGAGAGGGAGTACCAGGAGGCTGAGCAGAAGGAGATCACGTGCCTGCTG
GACAAGATACACAAGTTTCTGGCCGGGATCGAGCGGCAGGCCAATATCTT
CAAGCACTACGGAGTGGAGCGGGCGCTTTACCTGTACATGCTCGGTGTGG
ACGTGTCCATTCGACGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
ATTGAGCTGGGTCGCCAGCGTGGATTTCCCGTCGTCACATCTACCTGCAG
CAACCAGAACTCCAAACGCCTTATGACCGCCCTAAACATGGAGTGCATAC
TCACAAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG
CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGACTG
>C2
ATGTCAGCGATCACCATACGCGCCATGACAGTTGGGGATTACGAGGAGGT
CGAGGCCTTTCTCGCAGTGCATTTCTTCAAGCAGGAGCCGCTGATGCTGA
TCCCCCAGGAGGATCCCAAGCAGAGCGAAGTGTCTCCTGCGGAGACTGAG
CTCCATCGTGCGCTCATACCCCAGGATCTTTCTCTGGTGGCCGTCGACGG
GCAGCGCATTGTCGGCCTGGTTCTGGCCGGTGAACTGGTGCCCGAGGATC
TGGAGAGGGAGTACCAGGAGGCGGAGCAGAAGGAGATCACGTGCCTGCTG
GACAAGATACACAAGTTTCTGGCCGGGATCGAGCTGCAGGCTAACATATT
CAAGCACTACGGAGTGGATCGGGCGCTGTACCTCTACATGCTCGGTGTGG
ACACCTCCATTCGGCGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACA
ATTGAGCTGGGTCGCCAGCGGGGATTCCCCGTCGTCACATCTACCTGCAG
CAACCTGAACTCCAAACGCCTTATGACCGCCCTGAACATGGAGTGCATAC
TCACGAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG
CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGGCTG
>C3
ATGTCAGCGATCACCATACGCGCCATGACAATTGGGGATTACGAGGAGGT
CGAGGCCTTTCTCGCAGTGCATTTCTTCAAGCAGGAGCCGCTGATGCTGA
TCCCCCAGGAGGATCCCAAGCAGAGCGAAGTGTCTCCTGCGGAGACTGAG
CTCCATCGTGCGCTCATACCCCAGGATCTCTCCCTGGTGGCCGTCGACGG
GCAGCGCATTGTGGGCGTGGTTCTGGCCGGTGAACTGGTGCCCGAGGATC
TGGAGAGGGAGTACCAGGAGGCGGAGCAGAAGGAGATCACGTGCCTGCTG
GACAAGATACACAAGTTTCTGGCCGGGATCGAGCTGCAAGCCAACATATT
CAAGCACTACGGAGTGGATCGGGCGCTGTACCTCTACATGCTCGGTGTGG
ACACGTCCATTCGGCGGCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
ATTGAGCTGGGTCGCCAGCGGGGATTCCCCGTCGTCACATCTACCTGCAG
CAACCTGAACTCCAAACGCCTTATGACCGCCCTGAACATGGAGTGCATAC
TCACGAAGGATTACGCGGACTACAAGGATGAGCACGGGGAGATCGTCCTG
CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGGCTG
>C4
ATGTCAGCGATCAGCATACGCGCCATGAGAATGGAGGACTTCGACGAGGT
CGAGGCCTTTCTCGCGGAGCACTTCTTCAAGCAGGAGCCGCTGATGCTGA
TCCCGCAGGAGGACCCCAAGCAGAGCGAGGTGATTCCCGCCGAGGCAGAG
CTGCACCGCTCGCTCATACCCCAGGATCTCTCACTGGTGGCCGTCGACGG
GGAGCGCATTGTGGGCGTCGTTCTGGCCGGTGAACTGGTGCCCGAGGATC
TGGAGCGGGAGTACCAGGAGGCTGAGCACAAGGAGGCGGTGTGCCTGCTG
GACAAGATACACAAGTTTCTGGCCGGCATCGAGCGGCAGGCCAACATCTT
CGAGCACTACGGTGTGAAGCGGGCCCTCTACCTCTACATGCTCGGTGTGG
ACACTTCCGTGCGGCGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
ATTGAGCTGGGTCGCCAGCGGGGCTACCCCCTTGTGACGTCTACCTGCAC
CAACATGAACTCCCGGCGCCTCATGACCGCCCTGCACATGGAGTGCGTCC
TCACGAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG
CAGGCATCCGAACCCCACACCTCCGCCAGTGTCGTGGCCATACGACTG
>C5
ATGTCAGCGATCACCATACGCGCCATGAGAATGGAGGATTACGAGGAGGT
CGAGGCCTTTCTCGCGGTGCACTTCTTCAAGCAGGAGCCGCTGATGCTGA
TCCCCCAGGAGGATCCCAGGCAGAGCGAGGTGATTCCCGCCGAGGCTGAG
CTGCACCGCTCGCTCATTCCCCAGGATCTCTCCCTGGTGGCCGTCGACGG
GCAGCGCATTGTGGGCGTGGCTCTGGCTGGGGAACAGGTGCCCGAGGACC
TGGAGAGGGAGTACCAGGAGGCTGAGCACAAGGAGGTCGCGTGCCTGCTG
GACAAGATACACAAGTTTCTGGCCGGGATCGAGCGGCAGGCCAACATCTT
CGAGCACTACGGAGTGGAGCGGGCCCTCTACCTCTACATGCTCGGTGTGG
ACACCTCCGTGCGGCGTCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC
ATTGAGCTGGGTCGCCAGCGGGGATACTCCGTTGTGACATCCACCTGCAC
CAACATGAACTCCAGGCGCCTCATGACCGCCCTGCACATGGAGTGCGTCC
TCTCGAAGGACTACGCGGACTACAAGGACGAGCACGGGCAGATCGTCCTG
CGGGCATCCGAACCCCACACCTCCGCCAGTGTCTTGGCCATACGACTG
>C1
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C2
MSAITIRAMTVGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGLVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C3
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
LHRALIPQDLSLVAVDGQRIVGVVLAGELVPEDLEREYQEAEQKEITCLL
DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
RASEPHTSASVVAIRL
>C4
MSAISIRAMRMEDFDEVEAFLAEHFFKQEPLMLIPQEDPKQSEVIPAEAE
LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEHKEAVCLL
DKIHKFLAGIERQANIFEHYGVKRALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYPLVTSTCTNMNSRRLMTALHMECVLTKDYADYKDEHGEIVL
QASEPHTSASVVAIRL
>C5
MSAITIRAMRMEDYEEVEAFLAVHFFKQEPLMLIPQEDPRQSEVIPAEAE
LHRSLIPQDLSLVAVDGQRIVGVALAGEQVPEDLEREYQEAEHKEVACLL
DKIHKFLAGIERQANIFEHYGVERALYLYMLGVDTSVRRQRVGTRLVEAT
IELGRQRGYSVVTSTCTNMNSRRLMTALHMECVLSKDYADYKDEHGQIVL
RASEPHTSASVLAIRL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 648 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478881424
Setting output file names to "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 456513200
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2482720199
Seed = 706023346
Swapseed = 1478881424
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 22 unique site patterns
Division 2 has 22 unique site patterns
Division 3 has 44 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1813.938725 -- -25.624409
Chain 2 -- -1810.265344 -- -25.624409
Chain 3 -- -1725.711368 -- -25.624409
Chain 4 -- -1818.172212 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1825.839822 -- -25.624409
Chain 2 -- -1807.224169 -- -25.624409
Chain 3 -- -1825.944809 -- -25.624409
Chain 4 -- -1809.102903 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1813.939] (-1810.265) (-1725.711) (-1818.172) * [-1825.840] (-1807.224) (-1825.945) (-1809.103)
500 -- (-1499.144) [-1493.422] (-1501.024) (-1495.418) * (-1496.173) (-1505.619) [-1496.509] (-1500.639) -- 0:00:00
1000 -- (-1489.822) (-1494.965) (-1488.965) [-1493.361] * (-1492.515) (-1499.141) [-1490.909] (-1496.581) -- 0:00:00
1500 -- [-1487.345] (-1492.246) (-1498.139) (-1493.683) * (-1491.722) (-1496.435) (-1486.963) [-1489.882] -- 0:00:00
2000 -- (-1492.626) (-1493.704) [-1490.617] (-1485.842) * (-1487.000) (-1496.662) [-1486.062] (-1492.576) -- 0:00:00
2500 -- (-1488.110) [-1488.700] (-1489.959) (-1484.832) * [-1485.416] (-1488.923) (-1488.055) (-1493.604) -- 0:00:00
3000 -- [-1491.034] (-1489.956) (-1490.988) (-1490.377) * (-1486.046) (-1488.542) [-1486.888] (-1488.281) -- 0:00:00
3500 -- (-1489.649) (-1491.453) [-1488.151] (-1487.587) * [-1485.081] (-1484.025) (-1485.402) (-1486.216) -- 0:00:00
4000 -- (-1490.503) (-1489.784) [-1494.922] (-1492.116) * [-1486.951] (-1489.307) (-1486.357) (-1484.544) -- 0:00:00
4500 -- [-1487.895] (-1489.003) (-1492.822) (-1487.359) * (-1485.987) (-1489.409) [-1486.412] (-1487.040) -- 0:00:00
5000 -- (-1485.855) [-1491.546] (-1489.753) (-1488.277) * [-1490.005] (-1486.362) (-1491.381) (-1488.045) -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- (-1486.348) (-1490.235) (-1486.895) [-1487.772] * (-1483.728) (-1484.922) [-1497.285] (-1488.439) -- 0:03:00
6000 -- [-1485.602] (-1489.204) (-1487.573) (-1497.490) * [-1490.475] (-1484.181) (-1489.184) (-1498.021) -- 0:02:45
6500 -- (-1487.851) (-1486.681) (-1485.725) [-1485.773] * (-1493.318) (-1491.186) [-1485.531] (-1500.873) -- 0:02:32
7000 -- (-1490.087) (-1487.217) (-1488.568) [-1486.053] * (-1486.727) (-1489.904) [-1491.012] (-1495.208) -- 0:02:21
7500 -- (-1492.972) (-1487.221) (-1492.913) [-1499.919] * [-1485.754] (-1498.577) (-1486.368) (-1490.759) -- 0:02:12
8000 -- (-1499.189) [-1484.127] (-1493.111) (-1490.451) * (-1486.931) [-1487.554] (-1491.966) (-1490.422) -- 0:02:04
8500 -- [-1492.691] (-1487.156) (-1497.339) (-1493.483) * (-1486.514) (-1488.619) (-1489.295) [-1490.297] -- 0:01:56
9000 -- (-1486.253) (-1487.195) [-1484.259] (-1487.607) * (-1487.484) (-1491.433) (-1485.299) [-1489.094] -- 0:01:50
9500 -- [-1486.185] (-1486.915) (-1495.207) (-1488.728) * (-1486.733) (-1488.832) (-1485.802) [-1497.483] -- 0:01:44
10000 -- [-1488.557] (-1490.849) (-1487.816) (-1496.293) * (-1490.129) (-1488.582) (-1487.115) [-1484.842] -- 0:01:39
Average standard deviation of split frequencies: 0.000000
10500 -- (-1484.846) [-1485.860] (-1483.590) (-1488.744) * (-1491.386) [-1486.394] (-1486.805) (-1486.116) -- 0:01:34
11000 -- (-1485.629) [-1487.474] (-1489.035) (-1485.072) * (-1491.885) [-1485.229] (-1489.016) (-1490.658) -- 0:01:29
11500 -- [-1485.978] (-1486.203) (-1491.876) (-1487.451) * (-1490.975) (-1491.550) (-1490.407) [-1491.591] -- 0:02:51
12000 -- (-1487.770) [-1486.752] (-1493.331) (-1493.003) * (-1486.835) [-1487.661] (-1491.660) (-1488.448) -- 0:02:44
12500 -- (-1489.535) [-1495.880] (-1494.085) (-1491.077) * [-1486.194] (-1488.085) (-1494.200) (-1487.148) -- 0:02:38
13000 -- (-1485.746) (-1489.730) (-1492.318) [-1488.071] * (-1485.572) [-1486.908] (-1496.250) (-1486.848) -- 0:02:31
13500 -- (-1492.836) [-1490.191] (-1491.273) (-1485.248) * [-1486.867] (-1485.985) (-1489.779) (-1486.248) -- 0:02:26
14000 -- [-1492.862] (-1491.733) (-1485.402) (-1481.774) * (-1484.857) [-1492.720] (-1492.482) (-1488.761) -- 0:02:20
14500 -- [-1489.322] (-1489.973) (-1491.354) (-1482.286) * [-1486.336] (-1487.346) (-1490.243) (-1486.205) -- 0:02:15
15000 -- (-1490.252) (-1486.283) [-1485.528] (-1489.234) * (-1485.934) [-1485.367] (-1485.086) (-1487.112) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
15500 -- (-1485.249) [-1488.900] (-1493.874) (-1491.714) * (-1488.767) (-1488.087) [-1492.965] (-1484.814) -- 0:02:07
16000 -- (-1489.093) (-1490.463) (-1484.669) [-1487.416] * (-1485.955) (-1487.149) (-1489.254) [-1486.916] -- 0:02:03
16500 -- [-1490.297] (-1495.406) (-1485.276) (-1484.821) * (-1485.213) [-1487.146] (-1489.594) (-1485.264) -- 0:01:59
17000 -- [-1482.655] (-1492.277) (-1487.588) (-1487.327) * (-1493.506) (-1490.481) (-1489.031) [-1487.249] -- 0:01:55
17500 -- (-1486.004) (-1486.611) [-1484.070] (-1485.962) * (-1487.121) (-1491.421) (-1488.943) [-1494.025] -- 0:01:52
18000 -- (-1484.778) (-1495.188) [-1484.102] (-1488.204) * [-1490.619] (-1490.255) (-1486.989) (-1485.242) -- 0:02:43
18500 -- (-1487.488) (-1491.777) (-1492.936) [-1484.807] * (-1491.310) (-1486.454) (-1487.781) [-1486.341] -- 0:02:39
19000 -- (-1482.972) (-1489.112) [-1486.842] (-1485.439) * (-1487.711) [-1488.503] (-1484.656) (-1494.371) -- 0:02:34
19500 -- (-1492.985) (-1493.592) [-1483.230] (-1488.399) * [-1492.326] (-1488.449) (-1487.482) (-1489.714) -- 0:02:30
20000 -- [-1487.993] (-1491.440) (-1484.190) (-1489.220) * (-1485.697) (-1489.897) [-1487.911] (-1487.888) -- 0:02:27
Average standard deviation of split frequencies: 0.000000
20500 -- (-1496.439) (-1492.932) (-1489.602) [-1484.486] * (-1491.168) (-1490.542) (-1489.216) [-1491.663] -- 0:02:23
21000 -- [-1487.516] (-1485.131) (-1488.220) (-1486.046) * (-1493.037) (-1486.903) (-1486.461) [-1485.484] -- 0:02:19
21500 -- [-1485.073] (-1490.410) (-1484.278) (-1487.898) * (-1491.225) (-1491.516) [-1487.340] (-1485.038) -- 0:02:16
22000 -- (-1486.928) [-1485.940] (-1487.914) (-1484.083) * [-1487.491] (-1492.615) (-1485.718) (-1487.436) -- 0:02:13
22500 -- [-1491.369] (-1494.939) (-1490.506) (-1487.477) * [-1485.671] (-1493.938) (-1489.819) (-1485.650) -- 0:02:10
23000 -- (-1487.027) (-1488.113) (-1486.315) [-1484.565] * (-1489.512) (-1486.061) [-1490.509] (-1495.046) -- 0:02:07
23500 -- (-1486.980) (-1495.072) (-1492.243) [-1487.553] * (-1487.585) (-1490.211) (-1491.271) [-1484.183] -- 0:02:04
24000 -- (-1492.392) (-1490.515) (-1489.359) [-1485.173] * [-1487.763] (-1490.892) (-1488.738) (-1492.182) -- 0:02:42
24500 -- [-1487.762] (-1486.470) (-1489.783) (-1488.541) * (-1485.011) [-1485.022] (-1489.899) (-1493.984) -- 0:02:39
25000 -- (-1487.139) (-1489.781) [-1487.573] (-1481.675) * (-1486.476) [-1483.643] (-1488.385) (-1491.613) -- 0:02:36
Average standard deviation of split frequencies: 0.000000
25500 -- (-1487.958) [-1485.518] (-1489.574) (-1484.844) * (-1482.979) [-1483.607] (-1484.790) (-1494.137) -- 0:02:32
26000 -- (-1486.081) (-1488.923) (-1489.143) [-1485.275] * [-1491.077] (-1482.416) (-1488.201) (-1490.185) -- 0:02:29
26500 -- (-1489.984) (-1492.823) (-1484.817) [-1486.435] * (-1488.282) (-1487.671) [-1484.569] (-1485.291) -- 0:02:26
27000 -- [-1486.446] (-1487.847) (-1486.881) (-1488.667) * (-1486.994) (-1490.040) (-1486.948) [-1486.982] -- 0:02:24
27500 -- [-1481.842] (-1483.475) (-1490.809) (-1493.263) * (-1493.581) (-1488.904) [-1486.798] (-1487.066) -- 0:02:21
28000 -- (-1485.766) (-1485.817) [-1485.678] (-1492.795) * (-1493.114) (-1488.791) [-1490.918] (-1485.107) -- 0:02:18
28500 -- (-1488.706) (-1486.511) (-1485.057) [-1484.408] * (-1492.669) (-1487.675) [-1483.910] (-1488.579) -- 0:02:16
29000 -- (-1487.938) (-1496.235) [-1483.633] (-1492.402) * [-1487.719] (-1488.943) (-1488.585) (-1486.551) -- 0:02:13
29500 -- (-1487.109) (-1487.777) [-1486.572] (-1495.151) * [-1488.258] (-1489.110) (-1496.819) (-1487.576) -- 0:02:11
30000 -- (-1487.460) (-1484.435) [-1486.416] (-1492.736) * [-1491.891] (-1488.383) (-1484.710) (-1482.276) -- 0:02:09
Average standard deviation of split frequencies: 0.000000
30500 -- [-1488.328] (-1485.730) (-1486.541) (-1484.448) * [-1490.612] (-1490.552) (-1484.584) (-1489.446) -- 0:02:38
31000 -- (-1494.721) (-1484.857) (-1483.161) [-1486.272] * (-1491.546) (-1490.610) (-1488.074) [-1485.583] -- 0:02:36
31500 -- (-1494.328) (-1485.748) [-1482.587] (-1489.150) * (-1488.046) (-1491.781) [-1485.499] (-1496.325) -- 0:02:33
32000 -- (-1488.883) (-1486.765) [-1484.677] (-1492.268) * (-1492.467) (-1491.994) [-1483.208] (-1490.910) -- 0:02:31
32500 -- (-1500.353) (-1489.783) [-1487.787] (-1490.780) * (-1488.986) (-1498.323) [-1488.088] (-1488.488) -- 0:02:28
33000 -- (-1488.561) (-1496.170) (-1493.739) [-1485.914] * (-1497.138) (-1495.299) (-1490.250) [-1486.078] -- 0:02:26
33500 -- (-1486.681) (-1487.794) (-1487.968) [-1486.432] * [-1493.864] (-1492.629) (-1489.899) (-1491.391) -- 0:02:24
34000 -- (-1487.599) (-1487.167) (-1492.988) [-1481.600] * (-1485.549) [-1491.642] (-1488.325) (-1489.178) -- 0:02:22
34500 -- (-1486.496) (-1488.617) (-1491.940) [-1485.740] * [-1486.699] (-1486.874) (-1488.279) (-1488.445) -- 0:02:19
35000 -- (-1487.868) (-1487.354) [-1486.230] (-1481.594) * (-1484.110) (-1491.525) [-1488.296] (-1488.977) -- 0:02:17
Average standard deviation of split frequencies: 0.000000
35500 -- (-1490.658) (-1490.176) (-1492.546) [-1486.002] * (-1486.542) (-1498.163) (-1492.871) [-1488.812] -- 0:02:15
36000 -- (-1485.379) (-1490.586) [-1489.811] (-1486.360) * (-1487.779) (-1493.631) (-1493.249) [-1488.230] -- 0:02:13
36500 -- [-1485.359] (-1495.119) (-1492.346) (-1491.525) * [-1488.138] (-1488.916) (-1489.757) (-1487.657) -- 0:02:11
37000 -- (-1486.430) [-1487.661] (-1495.406) (-1488.633) * (-1491.133) (-1490.454) [-1489.947] (-1490.952) -- 0:02:36
37500 -- (-1492.239) [-1487.273] (-1489.456) (-1482.533) * (-1494.404) (-1491.878) [-1489.495] (-1485.788) -- 0:02:34
38000 -- (-1492.822) (-1486.912) (-1485.671) [-1483.779] * (-1499.392) [-1484.999] (-1485.032) (-1486.009) -- 0:02:31
38500 -- (-1486.776) (-1487.105) (-1486.397) [-1488.800] * (-1494.865) [-1486.871] (-1486.476) (-1494.807) -- 0:02:29
39000 -- (-1499.112) (-1490.078) (-1489.861) [-1488.939] * (-1488.904) [-1489.015] (-1489.896) (-1490.544) -- 0:02:27
39500 -- [-1490.111] (-1489.896) (-1489.368) (-1483.976) * (-1488.956) (-1488.808) (-1489.697) [-1489.700] -- 0:02:25
40000 -- (-1490.220) (-1485.875) [-1484.662] (-1483.123) * (-1493.508) (-1489.224) (-1484.727) [-1492.590] -- 0:02:24
Average standard deviation of split frequencies: 0.000000
40500 -- (-1487.475) (-1492.834) (-1484.149) [-1488.418] * [-1486.700] (-1486.071) (-1483.598) (-1486.854) -- 0:02:22
41000 -- (-1487.874) (-1486.796) [-1483.854] (-1487.366) * (-1487.259) (-1491.755) [-1486.026] (-1484.639) -- 0:02:20
41500 -- [-1486.607] (-1486.828) (-1484.775) (-1488.050) * [-1483.670] (-1486.178) (-1489.529) (-1485.534) -- 0:02:18
42000 -- (-1489.258) (-1493.722) (-1490.667) [-1486.076] * (-1489.067) [-1484.805] (-1486.240) (-1486.676) -- 0:02:16
42500 -- [-1485.933] (-1495.605) (-1484.259) (-1487.108) * (-1484.293) (-1490.513) (-1487.907) [-1492.678] -- 0:02:15
43000 -- [-1483.374] (-1492.186) (-1485.294) (-1492.915) * (-1487.959) (-1491.159) (-1489.628) [-1487.056] -- 0:02:35
43500 -- [-1490.304] (-1487.324) (-1494.435) (-1488.094) * (-1492.869) (-1485.289) (-1487.566) [-1487.442] -- 0:02:33
44000 -- (-1484.180) (-1484.973) (-1495.083) [-1491.872] * [-1489.760] (-1490.268) (-1485.520) (-1488.850) -- 0:02:32
44500 -- (-1487.758) (-1488.258) [-1485.417] (-1494.462) * (-1483.304) [-1491.960] (-1485.335) (-1490.836) -- 0:02:30
45000 -- (-1492.869) [-1488.048] (-1486.000) (-1491.153) * (-1485.227) (-1489.361) [-1485.803] (-1485.742) -- 0:02:28
Average standard deviation of split frequencies: 0.000000
45500 -- (-1489.788) [-1487.496] (-1487.398) (-1488.779) * (-1488.051) (-1496.658) [-1483.870] (-1490.580) -- 0:02:26
46000 -- (-1483.194) (-1494.030) [-1487.347] (-1491.669) * (-1490.334) (-1496.631) [-1486.435] (-1488.737) -- 0:02:25
46500 -- (-1490.382) (-1493.529) [-1491.680] (-1487.311) * (-1494.022) [-1493.919] (-1489.674) (-1487.673) -- 0:02:23
47000 -- (-1490.245) [-1483.877] (-1488.299) (-1492.399) * [-1488.441] (-1490.655) (-1486.814) (-1486.442) -- 0:02:21
47500 -- (-1492.257) [-1486.248] (-1492.944) (-1490.942) * [-1487.696] (-1485.738) (-1491.959) (-1487.809) -- 0:02:20
48000 -- (-1484.523) (-1495.903) [-1484.909] (-1484.495) * (-1488.441) (-1492.505) (-1487.126) [-1485.099] -- 0:02:18
48500 -- (-1489.161) [-1486.278] (-1484.035) (-1493.493) * (-1492.845) (-1484.279) [-1493.731] (-1484.008) -- 0:02:17
49000 -- (-1487.696) [-1488.457] (-1492.368) (-1501.226) * (-1497.482) (-1483.655) [-1490.396] (-1489.576) -- 0:02:15
49500 -- (-1486.900) [-1486.532] (-1492.185) (-1493.074) * (-1491.196) [-1485.345] (-1487.290) (-1487.235) -- 0:02:33
50000 -- (-1485.693) [-1488.264] (-1498.203) (-1493.769) * (-1494.367) (-1485.768) [-1485.539] (-1490.456) -- 0:02:32
Average standard deviation of split frequencies: 0.000000
50500 -- [-1482.083] (-1488.826) (-1492.042) (-1489.920) * (-1489.752) [-1486.721] (-1490.512) (-1486.263) -- 0:02:30
51000 -- [-1481.708] (-1489.701) (-1491.938) (-1491.259) * (-1491.607) [-1486.556] (-1492.921) (-1488.193) -- 0:02:28
51500 -- [-1490.442] (-1488.548) (-1490.071) (-1495.728) * (-1490.230) (-1486.709) [-1488.345] (-1494.855) -- 0:02:27
52000 -- [-1484.490] (-1485.593) (-1488.883) (-1494.032) * (-1487.742) [-1486.383] (-1492.490) (-1484.916) -- 0:02:25
52500 -- (-1484.739) (-1492.091) (-1492.396) [-1495.923] * [-1483.647] (-1486.845) (-1490.820) (-1486.364) -- 0:02:24
53000 -- (-1485.458) (-1488.143) [-1488.726] (-1491.928) * (-1484.080) (-1488.938) (-1495.258) [-1484.812] -- 0:02:22
53500 -- (-1488.707) (-1483.545) [-1486.411] (-1491.131) * (-1494.397) [-1485.596] (-1487.739) (-1488.679) -- 0:02:21
54000 -- (-1488.043) (-1485.556) [-1491.306] (-1488.488) * (-1495.524) (-1485.910) [-1486.352] (-1488.168) -- 0:02:20
54500 -- (-1493.480) (-1484.726) (-1491.170) [-1486.473] * (-1491.367) (-1482.499) [-1486.478] (-1496.262) -- 0:02:18
55000 -- (-1493.658) [-1483.561] (-1486.117) (-1492.850) * (-1486.721) [-1490.445] (-1488.476) (-1491.152) -- 0:02:17
Average standard deviation of split frequencies: 0.000000
55500 -- (-1486.039) (-1484.198) [-1488.309] (-1488.029) * (-1487.951) (-1485.567) (-1489.949) [-1488.894] -- 0:02:33
56000 -- [-1492.540] (-1485.133) (-1484.941) (-1486.998) * (-1489.463) (-1488.450) (-1489.725) [-1485.588] -- 0:02:31
56500 -- (-1486.711) [-1485.038] (-1484.105) (-1495.003) * (-1487.428) (-1487.421) [-1494.257] (-1488.997) -- 0:02:30
57000 -- (-1489.671) (-1487.465) (-1488.430) [-1487.258] * [-1492.224] (-1487.280) (-1493.255) (-1492.751) -- 0:02:28
57500 -- (-1488.522) (-1490.537) (-1485.644) [-1491.898] * [-1484.841] (-1488.038) (-1496.815) (-1491.053) -- 0:02:27
58000 -- (-1493.740) (-1487.874) (-1486.019) [-1490.543] * [-1486.407] (-1490.897) (-1493.275) (-1488.803) -- 0:02:26
58500 -- [-1487.839] (-1487.960) (-1487.246) (-1487.093) * (-1484.725) (-1484.225) (-1493.602) [-1492.480] -- 0:02:24
59000 -- (-1491.068) (-1486.448) (-1484.167) [-1486.792] * [-1488.512] (-1490.608) (-1493.267) (-1490.826) -- 0:02:23
59500 -- (-1488.605) (-1488.929) [-1486.540] (-1491.792) * (-1492.350) (-1490.872) [-1493.907] (-1489.080) -- 0:02:22
60000 -- (-1492.601) (-1487.695) (-1492.331) [-1490.408] * (-1489.479) (-1489.399) [-1494.889] (-1491.901) -- 0:02:21
Average standard deviation of split frequencies: 0.000000
60500 -- (-1489.349) (-1489.421) (-1491.519) [-1487.947] * (-1489.518) (-1489.469) (-1492.267) [-1486.109] -- 0:02:19
61000 -- (-1486.571) (-1485.542) (-1488.641) [-1484.307] * (-1490.293) (-1489.936) [-1486.693] (-1486.254) -- 0:02:18
61500 -- [-1488.731] (-1489.353) (-1491.681) (-1481.835) * (-1490.128) (-1484.849) [-1492.696] (-1487.845) -- 0:02:17
62000 -- (-1484.764) (-1483.927) (-1493.407) [-1486.033] * (-1498.677) (-1488.202) [-1486.450] (-1491.080) -- 0:02:31
62500 -- (-1483.313) [-1486.389] (-1490.885) (-1490.710) * (-1489.435) (-1484.913) (-1487.912) [-1490.090] -- 0:02:30
63000 -- (-1485.626) [-1487.085] (-1491.776) (-1491.241) * [-1489.681] (-1489.588) (-1482.657) (-1490.169) -- 0:02:28
63500 -- (-1481.299) [-1486.000] (-1495.388) (-1489.249) * (-1490.962) (-1489.784) (-1495.475) [-1488.550] -- 0:02:27
64000 -- (-1486.938) [-1486.517] (-1494.149) (-1485.024) * (-1483.368) (-1484.847) [-1486.118] (-1487.180) -- 0:02:26
64500 -- (-1485.192) [-1485.664] (-1492.095) (-1484.514) * (-1487.841) [-1485.377] (-1488.817) (-1490.484) -- 0:02:25
65000 -- (-1486.957) (-1485.628) (-1493.527) [-1488.985] * [-1486.942] (-1482.966) (-1488.670) (-1494.544) -- 0:02:23
Average standard deviation of split frequencies: 0.000000
65500 -- [-1488.666] (-1493.749) (-1497.536) (-1487.175) * [-1486.121] (-1484.459) (-1483.923) (-1488.545) -- 0:02:22
66000 -- (-1489.569) (-1488.548) (-1493.912) [-1488.624] * (-1497.826) [-1488.567] (-1484.874) (-1500.403) -- 0:02:21
66500 -- (-1489.219) (-1487.740) (-1492.353) [-1491.910] * (-1494.831) [-1484.014] (-1486.136) (-1497.476) -- 0:02:20
67000 -- (-1493.941) (-1487.775) [-1485.961] (-1484.650) * (-1499.247) (-1487.431) [-1484.118] (-1495.555) -- 0:02:19
67500 -- (-1485.946) [-1485.134] (-1485.891) (-1485.684) * (-1487.653) (-1484.768) [-1489.611] (-1500.507) -- 0:02:18
68000 -- (-1488.695) (-1486.292) [-1491.045] (-1486.740) * (-1490.743) [-1483.448] (-1485.060) (-1491.834) -- 0:02:17
68500 -- (-1485.032) (-1488.084) [-1486.119] (-1490.413) * (-1485.767) (-1488.389) (-1496.367) [-1493.803] -- 0:02:29
69000 -- (-1487.976) [-1485.758] (-1487.886) (-1490.275) * (-1490.719) (-1491.587) [-1486.578] (-1490.573) -- 0:02:28
69500 -- [-1487.168] (-1487.289) (-1484.816) (-1489.320) * (-1489.722) [-1484.141] (-1485.789) (-1486.181) -- 0:02:27
70000 -- (-1490.660) (-1485.549) (-1492.795) [-1488.565] * [-1490.491] (-1487.262) (-1486.467) (-1487.855) -- 0:02:26
Average standard deviation of split frequencies: 0.000000
70500 -- (-1488.073) (-1483.308) [-1490.670] (-1489.032) * (-1486.986) [-1483.347] (-1487.849) (-1486.349) -- 0:02:25
71000 -- [-1485.313] (-1487.083) (-1492.223) (-1489.092) * (-1486.202) [-1486.135] (-1488.769) (-1484.785) -- 0:02:23
71500 -- [-1483.718] (-1483.165) (-1487.428) (-1492.122) * (-1494.483) (-1488.548) (-1492.640) [-1487.826] -- 0:02:22
72000 -- (-1488.870) [-1486.693] (-1488.496) (-1504.870) * [-1490.143] (-1493.975) (-1485.195) (-1492.333) -- 0:02:21
72500 -- (-1492.484) [-1486.105] (-1493.813) (-1495.781) * (-1491.590) (-1485.761) [-1485.926] (-1488.020) -- 0:02:20
73000 -- [-1486.528] (-1485.090) (-1498.973) (-1490.333) * (-1485.850) (-1490.777) (-1485.246) [-1488.076] -- 0:02:19
73500 -- (-1490.942) [-1488.278] (-1497.144) (-1495.645) * (-1490.754) (-1492.374) [-1488.414] (-1491.657) -- 0:02:18
74000 -- (-1488.418) (-1489.504) (-1496.318) [-1495.476] * (-1488.497) (-1489.565) (-1490.511) [-1487.186] -- 0:02:17
74500 -- (-1488.637) [-1485.311] (-1498.191) (-1486.708) * (-1489.973) (-1489.502) [-1492.828] (-1492.898) -- 0:02:29
75000 -- [-1487.259] (-1490.185) (-1492.285) (-1488.441) * (-1491.682) [-1490.182] (-1496.038) (-1492.470) -- 0:02:28
Average standard deviation of split frequencies: 0.000000
75500 -- (-1488.260) (-1483.616) [-1489.872] (-1492.032) * (-1484.703) (-1492.466) (-1487.258) [-1488.335] -- 0:02:26
76000 -- (-1491.109) [-1485.371] (-1489.604) (-1491.591) * [-1491.963] (-1492.216) (-1493.025) (-1490.075) -- 0:02:25
76500 -- [-1486.494] (-1482.538) (-1488.528) (-1488.620) * (-1492.521) (-1492.081) [-1487.067] (-1495.470) -- 0:02:24
77000 -- (-1492.897) (-1493.474) (-1484.027) [-1487.145] * (-1495.726) (-1491.440) (-1489.657) [-1484.622] -- 0:02:23
77500 -- (-1489.288) [-1483.953] (-1485.252) (-1491.167) * (-1489.499) [-1485.988] (-1491.179) (-1490.155) -- 0:02:22
78000 -- (-1487.265) (-1487.364) [-1488.033] (-1492.711) * (-1495.308) (-1484.944) [-1486.688] (-1484.741) -- 0:02:21
78500 -- (-1490.927) (-1486.945) [-1485.461] (-1486.742) * (-1487.662) (-1483.408) (-1489.765) [-1483.661] -- 0:02:20
79000 -- (-1493.340) (-1485.286) [-1482.821] (-1491.580) * (-1489.732) (-1485.755) (-1486.795) [-1483.850] -- 0:02:19
79500 -- (-1482.511) [-1492.771] (-1487.793) (-1487.026) * (-1489.245) (-1487.356) (-1490.623) [-1487.160] -- 0:02:18
80000 -- (-1491.459) [-1488.654] (-1488.435) (-1491.141) * (-1484.057) (-1486.291) (-1488.554) [-1487.853] -- 0:02:29
Average standard deviation of split frequencies: 0.000000
80500 -- (-1484.301) [-1484.463] (-1487.525) (-1493.983) * (-1486.609) (-1491.346) (-1485.058) [-1483.769] -- 0:02:28
81000 -- (-1488.647) (-1487.031) [-1482.115] (-1488.000) * [-1489.073] (-1488.244) (-1486.814) (-1493.190) -- 0:02:27
81500 -- (-1493.646) (-1491.975) [-1487.630] (-1494.219) * (-1492.277) (-1489.383) [-1486.380] (-1491.970) -- 0:02:26
82000 -- [-1491.086] (-1483.700) (-1489.771) (-1486.811) * (-1494.487) [-1486.287] (-1493.754) (-1492.369) -- 0:02:25
82500 -- (-1490.985) [-1487.996] (-1484.658) (-1495.651) * (-1486.230) [-1488.232] (-1487.570) (-1493.506) -- 0:02:24
83000 -- [-1484.266] (-1492.208) (-1485.539) (-1492.967) * [-1487.690] (-1488.896) (-1488.726) (-1488.697) -- 0:02:23
83500 -- [-1485.267] (-1490.608) (-1482.841) (-1501.430) * (-1490.074) [-1486.876] (-1491.914) (-1495.924) -- 0:02:22
84000 -- (-1488.158) [-1489.252] (-1487.380) (-1494.105) * (-1487.438) (-1494.661) (-1489.485) [-1489.798] -- 0:02:21
84500 -- (-1485.365) (-1487.397) [-1488.484] (-1489.424) * (-1485.048) (-1488.148) (-1489.815) [-1488.831] -- 0:02:20
85000 -- (-1485.864) [-1484.772] (-1484.957) (-1491.482) * (-1488.923) (-1485.625) (-1493.662) [-1485.389] -- 0:02:19
Average standard deviation of split frequencies: 0.000000
85500 -- (-1488.968) (-1486.688) [-1486.127] (-1489.188) * [-1488.081] (-1489.244) (-1490.770) (-1490.997) -- 0:02:19
86000 -- [-1487.954] (-1486.095) (-1491.069) (-1485.738) * (-1487.105) (-1493.970) (-1493.952) [-1492.060] -- 0:02:18
86500 -- [-1486.468] (-1486.654) (-1490.275) (-1482.161) * (-1487.147) (-1487.685) (-1491.532) [-1487.751] -- 0:02:27
87000 -- (-1487.295) (-1487.259) (-1487.633) [-1483.759] * (-1486.328) (-1488.315) [-1487.583] (-1490.828) -- 0:02:26
87500 -- (-1488.243) (-1494.385) [-1485.719] (-1491.480) * (-1486.962) [-1489.272] (-1488.597) (-1486.323) -- 0:02:26
88000 -- (-1489.644) (-1484.550) [-1486.775] (-1489.540) * (-1488.142) (-1492.602) (-1488.310) [-1493.101] -- 0:02:25
88500 -- (-1486.137) (-1489.095) [-1485.948] (-1490.042) * [-1487.800] (-1490.720) (-1487.443) (-1487.561) -- 0:02:24
89000 -- (-1488.882) (-1489.753) (-1489.737) [-1487.794] * (-1488.599) (-1498.535) (-1491.670) [-1488.747] -- 0:02:23
89500 -- [-1484.108] (-1488.426) (-1490.832) (-1493.198) * (-1489.829) (-1496.967) [-1486.370] (-1488.600) -- 0:02:22
90000 -- [-1488.558] (-1488.622) (-1482.706) (-1497.622) * [-1488.315] (-1489.603) (-1489.734) (-1484.015) -- 0:02:21
Average standard deviation of split frequencies: 0.000000
90500 -- (-1486.808) (-1488.786) [-1489.709] (-1488.509) * (-1488.060) (-1491.217) (-1486.640) [-1484.402] -- 0:02:20
91000 -- (-1487.990) (-1489.231) [-1489.116] (-1492.730) * [-1484.530] (-1489.208) (-1487.528) (-1493.306) -- 0:02:19
91500 -- (-1492.504) (-1485.624) (-1484.789) [-1484.950] * (-1485.590) (-1489.422) [-1493.011] (-1487.447) -- 0:02:19
92000 -- [-1491.500] (-1485.836) (-1490.226) (-1490.079) * (-1484.818) [-1486.761] (-1496.692) (-1491.359) -- 0:02:18
92500 -- (-1490.084) [-1487.398] (-1485.906) (-1486.311) * (-1485.176) [-1486.593] (-1499.813) (-1486.056) -- 0:02:27
93000 -- (-1489.159) (-1486.697) (-1485.260) [-1489.412] * [-1482.556] (-1484.610) (-1492.127) (-1488.277) -- 0:02:26
93500 -- [-1488.456] (-1487.120) (-1485.994) (-1490.949) * (-1484.606) (-1489.432) (-1487.553) [-1484.888] -- 0:02:25
94000 -- [-1493.429] (-1496.403) (-1496.878) (-1489.387) * (-1487.023) (-1486.982) [-1485.175] (-1487.448) -- 0:02:24
94500 -- (-1487.431) (-1484.218) (-1495.365) [-1494.768] * (-1493.895) [-1490.807] (-1488.993) (-1483.692) -- 0:02:23
95000 -- (-1489.289) (-1486.471) [-1491.783] (-1499.166) * (-1491.419) (-1485.144) [-1486.856] (-1484.011) -- 0:02:22
Average standard deviation of split frequencies: 0.000000
95500 -- (-1488.033) [-1494.061] (-1490.181) (-1483.249) * (-1490.380) (-1489.270) (-1486.893) [-1486.165] -- 0:02:22
96000 -- [-1486.096] (-1489.639) (-1492.380) (-1488.095) * (-1487.712) (-1489.844) [-1487.870] (-1490.150) -- 0:02:21
96500 -- (-1488.622) (-1494.129) [-1493.718] (-1492.501) * (-1484.713) (-1486.601) [-1487.405] (-1490.817) -- 0:02:20
97000 -- (-1490.282) (-1493.570) (-1486.625) [-1484.841] * (-1493.902) (-1491.059) [-1484.518] (-1485.046) -- 0:02:19
97500 -- [-1485.755] (-1490.081) (-1485.597) (-1486.219) * (-1492.360) (-1490.894) (-1483.131) [-1486.788] -- 0:02:18
98000 -- [-1488.687] (-1484.586) (-1490.363) (-1485.101) * (-1489.890) (-1485.038) [-1486.176] (-1487.648) -- 0:02:18
98500 -- (-1494.722) (-1487.972) [-1494.412] (-1490.516) * [-1489.921] (-1486.167) (-1485.299) (-1488.120) -- 0:02:17
99000 -- (-1492.091) (-1485.569) (-1498.480) [-1481.989] * (-1487.476) [-1486.845] (-1491.192) (-1483.059) -- 0:02:25
99500 -- (-1491.690) [-1491.270] (-1490.015) (-1484.829) * (-1489.334) (-1487.532) (-1491.355) [-1485.508] -- 0:02:24
100000 -- (-1488.502) [-1486.584] (-1489.334) (-1488.104) * (-1490.713) (-1486.017) [-1485.980] (-1486.509) -- 0:02:24
Average standard deviation of split frequencies: 0.000000
100500 -- (-1488.717) (-1495.866) (-1486.612) [-1490.853] * (-1489.629) (-1488.758) [-1490.647] (-1488.746) -- 0:02:23
101000 -- (-1486.763) (-1489.511) [-1484.924] (-1490.369) * (-1488.403) (-1491.242) (-1484.080) [-1488.194] -- 0:02:22
101500 -- [-1489.079] (-1497.442) (-1484.202) (-1493.276) * (-1487.508) [-1488.010] (-1489.272) (-1491.462) -- 0:02:21
102000 -- (-1487.011) [-1489.472] (-1489.654) (-1494.628) * (-1486.977) (-1487.914) [-1492.669] (-1482.479) -- 0:02:20
102500 -- (-1488.266) [-1489.434] (-1492.850) (-1498.114) * (-1487.161) [-1490.247] (-1495.005) (-1485.385) -- 0:02:20
103000 -- (-1486.594) (-1491.963) [-1486.531] (-1498.848) * (-1492.126) (-1488.056) (-1491.206) [-1486.692] -- 0:02:19
103500 -- [-1488.315] (-1491.999) (-1486.860) (-1492.391) * (-1487.795) (-1489.663) [-1485.344] (-1487.915) -- 0:02:18
104000 -- (-1488.473) [-1486.843] (-1486.083) (-1492.834) * (-1487.231) (-1492.630) (-1485.875) [-1485.261] -- 0:02:17
104500 -- (-1487.934) (-1491.449) (-1489.661) [-1489.625] * (-1494.350) (-1494.897) [-1487.420] (-1485.473) -- 0:02:17
105000 -- (-1482.932) (-1488.240) [-1487.707] (-1492.981) * (-1493.564) (-1489.140) [-1487.997] (-1489.381) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
105500 -- (-1486.903) (-1492.895) [-1483.224] (-1488.603) * (-1489.392) [-1488.508] (-1486.893) (-1487.980) -- 0:02:24
106000 -- (-1487.163) (-1489.668) [-1483.788] (-1492.648) * (-1496.972) [-1492.052] (-1487.836) (-1492.892) -- 0:02:23
106500 -- (-1486.804) (-1487.388) (-1491.038) [-1490.057] * [-1493.008] (-1492.709) (-1489.521) (-1488.985) -- 0:02:22
107000 -- (-1489.142) (-1491.597) (-1485.834) [-1502.031] * (-1493.033) (-1488.303) [-1489.398] (-1486.725) -- 0:02:21
107500 -- [-1486.783] (-1492.930) (-1482.798) (-1496.441) * (-1491.811) [-1485.820] (-1487.108) (-1486.928) -- 0:02:21
108000 -- (-1498.537) (-1487.454) [-1485.290] (-1497.264) * (-1489.487) (-1494.717) [-1487.900] (-1484.747) -- 0:02:20
108500 -- (-1491.533) [-1485.907] (-1484.928) (-1497.540) * (-1491.445) (-1496.251) (-1493.613) [-1491.012] -- 0:02:19
109000 -- (-1488.532) (-1483.950) [-1485.217] (-1492.040) * (-1502.169) (-1490.368) [-1488.688] (-1490.261) -- 0:02:18
109500 -- [-1486.645] (-1487.037) (-1489.606) (-1491.334) * [-1490.274] (-1492.338) (-1482.552) (-1488.746) -- 0:02:18
110000 -- (-1486.104) [-1486.515] (-1484.892) (-1490.531) * (-1492.399) (-1491.642) [-1486.947] (-1487.151) -- 0:02:17
Average standard deviation of split frequencies: 0.000000
110500 -- (-1486.983) (-1488.589) (-1489.429) [-1487.076] * (-1487.315) [-1492.014] (-1488.879) (-1486.937) -- 0:02:16
111000 -- (-1489.619) (-1485.302) (-1495.405) [-1488.559] * (-1486.927) (-1489.618) (-1494.747) [-1486.482] -- 0:02:16
111500 -- [-1483.432] (-1482.794) (-1494.146) (-1486.813) * [-1486.044] (-1496.548) (-1486.564) (-1489.447) -- 0:02:23
112000 -- (-1488.480) [-1486.006] (-1487.488) (-1484.754) * (-1487.787) [-1491.377] (-1485.695) (-1485.575) -- 0:02:22
112500 -- (-1486.806) (-1492.241) [-1490.592] (-1486.821) * (-1491.168) (-1493.028) [-1484.179] (-1489.896) -- 0:02:22
113000 -- [-1488.789] (-1487.174) (-1492.242) (-1489.428) * [-1488.769] (-1496.195) (-1484.873) (-1484.335) -- 0:02:21
113500 -- [-1489.587] (-1486.250) (-1488.605) (-1485.615) * (-1494.583) (-1492.080) [-1485.153] (-1484.194) -- 0:02:20
114000 -- (-1492.609) (-1498.563) (-1491.650) [-1486.571] * (-1487.920) (-1493.014) [-1486.461] (-1485.037) -- 0:02:19
114500 -- (-1486.923) [-1489.723] (-1497.048) (-1492.179) * (-1489.407) [-1485.537] (-1487.591) (-1487.785) -- 0:02:19
115000 -- (-1496.489) [-1485.775] (-1496.396) (-1483.788) * (-1492.518) (-1493.063) (-1489.965) [-1484.620] -- 0:02:18
Average standard deviation of split frequencies: 0.000000
115500 -- [-1490.112] (-1497.268) (-1490.827) (-1489.267) * [-1488.989] (-1494.009) (-1486.825) (-1485.755) -- 0:02:17
116000 -- (-1485.780) [-1489.166] (-1494.691) (-1491.252) * (-1483.957) (-1495.081) (-1493.596) [-1486.058] -- 0:02:17
116500 -- (-1489.719) (-1496.835) (-1486.099) [-1493.192] * (-1490.135) [-1486.552] (-1491.244) (-1484.702) -- 0:02:16
117000 -- (-1492.140) [-1487.723] (-1486.697) (-1492.108) * (-1484.714) (-1484.744) [-1485.607] (-1486.741) -- 0:02:15
117500 -- (-1487.118) [-1489.452] (-1486.683) (-1489.486) * (-1490.435) [-1486.141] (-1490.158) (-1492.852) -- 0:02:22
118000 -- [-1485.116] (-1492.547) (-1482.427) (-1489.260) * (-1488.471) [-1486.742] (-1488.288) (-1488.829) -- 0:02:22
118500 -- (-1485.433) (-1494.080) [-1485.793] (-1486.397) * (-1488.624) (-1487.026) [-1486.817] (-1491.337) -- 0:02:21
119000 -- (-1484.048) (-1485.568) [-1483.202] (-1490.504) * [-1485.554] (-1489.656) (-1491.554) (-1489.418) -- 0:02:20
119500 -- [-1488.284] (-1490.374) (-1484.686) (-1489.537) * (-1485.261) (-1486.329) (-1488.956) [-1488.924] -- 0:02:19
120000 -- (-1488.193) (-1482.705) [-1485.410] (-1486.544) * (-1484.197) [-1488.830] (-1486.531) (-1486.738) -- 0:02:19
Average standard deviation of split frequencies: 0.000000
120500 -- (-1485.309) (-1497.026) [-1487.101] (-1492.368) * (-1487.520) (-1487.965) [-1489.444] (-1490.686) -- 0:02:18
121000 -- (-1489.852) (-1485.788) [-1486.477] (-1487.519) * (-1487.982) (-1489.253) [-1485.461] (-1489.157) -- 0:02:18
121500 -- (-1485.324) [-1490.271] (-1489.274) (-1485.277) * (-1487.366) [-1486.054] (-1495.554) (-1485.875) -- 0:02:17
122000 -- (-1490.371) [-1493.348] (-1488.526) (-1490.610) * (-1491.533) (-1492.312) [-1493.251] (-1487.167) -- 0:02:16
122500 -- [-1485.808] (-1496.256) (-1493.174) (-1488.404) * (-1487.550) [-1489.117] (-1492.032) (-1485.523) -- 0:02:16
123000 -- (-1488.814) [-1494.378] (-1486.121) (-1489.443) * (-1489.908) [-1484.377] (-1485.612) (-1486.658) -- 0:02:15
123500 -- (-1485.051) (-1489.792) (-1490.218) [-1488.062] * (-1485.162) (-1491.037) [-1485.294] (-1491.361) -- 0:02:14
124000 -- (-1485.598) (-1489.317) [-1488.608] (-1491.564) * [-1484.498] (-1486.908) (-1487.827) (-1493.423) -- 0:02:21
124500 -- [-1485.584] (-1487.376) (-1489.357) (-1488.812) * (-1481.304) (-1485.167) [-1486.859] (-1486.175) -- 0:02:20
125000 -- (-1487.014) [-1487.928] (-1492.439) (-1490.301) * [-1491.874] (-1484.500) (-1485.575) (-1490.345) -- 0:02:20
Average standard deviation of split frequencies: 0.000000
125500 -- [-1486.000] (-1486.677) (-1494.353) (-1489.487) * (-1491.448) (-1487.463) (-1485.038) [-1486.999] -- 0:02:19
126000 -- (-1488.494) (-1488.372) [-1492.841] (-1487.209) * (-1494.233) (-1484.509) [-1483.247] (-1495.514) -- 0:02:18
126500 -- (-1485.142) (-1493.252) (-1489.645) [-1484.139] * (-1484.329) (-1485.025) [-1488.671] (-1494.385) -- 0:02:18
127000 -- (-1484.463) (-1488.300) [-1493.299] (-1492.654) * (-1483.400) [-1487.418] (-1495.266) (-1495.138) -- 0:02:17
127500 -- (-1489.056) [-1482.767] (-1488.567) (-1490.432) * (-1489.237) (-1493.111) [-1490.608] (-1492.209) -- 0:02:16
128000 -- [-1488.400] (-1481.965) (-1489.108) (-1485.098) * (-1490.053) (-1491.404) [-1488.359] (-1491.170) -- 0:02:16
128500 -- (-1485.876) (-1482.814) (-1489.088) [-1487.507] * [-1488.700] (-1489.382) (-1488.193) (-1488.366) -- 0:02:15
129000 -- (-1489.920) [-1486.510] (-1490.040) (-1494.341) * [-1489.296] (-1485.760) (-1490.918) (-1483.875) -- 0:02:15
129500 -- [-1488.647] (-1485.950) (-1490.719) (-1487.363) * (-1488.675) (-1487.858) [-1490.495] (-1485.355) -- 0:02:14
130000 -- (-1486.989) (-1487.515) (-1498.867) [-1484.057] * (-1491.590) [-1489.135] (-1489.172) (-1490.365) -- 0:02:20
Average standard deviation of split frequencies: 0.000000
130500 -- (-1487.721) [-1485.607] (-1491.941) (-1484.914) * (-1489.093) (-1483.985) [-1487.273] (-1491.139) -- 0:02:19
131000 -- (-1490.660) (-1494.237) (-1490.450) [-1484.749] * (-1488.878) [-1488.010] (-1493.875) (-1493.452) -- 0:02:19
131500 -- [-1487.650] (-1489.349) (-1484.468) (-1485.413) * [-1492.942] (-1485.932) (-1499.226) (-1494.398) -- 0:02:18
132000 -- (-1489.333) [-1487.539] (-1490.950) (-1483.941) * (-1486.331) (-1488.370) [-1491.174] (-1489.831) -- 0:02:18
132500 -- [-1485.200] (-1492.232) (-1486.815) (-1487.205) * [-1488.011] (-1494.943) (-1498.862) (-1484.290) -- 0:02:17
133000 -- (-1484.608) (-1488.047) (-1491.800) [-1486.390] * (-1493.705) [-1489.549] (-1494.349) (-1485.738) -- 0:02:16
133500 -- (-1484.837) (-1491.206) (-1484.015) [-1487.162] * [-1490.575] (-1490.652) (-1500.048) (-1491.312) -- 0:02:16
134000 -- (-1491.658) (-1489.977) [-1488.561] (-1490.481) * (-1487.520) [-1485.973] (-1489.846) (-1492.389) -- 0:02:15
134500 -- [-1483.173] (-1494.224) (-1495.450) (-1483.165) * [-1487.760] (-1486.353) (-1488.111) (-1490.726) -- 0:02:15
135000 -- (-1487.045) (-1489.597) [-1483.434] (-1483.127) * (-1486.479) [-1487.120] (-1492.718) (-1492.200) -- 0:02:14
Average standard deviation of split frequencies: 0.000000
135500 -- [-1484.159] (-1484.036) (-1486.906) (-1488.683) * (-1485.821) [-1484.265] (-1489.500) (-1490.028) -- 0:02:20
136000 -- [-1489.098] (-1489.417) (-1488.691) (-1488.565) * [-1486.538] (-1485.844) (-1485.217) (-1493.342) -- 0:02:19
136500 -- [-1492.406] (-1491.008) (-1500.575) (-1492.877) * (-1487.064) [-1486.995] (-1488.524) (-1483.869) -- 0:02:19
137000 -- (-1492.415) (-1490.155) (-1485.623) [-1489.135] * (-1489.461) (-1486.399) (-1484.975) [-1490.511] -- 0:02:18
137500 -- (-1492.489) (-1491.410) [-1485.219] (-1484.874) * [-1489.363] (-1484.388) (-1488.758) (-1497.395) -- 0:02:18
138000 -- (-1487.285) [-1492.114] (-1486.591) (-1486.639) * (-1487.859) (-1489.254) [-1491.700] (-1488.891) -- 0:02:17
138500 -- (-1484.851) (-1493.532) (-1485.947) [-1484.595] * (-1489.883) [-1489.492] (-1486.314) (-1492.739) -- 0:02:16
139000 -- [-1493.203] (-1490.004) (-1484.596) (-1486.567) * [-1489.475] (-1485.349) (-1485.599) (-1501.523) -- 0:02:16
139500 -- [-1489.608] (-1489.237) (-1486.718) (-1488.812) * [-1486.209] (-1485.622) (-1488.681) (-1499.987) -- 0:02:15
140000 -- [-1488.537] (-1488.038) (-1486.861) (-1489.468) * [-1488.630] (-1487.788) (-1495.364) (-1504.846) -- 0:02:15
Average standard deviation of split frequencies: 0.000000
140500 -- (-1486.377) [-1487.318] (-1486.628) (-1494.093) * (-1482.568) [-1484.518] (-1484.683) (-1502.923) -- 0:02:14
141000 -- [-1489.753] (-1483.196) (-1483.782) (-1488.148) * (-1494.108) (-1485.852) [-1485.370] (-1497.162) -- 0:02:14
141500 -- [-1485.603] (-1490.922) (-1491.501) (-1482.179) * (-1486.328) [-1485.129] (-1485.249) (-1498.375) -- 0:02:13
142000 -- [-1484.676] (-1486.974) (-1493.260) (-1486.620) * (-1488.231) [-1486.147] (-1485.879) (-1498.234) -- 0:02:18
142500 -- (-1489.652) (-1490.807) [-1492.010] (-1483.268) * (-1487.707) [-1486.715] (-1490.119) (-1492.275) -- 0:02:18
143000 -- (-1487.947) [-1484.940] (-1497.950) (-1483.156) * (-1490.468) (-1498.525) [-1491.389] (-1491.116) -- 0:02:17
143500 -- (-1495.696) (-1490.932) [-1490.901] (-1488.906) * (-1488.345) [-1491.770] (-1487.845) (-1490.529) -- 0:02:17
144000 -- (-1491.386) [-1487.244] (-1489.345) (-1492.997) * (-1489.788) (-1486.466) [-1495.908] (-1495.190) -- 0:02:16
144500 -- (-1494.644) (-1490.695) (-1484.883) [-1490.315] * [-1490.056] (-1489.300) (-1493.781) (-1494.414) -- 0:02:16
145000 -- (-1491.341) (-1498.091) [-1485.057] (-1493.637) * (-1493.151) (-1485.316) (-1489.433) [-1492.088] -- 0:02:15
Average standard deviation of split frequencies: 0.000000
145500 -- (-1492.940) (-1484.370) (-1490.559) [-1487.735] * (-1497.658) (-1490.676) (-1489.310) [-1484.480] -- 0:02:15
146000 -- (-1492.499) [-1484.814] (-1494.631) (-1490.948) * (-1485.583) [-1487.423] (-1487.772) (-1485.380) -- 0:02:14
146500 -- (-1492.602) (-1486.251) (-1499.598) [-1487.464] * (-1484.920) (-1487.410) (-1484.734) [-1487.693] -- 0:02:13
147000 -- (-1492.371) [-1482.995] (-1493.992) (-1484.879) * (-1486.443) (-1483.536) [-1484.168] (-1487.125) -- 0:02:13
147500 -- (-1491.093) [-1486.946] (-1489.331) (-1485.982) * (-1484.440) [-1487.757] (-1487.511) (-1489.640) -- 0:02:12
148000 -- (-1489.381) (-1486.126) (-1487.799) [-1490.234] * [-1490.903] (-1490.442) (-1485.220) (-1484.427) -- 0:02:12
148500 -- (-1489.687) [-1484.057] (-1487.994) (-1485.838) * (-1485.793) (-1490.919) (-1491.475) [-1483.048] -- 0:02:17
149000 -- (-1492.532) [-1486.860] (-1490.955) (-1488.162) * (-1488.802) [-1489.738] (-1485.563) (-1485.658) -- 0:02:17
149500 -- (-1488.715) (-1489.054) (-1486.019) [-1488.309] * (-1489.435) [-1486.182] (-1485.199) (-1488.135) -- 0:02:16
150000 -- [-1483.890] (-1487.197) (-1486.749) (-1496.012) * (-1492.661) (-1491.878) (-1482.002) [-1491.758] -- 0:02:16
Average standard deviation of split frequencies: 0.000000
150500 -- [-1488.293] (-1490.006) (-1491.258) (-1485.028) * (-1487.046) [-1488.032] (-1485.633) (-1485.673) -- 0:02:15
151000 -- (-1489.659) (-1491.686) (-1486.734) [-1486.924] * (-1484.526) (-1486.448) (-1488.360) [-1484.816] -- 0:02:14
151500 -- (-1493.195) (-1490.332) (-1492.451) [-1485.821] * (-1485.888) [-1486.942] (-1487.983) (-1493.221) -- 0:02:14
152000 -- (-1484.793) (-1485.324) [-1487.470] (-1492.419) * [-1482.995] (-1489.919) (-1488.792) (-1491.993) -- 0:02:13
152500 -- [-1481.999] (-1487.899) (-1482.157) (-1498.854) * (-1486.246) [-1490.406] (-1487.069) (-1492.126) -- 0:02:13
153000 -- (-1486.317) (-1487.141) [-1487.341] (-1484.096) * (-1494.726) [-1486.735] (-1486.316) (-1486.385) -- 0:02:12
153500 -- (-1491.385) [-1490.118] (-1486.581) (-1487.220) * (-1484.635) [-1487.149] (-1485.955) (-1489.595) -- 0:02:12
154000 -- (-1489.715) (-1492.380) (-1488.402) [-1485.343] * [-1483.899] (-1490.336) (-1486.548) (-1488.978) -- 0:02:11
154500 -- (-1492.047) (-1490.825) [-1492.674] (-1489.107) * (-1490.607) (-1492.001) (-1490.381) [-1487.442] -- 0:02:11
155000 -- [-1489.776] (-1490.888) (-1490.843) (-1485.823) * [-1484.376] (-1486.205) (-1485.739) (-1493.373) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
155500 -- (-1486.259) (-1487.524) [-1488.838] (-1490.439) * (-1493.146) (-1488.325) (-1490.366) [-1483.902] -- 0:02:15
156000 -- [-1489.899] (-1492.115) (-1485.655) (-1486.230) * [-1493.355] (-1486.752) (-1494.117) (-1482.634) -- 0:02:15
156500 -- (-1487.057) [-1489.172] (-1488.123) (-1487.505) * (-1492.997) (-1487.837) (-1487.678) [-1482.429] -- 0:02:14
157000 -- (-1487.380) (-1487.362) (-1489.210) [-1485.355] * (-1491.228) (-1487.769) [-1486.429] (-1484.709) -- 0:02:14
157500 -- [-1489.517] (-1486.288) (-1487.988) (-1484.863) * (-1491.063) (-1491.279) (-1490.884) [-1491.516] -- 0:02:13
158000 -- [-1487.907] (-1489.451) (-1489.556) (-1491.045) * (-1492.258) (-1485.838) (-1490.605) [-1489.860] -- 0:02:13
158500 -- (-1484.528) (-1488.233) [-1487.098] (-1492.497) * (-1485.862) (-1488.715) (-1485.869) [-1484.252] -- 0:02:12
159000 -- [-1486.341] (-1487.679) (-1488.812) (-1483.392) * [-1490.147] (-1492.870) (-1488.084) (-1485.407) -- 0:02:12
159500 -- (-1490.590) [-1485.404] (-1487.278) (-1490.989) * (-1483.461) (-1491.945) (-1487.383) [-1490.854] -- 0:02:11
160000 -- (-1488.868) (-1488.695) (-1489.225) [-1484.658] * (-1487.862) (-1491.792) [-1482.775] (-1488.247) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
160500 -- (-1488.300) [-1486.525] (-1485.330) (-1487.754) * (-1489.109) (-1490.962) [-1488.432] (-1484.868) -- 0:02:10
161000 -- (-1495.349) [-1488.660] (-1487.306) (-1489.006) * [-1483.978] (-1485.352) (-1486.318) (-1484.150) -- 0:02:15
161500 -- (-1490.054) [-1491.841] (-1492.578) (-1489.210) * (-1487.670) [-1494.867] (-1484.857) (-1484.869) -- 0:02:14
162000 -- (-1485.095) (-1497.668) (-1488.012) [-1487.416] * (-1494.773) (-1492.559) (-1486.292) [-1486.398] -- 0:02:14
162500 -- [-1494.699] (-1493.450) (-1487.544) (-1492.759) * (-1484.877) [-1487.707] (-1487.901) (-1486.615) -- 0:02:14
163000 -- (-1490.637) (-1490.029) [-1483.801] (-1485.230) * [-1489.606] (-1489.697) (-1495.748) (-1485.908) -- 0:02:13
163500 -- [-1489.325] (-1488.776) (-1486.117) (-1490.086) * (-1492.842) [-1489.113] (-1484.954) (-1488.969) -- 0:02:13
164000 -- (-1487.525) (-1486.385) (-1503.269) [-1491.590] * (-1496.596) [-1490.392] (-1487.603) (-1494.218) -- 0:02:12
164500 -- [-1485.892] (-1488.080) (-1492.068) (-1491.561) * (-1492.171) (-1484.737) [-1489.529] (-1490.455) -- 0:02:12
165000 -- [-1488.132] (-1484.539) (-1488.583) (-1491.712) * (-1494.938) (-1486.292) (-1486.196) [-1488.772] -- 0:02:11
Average standard deviation of split frequencies: 0.000000
165500 -- [-1489.059] (-1487.327) (-1492.244) (-1490.673) * (-1500.655) [-1489.473] (-1489.766) (-1490.233) -- 0:02:11
166000 -- (-1495.145) [-1488.568] (-1488.483) (-1496.658) * (-1494.640) (-1486.551) [-1485.214] (-1492.126) -- 0:02:10
166500 -- [-1487.327] (-1492.075) (-1494.387) (-1489.231) * (-1491.519) (-1486.534) (-1486.957) [-1489.943] -- 0:02:10
167000 -- (-1488.596) [-1482.404] (-1490.627) (-1494.478) * (-1492.271) (-1487.787) [-1486.771] (-1483.671) -- 0:02:09
167500 -- (-1493.475) [-1488.927] (-1483.364) (-1492.012) * [-1490.988] (-1486.295) (-1487.277) (-1492.299) -- 0:02:14
168000 -- (-1488.838) (-1492.761) (-1493.313) [-1485.496] * (-1489.935) (-1488.645) [-1484.725] (-1491.583) -- 0:02:13
168500 -- (-1486.299) [-1488.762] (-1488.271) (-1486.703) * (-1492.232) [-1488.701] (-1487.790) (-1490.962) -- 0:02:13
169000 -- [-1487.169] (-1488.490) (-1490.630) (-1489.118) * [-1485.344] (-1493.373) (-1487.995) (-1491.035) -- 0:02:12
169500 -- (-1487.768) [-1487.414] (-1499.405) (-1485.265) * (-1493.431) [-1487.773] (-1494.160) (-1489.306) -- 0:02:12
170000 -- (-1484.797) [-1487.003] (-1486.902) (-1488.718) * (-1500.608) (-1487.068) (-1486.639) [-1490.279] -- 0:02:11
Average standard deviation of split frequencies: 0.000000
170500 -- (-1489.833) [-1488.812] (-1489.070) (-1488.568) * (-1487.800) (-1487.109) (-1486.963) [-1495.955] -- 0:02:11
171000 -- (-1491.518) (-1488.874) (-1491.058) [-1485.830] * (-1490.506) (-1491.609) [-1489.355] (-1489.880) -- 0:02:10
171500 -- (-1493.359) [-1488.561] (-1490.413) (-1492.508) * (-1497.106) (-1492.737) [-1487.561] (-1491.148) -- 0:02:10
172000 -- (-1494.980) [-1488.786] (-1495.716) (-1494.197) * (-1487.283) [-1487.905] (-1486.972) (-1486.594) -- 0:02:09
172500 -- (-1496.689) (-1492.901) [-1495.781] (-1487.954) * (-1490.094) (-1494.656) (-1487.291) [-1486.913] -- 0:02:09
173000 -- (-1488.637) [-1487.353] (-1500.792) (-1500.270) * (-1490.645) (-1491.210) [-1489.077] (-1487.761) -- 0:02:09
173500 -- [-1488.712] (-1490.583) (-1493.672) (-1489.989) * [-1487.013] (-1487.870) (-1487.962) (-1487.828) -- 0:02:08
174000 -- (-1489.908) (-1484.465) (-1487.161) [-1491.277] * (-1494.020) (-1486.770) [-1486.330] (-1484.625) -- 0:02:12
174500 -- [-1490.030] (-1490.209) (-1493.137) (-1494.034) * (-1492.327) (-1490.257) [-1489.727] (-1483.840) -- 0:02:12
175000 -- (-1485.974) (-1495.332) (-1489.657) [-1488.088] * [-1488.893] (-1486.312) (-1488.310) (-1487.522) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
175500 -- (-1485.459) [-1488.225] (-1491.927) (-1499.280) * (-1485.899) (-1488.509) [-1490.020] (-1486.512) -- 0:02:11
176000 -- (-1485.607) (-1489.865) [-1484.876] (-1492.963) * [-1482.711] (-1485.582) (-1488.465) (-1487.849) -- 0:02:11
176500 -- [-1487.883] (-1488.337) (-1487.154) (-1495.897) * (-1489.070) [-1485.673] (-1487.379) (-1495.650) -- 0:02:10
177000 -- (-1487.632) [-1488.357] (-1492.304) (-1487.452) * (-1490.174) (-1490.304) (-1493.247) [-1496.624] -- 0:02:10
177500 -- (-1487.178) (-1493.034) [-1486.593] (-1482.627) * (-1492.416) [-1490.394] (-1490.587) (-1492.409) -- 0:02:09
178000 -- [-1482.835] (-1493.572) (-1485.483) (-1483.629) * (-1487.624) (-1492.250) [-1483.660] (-1490.204) -- 0:02:09
178500 -- (-1491.259) (-1494.334) (-1491.484) [-1484.135] * [-1484.497] (-1488.844) (-1487.045) (-1488.687) -- 0:02:08
179000 -- (-1489.057) (-1491.313) (-1488.854) [-1489.673] * (-1494.104) [-1484.479] (-1494.130) (-1487.888) -- 0:02:08
179500 -- (-1488.236) (-1493.424) (-1485.321) [-1485.644] * [-1482.705] (-1484.527) (-1492.908) (-1490.714) -- 0:02:07
180000 -- (-1482.316) (-1488.082) [-1489.142] (-1487.057) * (-1491.941) [-1488.400] (-1487.758) (-1490.323) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
180500 -- (-1485.499) [-1490.441] (-1494.771) (-1488.235) * (-1488.848) [-1486.925] (-1486.835) (-1492.032) -- 0:02:11
181000 -- [-1491.661] (-1489.646) (-1491.150) (-1488.081) * (-1491.651) (-1488.443) (-1483.987) [-1491.940] -- 0:02:11
181500 -- (-1488.055) (-1492.782) (-1490.615) [-1486.115] * [-1490.704] (-1486.367) (-1487.027) (-1490.769) -- 0:02:10
182000 -- [-1485.519] (-1486.118) (-1488.475) (-1487.240) * (-1492.287) (-1484.752) [-1487.842] (-1494.968) -- 0:02:10
182500 -- [-1489.278] (-1485.683) (-1490.312) (-1485.083) * (-1493.290) (-1491.906) [-1486.281] (-1491.043) -- 0:02:09
183000 -- (-1493.251) [-1485.131] (-1487.958) (-1489.364) * [-1492.593] (-1492.841) (-1488.957) (-1485.282) -- 0:02:09
183500 -- (-1486.605) (-1486.082) [-1483.532] (-1490.270) * (-1490.029) (-1487.643) (-1489.085) [-1483.571] -- 0:02:09
184000 -- [-1492.893] (-1483.434) (-1484.782) (-1490.768) * (-1490.683) (-1487.957) (-1496.661) [-1487.665] -- 0:02:08
184500 -- (-1500.586) [-1484.723] (-1486.740) (-1489.964) * (-1491.931) [-1486.307] (-1492.737) (-1486.276) -- 0:02:08
185000 -- (-1487.205) [-1486.348] (-1489.994) (-1487.725) * (-1489.363) (-1484.529) [-1488.713] (-1494.816) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
185500 -- (-1485.862) (-1483.812) [-1488.545] (-1487.929) * [-1484.608] (-1486.805) (-1485.262) (-1485.162) -- 0:02:07
186000 -- [-1485.391] (-1484.140) (-1485.055) (-1488.113) * (-1485.479) (-1489.925) [-1485.165] (-1487.645) -- 0:02:06
186500 -- (-1492.646) (-1485.227) (-1485.463) [-1487.934] * (-1492.856) (-1485.554) (-1490.282) [-1489.955] -- 0:02:06
187000 -- [-1481.853] (-1487.297) (-1486.800) (-1488.061) * (-1492.993) (-1484.395) (-1488.009) [-1491.916] -- 0:02:10
187500 -- (-1487.417) [-1487.194] (-1488.520) (-1490.838) * (-1493.748) (-1487.776) (-1487.757) [-1485.684] -- 0:02:10
188000 -- [-1482.795] (-1490.209) (-1483.359) (-1490.142) * [-1489.287] (-1486.464) (-1487.340) (-1484.805) -- 0:02:09
188500 -- (-1483.815) (-1491.846) [-1487.125] (-1485.788) * [-1490.994] (-1485.846) (-1483.976) (-1490.727) -- 0:02:09
189000 -- (-1488.495) (-1490.206) [-1484.859] (-1486.931) * (-1490.016) (-1488.413) (-1485.301) [-1488.678] -- 0:02:08
189500 -- (-1485.612) (-1489.959) [-1484.727] (-1497.137) * [-1484.164] (-1489.920) (-1491.238) (-1490.574) -- 0:02:08
190000 -- [-1490.131] (-1491.313) (-1486.182) (-1492.568) * (-1484.807) (-1485.321) (-1491.046) [-1487.288] -- 0:02:07
Average standard deviation of split frequencies: 0.000000
190500 -- (-1491.606) (-1489.892) [-1485.933] (-1490.673) * (-1491.140) [-1487.175] (-1489.845) (-1491.010) -- 0:02:07
191000 -- (-1491.064) [-1489.644] (-1488.833) (-1483.814) * [-1488.237] (-1485.652) (-1496.900) (-1489.143) -- 0:02:07
191500 -- (-1493.476) (-1489.341) (-1485.629) [-1488.884] * (-1486.344) (-1490.517) (-1492.166) [-1488.106] -- 0:02:06
192000 -- [-1483.468] (-1491.102) (-1484.898) (-1486.653) * [-1485.582] (-1483.732) (-1494.324) (-1488.558) -- 0:02:06
192500 -- (-1483.181) (-1485.518) [-1486.040] (-1488.867) * (-1484.956) [-1485.977] (-1492.697) (-1490.735) -- 0:02:05
193000 -- (-1485.028) [-1487.231] (-1489.292) (-1492.801) * (-1484.761) [-1487.370] (-1485.693) (-1487.643) -- 0:02:09
193500 -- [-1482.899] (-1486.141) (-1489.471) (-1494.335) * (-1489.140) (-1488.125) (-1484.424) [-1494.019] -- 0:02:09
194000 -- (-1493.778) (-1488.093) [-1482.700] (-1499.012) * [-1487.329] (-1485.573) (-1485.648) (-1494.910) -- 0:02:08
194500 -- (-1488.502) (-1490.797) [-1484.850] (-1496.676) * (-1491.951) (-1484.457) [-1490.239] (-1499.472) -- 0:02:08
195000 -- (-1483.032) [-1484.807] (-1487.371) (-1497.377) * (-1488.923) [-1482.590] (-1494.793) (-1490.199) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
195500 -- (-1486.690) (-1494.956) [-1484.148] (-1493.985) * (-1486.047) [-1482.517] (-1495.214) (-1487.038) -- 0:02:07
196000 -- (-1485.270) (-1499.291) [-1489.140] (-1486.115) * [-1482.930] (-1489.323) (-1489.624) (-1485.215) -- 0:02:07
196500 -- (-1487.202) (-1490.893) (-1486.851) [-1486.564] * [-1489.631] (-1490.777) (-1490.714) (-1485.660) -- 0:02:06
197000 -- (-1486.170) (-1487.481) (-1485.287) [-1484.243] * (-1489.928) [-1485.459] (-1488.438) (-1487.732) -- 0:02:06
197500 -- (-1492.838) (-1487.899) (-1485.823) [-1482.100] * (-1490.232) (-1488.926) (-1489.545) [-1488.021] -- 0:02:05
198000 -- (-1487.131) (-1493.803) (-1486.888) [-1485.872] * [-1484.658] (-1487.511) (-1497.969) (-1491.060) -- 0:02:05
198500 -- (-1485.871) [-1486.242] (-1487.960) (-1484.395) * (-1483.687) [-1486.845] (-1491.933) (-1488.423) -- 0:02:05
199000 -- (-1486.958) [-1485.047] (-1487.798) (-1485.708) * (-1485.969) [-1485.044] (-1500.762) (-1491.255) -- 0:02:04
199500 -- (-1488.144) [-1484.020] (-1496.699) (-1490.349) * (-1492.248) (-1484.642) (-1495.002) [-1485.776] -- 0:02:08
200000 -- (-1487.599) (-1489.619) [-1486.448] (-1489.294) * (-1484.132) (-1489.850) [-1491.367] (-1490.314) -- 0:02:08
Average standard deviation of split frequencies: 0.000000
200500 -- (-1488.479) (-1493.222) (-1492.424) [-1491.823] * (-1488.571) [-1490.235] (-1491.698) (-1490.222) -- 0:02:07
201000 -- [-1485.320] (-1495.476) (-1495.772) (-1493.290) * (-1488.040) [-1487.885] (-1490.627) (-1494.093) -- 0:02:07
201500 -- (-1489.976) (-1494.895) (-1490.371) [-1482.564] * (-1487.473) [-1487.372] (-1493.028) (-1491.068) -- 0:02:06
202000 -- (-1489.806) [-1498.724] (-1493.027) (-1489.928) * (-1492.875) (-1485.478) [-1490.066] (-1494.113) -- 0:02:06
202500 -- [-1488.322] (-1487.722) (-1486.564) (-1491.537) * (-1493.330) (-1489.630) (-1489.773) [-1488.100] -- 0:02:06
203000 -- (-1487.826) (-1491.498) [-1487.530] (-1487.595) * (-1501.084) (-1487.292) (-1488.438) [-1489.466] -- 0:02:05
203500 -- (-1492.644) (-1494.367) (-1484.082) [-1486.528] * (-1488.784) (-1487.934) (-1488.596) [-1489.392] -- 0:02:05
204000 -- (-1489.806) (-1494.353) [-1484.129] (-1485.648) * (-1485.945) (-1496.339) [-1486.076] (-1488.944) -- 0:02:04
204500 -- (-1485.752) (-1489.953) [-1491.068] (-1484.824) * (-1490.333) (-1495.532) [-1487.081] (-1488.176) -- 0:02:04
205000 -- (-1484.587) (-1491.521) [-1493.951] (-1487.977) * (-1489.617) (-1488.778) (-1490.667) [-1485.816] -- 0:02:04
Average standard deviation of split frequencies: 0.000000
205500 -- (-1483.910) (-1500.643) (-1485.330) [-1490.501] * [-1486.226] (-1488.138) (-1489.183) (-1486.459) -- 0:02:03
206000 -- (-1487.808) (-1484.926) [-1485.459] (-1491.860) * (-1484.072) [-1489.553] (-1488.635) (-1485.117) -- 0:02:07
206500 -- (-1490.009) [-1487.505] (-1483.836) (-1494.044) * (-1483.823) [-1487.681] (-1488.739) (-1485.069) -- 0:02:06
207000 -- [-1491.455] (-1485.885) (-1491.699) (-1498.172) * [-1484.742] (-1494.205) (-1490.893) (-1487.301) -- 0:02:06
207500 -- (-1488.778) (-1491.085) (-1486.934) [-1483.950] * (-1483.375) (-1484.708) [-1490.303] (-1490.839) -- 0:02:06
208000 -- (-1483.862) [-1490.962] (-1484.474) (-1488.886) * (-1499.307) (-1490.414) [-1487.759] (-1488.640) -- 0:02:05
208500 -- (-1485.870) (-1493.631) [-1487.308] (-1488.182) * (-1496.243) (-1489.866) [-1487.361] (-1486.804) -- 0:02:05
209000 -- [-1488.252] (-1489.902) (-1486.348) (-1485.974) * [-1492.660] (-1483.046) (-1488.303) (-1494.004) -- 0:02:04
209500 -- [-1494.293] (-1492.424) (-1492.580) (-1489.423) * [-1487.710] (-1488.764) (-1482.803) (-1493.636) -- 0:02:04
210000 -- [-1491.983] (-1488.792) (-1492.286) (-1485.226) * (-1487.066) (-1486.104) [-1485.846] (-1491.828) -- 0:02:04
Average standard deviation of split frequencies: 0.000000
210500 -- (-1487.464) [-1488.479] (-1489.781) (-1484.978) * (-1485.236) [-1486.669] (-1490.360) (-1485.501) -- 0:02:03
211000 -- (-1488.900) (-1488.741) (-1485.927) [-1485.060] * (-1488.786) (-1484.616) [-1491.083] (-1485.257) -- 0:02:03
211500 -- (-1487.930) (-1491.680) (-1485.798) [-1485.442] * (-1486.970) [-1484.713] (-1491.148) (-1487.220) -- 0:02:03
212000 -- (-1489.358) (-1487.758) [-1490.127] (-1486.553) * [-1489.250] (-1485.894) (-1486.594) (-1493.481) -- 0:02:02
212500 -- (-1493.111) (-1489.737) (-1485.958) [-1486.987] * (-1492.539) (-1488.351) [-1488.187] (-1490.191) -- 0:02:06
213000 -- (-1494.382) (-1486.045) (-1487.185) [-1487.677] * [-1485.976] (-1487.192) (-1487.063) (-1493.692) -- 0:02:05
213500 -- (-1493.191) (-1486.745) [-1491.355] (-1488.439) * (-1492.220) [-1490.036] (-1492.154) (-1493.809) -- 0:02:05
214000 -- [-1493.146] (-1495.166) (-1488.187) (-1490.138) * (-1486.944) (-1490.256) [-1487.770] (-1487.249) -- 0:02:04
214500 -- (-1489.130) [-1485.326] (-1490.559) (-1488.128) * (-1488.343) (-1487.984) [-1488.952] (-1488.303) -- 0:02:04
215000 -- (-1490.598) [-1487.334] (-1487.599) (-1486.089) * [-1490.711] (-1491.975) (-1490.131) (-1489.999) -- 0:02:04
Average standard deviation of split frequencies: 0.000000
215500 -- [-1484.495] (-1484.168) (-1494.623) (-1485.623) * (-1486.807) (-1487.229) (-1488.001) [-1489.593] -- 0:02:03
216000 -- (-1489.484) [-1485.786] (-1488.295) (-1484.988) * (-1498.195) (-1491.573) (-1491.521) [-1487.472] -- 0:02:03
216500 -- (-1485.365) [-1486.430] (-1488.376) (-1485.279) * (-1493.610) [-1494.990] (-1484.050) (-1489.715) -- 0:02:03
217000 -- (-1486.986) [-1485.167] (-1490.161) (-1489.347) * (-1497.430) (-1494.028) (-1491.162) [-1490.813] -- 0:02:02
217500 -- [-1495.975] (-1495.941) (-1486.913) (-1489.293) * (-1491.526) (-1490.194) [-1492.774] (-1490.186) -- 0:02:02
218000 -- (-1490.761) (-1493.590) [-1484.455] (-1489.307) * (-1489.927) (-1490.622) (-1495.817) [-1485.075] -- 0:02:01
218500 -- (-1492.088) (-1496.510) [-1490.871] (-1489.396) * [-1486.716] (-1489.229) (-1496.557) (-1482.204) -- 0:02:01
219000 -- (-1488.272) (-1492.752) (-1490.861) [-1490.076] * (-1489.003) [-1486.229] (-1488.319) (-1485.972) -- 0:02:04
219500 -- [-1486.684] (-1496.944) (-1494.665) (-1492.939) * (-1493.514) (-1488.511) (-1487.102) [-1489.257] -- 0:02:04
220000 -- (-1489.092) [-1490.862] (-1490.027) (-1494.346) * (-1489.942) [-1484.629] (-1487.295) (-1488.127) -- 0:02:04
Average standard deviation of split frequencies: 0.000000
220500 -- (-1492.352) (-1485.462) (-1484.224) [-1486.957] * [-1488.352] (-1493.646) (-1487.326) (-1485.652) -- 0:02:03
221000 -- (-1492.756) [-1486.090] (-1487.103) (-1489.100) * (-1493.133) [-1490.475] (-1488.921) (-1492.869) -- 0:02:03
221500 -- (-1488.456) (-1490.038) (-1488.325) [-1486.074] * (-1492.676) (-1490.763) (-1495.795) [-1485.364] -- 0:02:03
222000 -- (-1485.155) (-1490.134) (-1486.853) [-1485.515] * [-1492.734] (-1497.232) (-1487.481) (-1486.337) -- 0:02:02
222500 -- [-1488.485] (-1488.136) (-1488.542) (-1484.952) * (-1486.898) (-1495.684) (-1488.119) [-1484.562] -- 0:02:02
223000 -- [-1488.459] (-1493.474) (-1487.458) (-1487.340) * (-1491.261) [-1492.907] (-1490.390) (-1485.041) -- 0:02:01
223500 -- (-1486.309) [-1493.562] (-1484.771) (-1487.534) * (-1485.890) (-1492.851) [-1489.897] (-1493.108) -- 0:02:01
224000 -- (-1494.098) [-1486.520] (-1485.847) (-1488.863) * (-1487.207) [-1493.602] (-1489.245) (-1486.565) -- 0:02:01
224500 -- [-1491.613] (-1488.418) (-1486.638) (-1488.758) * (-1492.446) (-1494.037) (-1491.486) [-1487.925] -- 0:02:00
225000 -- (-1487.976) [-1487.372] (-1485.784) (-1486.186) * (-1491.366) [-1493.492] (-1491.758) (-1485.607) -- 0:02:04
Average standard deviation of split frequencies: 0.000000
225500 -- (-1492.983) (-1487.233) (-1489.229) [-1487.593] * (-1490.873) (-1493.570) [-1487.826] (-1485.669) -- 0:02:03
226000 -- (-1488.619) (-1486.909) (-1486.821) [-1485.470] * (-1491.923) (-1487.924) [-1485.165] (-1487.912) -- 0:02:03
226500 -- (-1498.987) (-1484.414) (-1493.557) [-1485.511] * (-1492.801) [-1486.217] (-1491.555) (-1484.411) -- 0:02:02
227000 -- (-1492.051) [-1488.261] (-1489.566) (-1496.143) * (-1485.389) [-1488.335] (-1487.324) (-1492.540) -- 0:02:02
227500 -- (-1488.399) (-1487.553) (-1489.654) [-1489.284] * [-1491.194] (-1484.893) (-1492.472) (-1485.895) -- 0:02:02
228000 -- (-1488.229) (-1488.310) (-1491.704) [-1489.731] * (-1487.540) (-1487.648) [-1488.489] (-1489.086) -- 0:02:01
228500 -- (-1494.183) (-1486.731) [-1487.919] (-1487.066) * (-1485.708) [-1488.566] (-1493.292) (-1486.069) -- 0:02:01
229000 -- (-1487.532) [-1483.574] (-1490.380) (-1495.052) * (-1486.223) (-1491.948) [-1489.266] (-1492.489) -- 0:02:01
229500 -- (-1492.560) (-1490.665) (-1487.428) [-1489.894] * [-1487.701] (-1496.256) (-1491.475) (-1490.868) -- 0:02:00
230000 -- (-1487.564) (-1486.291) (-1486.166) [-1488.675] * (-1491.115) (-1490.962) (-1491.265) [-1488.295] -- 0:02:00
Average standard deviation of split frequencies: 0.000000
230500 -- (-1491.165) (-1486.536) [-1489.992] (-1488.576) * [-1487.109] (-1486.992) (-1493.571) (-1487.076) -- 0:02:00
231000 -- (-1484.800) (-1485.244) (-1496.598) [-1485.754] * [-1486.398] (-1493.270) (-1497.100) (-1490.376) -- 0:01:59
231500 -- (-1486.239) (-1484.795) (-1492.181) [-1490.077] * (-1485.135) (-1488.087) (-1489.943) [-1484.870] -- 0:02:02
232000 -- (-1486.234) (-1488.776) [-1487.316] (-1498.071) * (-1486.641) (-1492.721) [-1482.809] (-1489.865) -- 0:02:02
232500 -- (-1489.461) (-1485.790) [-1487.576] (-1489.751) * (-1490.259) (-1491.616) (-1485.535) [-1488.515] -- 0:02:02
233000 -- [-1487.956] (-1486.639) (-1487.459) (-1492.203) * (-1491.977) (-1486.614) (-1485.146) [-1487.268] -- 0:02:01
233500 -- (-1492.793) (-1486.632) (-1490.908) [-1486.608] * (-1492.828) (-1487.212) [-1485.776] (-1487.271) -- 0:02:01
234000 -- (-1493.033) [-1489.256] (-1489.545) (-1482.732) * (-1491.393) (-1495.246) (-1486.009) [-1491.194] -- 0:02:01
234500 -- (-1492.091) (-1483.322) [-1485.790] (-1483.767) * (-1485.454) [-1490.681] (-1491.043) (-1490.939) -- 0:02:00
235000 -- (-1487.408) (-1487.001) [-1491.996] (-1485.095) * (-1488.444) [-1488.361] (-1498.311) (-1492.034) -- 0:02:00
Average standard deviation of split frequencies: 0.000000
235500 -- (-1492.409) (-1485.833) (-1487.658) [-1484.972] * (-1489.943) [-1489.027] (-1499.046) (-1489.055) -- 0:02:00
236000 -- (-1485.411) [-1488.865] (-1484.689) (-1486.047) * (-1487.301) (-1483.573) [-1489.474] (-1486.933) -- 0:01:59
236500 -- (-1491.370) [-1493.310] (-1487.674) (-1488.365) * [-1483.359] (-1491.134) (-1487.178) (-1496.227) -- 0:01:59
237000 -- [-1485.508] (-1487.481) (-1488.304) (-1489.661) * (-1492.355) (-1487.559) (-1486.094) [-1488.807] -- 0:01:59
237500 -- (-1484.894) (-1491.613) [-1488.855] (-1499.202) * (-1486.447) [-1486.966] (-1490.896) (-1489.763) -- 0:01:58
238000 -- [-1484.060] (-1491.364) (-1489.425) (-1500.133) * (-1488.017) (-1495.734) (-1486.944) [-1487.204] -- 0:02:01
238500 -- (-1488.241) (-1485.045) [-1485.417] (-1495.195) * (-1490.875) [-1487.323] (-1486.350) (-1482.619) -- 0:02:01
239000 -- (-1489.999) (-1486.974) (-1486.302) [-1489.294] * (-1483.737) [-1485.017] (-1487.580) (-1487.396) -- 0:02:00
239500 -- (-1491.048) (-1492.016) [-1492.511] (-1490.941) * (-1482.906) (-1482.824) (-1489.042) [-1490.211] -- 0:02:00
240000 -- [-1485.876] (-1493.729) (-1495.732) (-1486.757) * (-1493.451) (-1484.233) [-1482.864] (-1491.798) -- 0:02:00
Average standard deviation of split frequencies: 0.000000
240500 -- (-1489.891) [-1495.310] (-1501.274) (-1484.484) * (-1487.947) (-1486.640) [-1485.776] (-1487.227) -- 0:02:00
241000 -- [-1486.909] (-1488.751) (-1492.835) (-1484.177) * (-1485.288) (-1482.113) [-1487.539] (-1488.626) -- 0:01:59
241500 -- (-1493.996) (-1489.492) [-1485.919] (-1490.622) * [-1484.219] (-1490.961) (-1487.927) (-1497.124) -- 0:01:59
242000 -- (-1490.874) (-1484.382) [-1492.187] (-1488.408) * (-1488.346) [-1484.483] (-1486.993) (-1494.027) -- 0:01:59
242500 -- (-1489.366) [-1483.928] (-1490.091) (-1485.647) * (-1485.669) (-1491.516) (-1484.680) [-1494.856] -- 0:01:58
243000 -- (-1487.180) [-1486.221] (-1492.380) (-1492.191) * (-1486.235) (-1486.028) [-1486.543] (-1492.969) -- 0:01:58
243500 -- (-1489.950) (-1488.973) [-1491.874] (-1486.874) * [-1486.696] (-1484.066) (-1487.226) (-1489.006) -- 0:01:58
244000 -- (-1492.765) (-1490.626) [-1495.373] (-1486.964) * (-1491.085) (-1485.574) (-1494.622) [-1482.564] -- 0:02:00
244500 -- [-1490.899] (-1490.733) (-1485.953) (-1487.962) * (-1486.973) [-1486.916] (-1487.213) (-1487.392) -- 0:02:00
245000 -- (-1490.879) (-1495.885) [-1490.781] (-1493.658) * (-1492.870) [-1486.090] (-1488.828) (-1491.523) -- 0:02:00
Average standard deviation of split frequencies: 0.000000
245500 -- [-1484.099] (-1497.799) (-1490.087) (-1496.997) * (-1489.634) (-1491.547) (-1491.123) [-1487.416] -- 0:01:59
246000 -- [-1486.675] (-1489.253) (-1484.565) (-1493.164) * (-1485.784) (-1483.441) (-1486.289) [-1485.174] -- 0:01:59
246500 -- (-1483.371) [-1487.396] (-1492.319) (-1488.274) * (-1489.610) (-1491.984) (-1491.505) [-1491.475] -- 0:01:59
247000 -- (-1490.503) (-1492.508) [-1483.875] (-1488.611) * [-1486.054] (-1484.040) (-1494.099) (-1490.314) -- 0:01:58
247500 -- [-1487.071] (-1490.112) (-1490.535) (-1496.495) * [-1494.265] (-1488.632) (-1490.097) (-1486.540) -- 0:01:58
248000 -- (-1484.854) (-1494.505) [-1486.061] (-1487.255) * (-1491.151) [-1483.231] (-1484.870) (-1489.169) -- 0:01:58
248500 -- (-1488.065) (-1498.000) [-1489.123] (-1487.910) * (-1490.477) (-1484.784) (-1483.259) [-1485.166] -- 0:01:57
249000 -- (-1488.959) [-1486.911] (-1485.031) (-1495.870) * [-1498.594] (-1488.086) (-1486.953) (-1487.739) -- 0:01:57
249500 -- [-1486.944] (-1492.873) (-1484.470) (-1491.215) * (-1487.264) [-1485.165] (-1488.765) (-1487.500) -- 0:01:57
250000 -- (-1495.521) (-1490.110) [-1482.956] (-1496.429) * (-1485.490) (-1489.745) [-1489.903] (-1492.407) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
250500 -- (-1495.743) [-1485.186] (-1485.931) (-1487.679) * (-1495.580) [-1484.084] (-1489.880) (-1486.614) -- 0:01:59
251000 -- (-1486.707) [-1488.962] (-1484.124) (-1489.537) * (-1488.204) [-1484.382] (-1487.046) (-1481.281) -- 0:01:59
251500 -- (-1486.944) [-1486.371] (-1481.683) (-1493.131) * (-1487.959) (-1493.275) (-1487.210) [-1485.358] -- 0:01:59
252000 -- (-1487.569) (-1487.977) [-1487.719] (-1485.277) * (-1492.529) [-1488.554] (-1488.191) (-1491.205) -- 0:01:58
252500 -- (-1481.908) (-1488.407) [-1487.969] (-1485.314) * [-1487.678] (-1490.858) (-1490.747) (-1488.051) -- 0:01:58
253000 -- (-1488.039) (-1495.169) [-1483.012] (-1490.805) * (-1481.820) [-1490.449] (-1489.365) (-1487.522) -- 0:01:58
253500 -- (-1488.460) (-1489.003) [-1487.942] (-1488.392) * (-1493.842) (-1499.312) [-1486.095] (-1486.550) -- 0:01:57
254000 -- (-1488.048) (-1486.503) [-1488.630] (-1490.092) * [-1489.949] (-1492.586) (-1494.003) (-1489.546) -- 0:01:57
254500 -- (-1486.921) (-1485.440) [-1490.937] (-1485.665) * (-1485.480) (-1485.859) (-1489.797) [-1483.833] -- 0:01:57
255000 -- [-1485.350] (-1490.576) (-1486.195) (-1485.842) * (-1487.018) (-1485.277) (-1492.594) [-1485.643] -- 0:01:56
Average standard deviation of split frequencies: 0.000000
255500 -- (-1494.734) [-1484.876] (-1488.328) (-1493.193) * (-1490.580) (-1489.325) (-1490.640) [-1483.788] -- 0:01:56
256000 -- [-1485.632] (-1501.339) (-1489.875) (-1496.731) * (-1489.554) [-1484.521] (-1487.504) (-1488.972) -- 0:01:56
256500 -- (-1484.929) (-1487.035) (-1487.374) [-1492.663] * (-1491.381) (-1491.397) [-1489.735] (-1485.638) -- 0:01:58
257000 -- (-1487.260) (-1491.691) (-1492.064) [-1484.887] * (-1487.440) (-1491.154) (-1489.125) [-1485.819] -- 0:01:58
257500 -- (-1482.930) [-1492.954] (-1488.452) (-1488.848) * (-1487.153) (-1485.503) [-1495.884] (-1493.676) -- 0:01:58
258000 -- (-1483.525) (-1487.111) (-1487.278) [-1484.753] * (-1486.270) (-1485.014) [-1487.442] (-1486.592) -- 0:01:57
258500 -- [-1487.448] (-1488.137) (-1492.939) (-1492.262) * (-1489.899) (-1487.998) (-1490.565) [-1486.998] -- 0:01:57
259000 -- (-1489.443) (-1489.511) (-1490.466) [-1484.738] * (-1489.038) (-1490.042) (-1489.903) [-1493.813] -- 0:01:57
259500 -- (-1490.681) (-1485.375) [-1488.883] (-1488.554) * (-1487.894) (-1490.232) (-1486.762) [-1486.068] -- 0:01:56
260000 -- (-1488.623) (-1487.145) (-1493.496) [-1487.079] * [-1487.961] (-1488.570) (-1489.527) (-1485.210) -- 0:01:56
Average standard deviation of split frequencies: 0.000000
260500 -- [-1487.163] (-1485.569) (-1496.805) (-1487.532) * [-1484.472] (-1485.045) (-1490.910) (-1491.405) -- 0:01:56
261000 -- (-1487.623) (-1488.224) [-1489.551] (-1490.875) * [-1483.863] (-1492.030) (-1486.553) (-1485.468) -- 0:01:56
261500 -- [-1489.847] (-1487.360) (-1493.087) (-1488.127) * (-1488.030) [-1488.849] (-1486.496) (-1490.696) -- 0:01:55
262000 -- (-1489.930) [-1485.833] (-1487.038) (-1495.347) * [-1486.582] (-1487.028) (-1493.191) (-1491.395) -- 0:01:55
262500 -- (-1489.692) [-1485.834] (-1484.034) (-1492.104) * [-1485.647] (-1495.190) (-1485.743) (-1487.792) -- 0:01:58
263000 -- (-1491.641) [-1487.283] (-1486.353) (-1489.145) * (-1487.975) (-1489.781) (-1490.396) [-1484.052] -- 0:01:57
263500 -- (-1492.828) (-1488.022) [-1485.539] (-1493.376) * (-1491.701) [-1488.574] (-1484.022) (-1488.175) -- 0:01:57
264000 -- [-1487.515] (-1487.362) (-1495.803) (-1488.889) * [-1485.580] (-1486.954) (-1484.214) (-1485.749) -- 0:01:57
264500 -- (-1488.962) (-1484.879) [-1494.617] (-1489.081) * (-1492.623) (-1491.460) (-1482.446) [-1486.316] -- 0:01:56
265000 -- (-1487.164) (-1491.990) (-1487.864) [-1495.784] * (-1491.232) (-1494.781) [-1484.677] (-1494.300) -- 0:01:56
Average standard deviation of split frequencies: 0.000000
265500 -- (-1484.378) [-1487.859] (-1492.757) (-1487.391) * (-1491.624) [-1485.173] (-1492.954) (-1492.240) -- 0:01:56
266000 -- (-1485.384) (-1485.738) (-1493.932) [-1485.760] * (-1494.976) (-1489.773) [-1488.495] (-1493.886) -- 0:01:55
266500 -- (-1490.927) (-1488.852) [-1493.279] (-1486.576) * [-1492.230] (-1491.447) (-1485.163) (-1504.310) -- 0:01:55
267000 -- (-1488.015) [-1491.423] (-1486.671) (-1488.219) * (-1487.221) (-1488.163) [-1485.732] (-1490.307) -- 0:01:55
267500 -- (-1489.739) [-1487.870] (-1484.544) (-1490.554) * [-1486.886] (-1487.628) (-1490.775) (-1484.150) -- 0:01:55
268000 -- (-1488.806) [-1484.648] (-1486.840) (-1488.303) * (-1489.577) [-1491.096] (-1485.533) (-1493.313) -- 0:01:57
268500 -- (-1491.299) (-1484.019) [-1485.938] (-1492.309) * [-1489.481] (-1497.985) (-1491.416) (-1488.437) -- 0:01:57
269000 -- (-1487.286) [-1481.766] (-1486.060) (-1487.466) * (-1484.951) (-1497.909) [-1485.270] (-1486.821) -- 0:01:56
269500 -- [-1491.056] (-1486.799) (-1490.264) (-1488.022) * [-1490.234] (-1486.783) (-1491.968) (-1484.889) -- 0:01:56
270000 -- (-1487.754) (-1486.598) [-1484.349] (-1489.152) * (-1487.637) (-1486.539) (-1491.257) [-1486.097] -- 0:01:56
Average standard deviation of split frequencies: 0.000000
270500 -- [-1484.462] (-1488.948) (-1488.956) (-1494.486) * (-1496.736) (-1489.475) (-1492.504) [-1491.184] -- 0:01:55
271000 -- (-1488.926) (-1487.263) [-1490.892] (-1497.535) * (-1490.816) (-1490.635) [-1490.239] (-1492.197) -- 0:01:55
271500 -- (-1493.728) [-1488.265] (-1493.892) (-1494.324) * (-1489.533) (-1489.669) [-1486.564] (-1487.895) -- 0:01:55
272000 -- (-1489.573) (-1485.479) [-1487.995] (-1489.730) * (-1490.704) [-1487.704] (-1487.259) (-1484.685) -- 0:01:55
272500 -- (-1488.760) [-1485.919] (-1494.790) (-1490.114) * (-1492.638) (-1487.705) [-1487.551] (-1491.678) -- 0:01:54
273000 -- (-1488.498) [-1485.776] (-1492.475) (-1493.952) * (-1497.230) [-1487.765] (-1488.895) (-1497.123) -- 0:01:54
273500 -- (-1486.364) (-1493.753) (-1489.101) [-1488.418] * (-1490.207) [-1491.634] (-1488.286) (-1489.493) -- 0:01:54
274000 -- (-1489.450) (-1492.128) (-1494.311) [-1489.831] * (-1486.460) (-1488.735) [-1491.304] (-1491.214) -- 0:01:56
274500 -- (-1489.976) [-1489.022] (-1495.106) (-1489.234) * (-1486.199) [-1491.691] (-1488.588) (-1486.835) -- 0:01:56
275000 -- (-1489.737) (-1492.824) (-1489.241) [-1486.754] * (-1491.072) (-1497.317) [-1483.482] (-1490.248) -- 0:01:56
Average standard deviation of split frequencies: 0.000000
275500 -- [-1484.971] (-1492.892) (-1488.534) (-1490.832) * (-1491.093) (-1490.738) (-1487.021) [-1485.436] -- 0:01:55
276000 -- (-1491.282) (-1494.641) [-1494.132] (-1491.140) * (-1487.035) [-1491.092] (-1485.232) (-1489.127) -- 0:01:55
276500 -- (-1487.767) (-1492.567) [-1484.954] (-1490.409) * (-1491.539) [-1491.273] (-1490.763) (-1485.243) -- 0:01:55
277000 -- (-1484.954) (-1496.347) [-1494.527] (-1488.555) * (-1492.697) (-1488.174) (-1485.461) [-1482.387] -- 0:01:54
277500 -- (-1490.360) (-1495.182) (-1491.481) [-1485.877] * (-1487.429) [-1483.867] (-1484.820) (-1484.508) -- 0:01:54
278000 -- [-1486.840] (-1486.984) (-1489.403) (-1493.044) * [-1486.630] (-1483.106) (-1487.749) (-1487.620) -- 0:01:54
278500 -- [-1485.537] (-1487.187) (-1493.487) (-1492.168) * (-1484.303) [-1492.794] (-1488.332) (-1484.915) -- 0:01:53
279000 -- (-1490.183) (-1484.739) [-1491.132] (-1492.706) * (-1488.638) [-1486.117] (-1485.723) (-1488.354) -- 0:01:53
279500 -- (-1486.826) (-1488.225) [-1486.821] (-1488.741) * (-1490.567) (-1488.201) [-1485.500] (-1483.961) -- 0:01:56
280000 -- (-1487.034) [-1485.813] (-1496.461) (-1484.635) * (-1487.151) (-1488.956) [-1483.757] (-1489.964) -- 0:01:55
Average standard deviation of split frequencies: 0.000000
280500 -- [-1490.008] (-1491.615) (-1488.010) (-1493.414) * [-1485.837] (-1489.138) (-1486.141) (-1487.281) -- 0:01:55
281000 -- (-1489.324) [-1484.991] (-1492.356) (-1490.969) * (-1488.923) [-1486.075] (-1488.443) (-1488.419) -- 0:01:55
281500 -- [-1489.944] (-1487.443) (-1490.745) (-1484.657) * (-1491.678) [-1486.140] (-1487.819) (-1485.575) -- 0:01:54
282000 -- (-1486.100) [-1486.861] (-1490.787) (-1486.872) * (-1495.500) (-1493.499) (-1489.896) [-1487.236] -- 0:01:54
282500 -- (-1491.836) [-1485.938] (-1489.615) (-1490.385) * (-1489.700) (-1495.024) [-1489.151] (-1488.931) -- 0:01:54
283000 -- (-1493.668) [-1489.582] (-1490.139) (-1491.280) * (-1491.317) [-1489.167] (-1491.122) (-1491.258) -- 0:01:54
283500 -- [-1494.082] (-1489.661) (-1487.529) (-1484.994) * (-1487.790) (-1489.347) (-1486.588) [-1488.261] -- 0:01:53
284000 -- (-1486.654) [-1484.910] (-1491.262) (-1485.763) * (-1495.788) (-1489.197) (-1490.943) [-1488.968] -- 0:01:53
284500 -- (-1492.626) [-1485.429] (-1490.042) (-1490.068) * (-1485.831) (-1486.009) [-1488.549] (-1489.359) -- 0:01:53
285000 -- (-1498.196) (-1494.436) (-1486.865) [-1482.715] * [-1485.291] (-1486.918) (-1486.715) (-1484.271) -- 0:01:52
Average standard deviation of split frequencies: 0.000000
285500 -- (-1492.890) (-1487.577) [-1488.278] (-1487.109) * [-1486.798] (-1491.398) (-1488.264) (-1488.110) -- 0:01:55
286000 -- (-1498.670) [-1486.100] (-1486.557) (-1491.550) * (-1491.652) [-1489.348] (-1491.814) (-1487.976) -- 0:01:54
286500 -- (-1486.873) (-1490.548) [-1487.052] (-1487.085) * (-1488.335) [-1484.764] (-1491.285) (-1493.478) -- 0:01:54
287000 -- [-1486.599] (-1488.787) (-1486.224) (-1493.264) * (-1496.631) [-1485.480] (-1496.286) (-1493.407) -- 0:01:54
287500 -- (-1490.496) [-1487.114] (-1493.017) (-1496.881) * (-1492.522) (-1489.620) (-1494.469) [-1488.545] -- 0:01:54
288000 -- [-1491.945] (-1489.578) (-1486.686) (-1490.174) * (-1495.993) (-1492.990) [-1490.128] (-1492.909) -- 0:01:53
288500 -- (-1490.522) (-1486.450) [-1492.945] (-1494.099) * (-1486.517) [-1488.019] (-1487.042) (-1485.917) -- 0:01:53
289000 -- (-1487.536) (-1484.742) [-1485.714] (-1492.182) * [-1485.771] (-1490.482) (-1490.904) (-1485.589) -- 0:01:53
289500 -- (-1493.408) (-1495.368) [-1487.176] (-1489.132) * (-1487.664) (-1489.034) (-1491.714) [-1483.410] -- 0:01:52
290000 -- (-1494.287) [-1485.682] (-1490.633) (-1497.275) * (-1486.603) (-1488.820) (-1489.540) [-1486.332] -- 0:01:52
Average standard deviation of split frequencies: 0.000000
290500 -- [-1492.224] (-1488.205) (-1486.745) (-1485.253) * [-1494.756] (-1489.542) (-1489.104) (-1486.189) -- 0:01:52
291000 -- (-1490.987) (-1489.404) (-1489.151) [-1486.747] * (-1486.318) (-1490.638) [-1496.743] (-1495.038) -- 0:01:52
291500 -- (-1496.767) (-1487.165) [-1484.636] (-1491.631) * (-1483.537) (-1495.477) (-1490.399) [-1487.682] -- 0:01:54
292000 -- [-1487.755] (-1489.266) (-1492.805) (-1485.681) * (-1486.694) (-1489.872) [-1489.042] (-1492.529) -- 0:01:53
292500 -- (-1492.293) [-1486.152] (-1485.913) (-1484.543) * [-1484.782] (-1491.769) (-1484.927) (-1490.009) -- 0:01:53
293000 -- (-1488.667) (-1487.257) (-1493.307) [-1486.717] * (-1487.603) [-1491.341] (-1493.622) (-1485.651) -- 0:01:53
293500 -- [-1485.737] (-1487.896) (-1485.469) (-1492.275) * (-1484.443) (-1494.762) (-1490.646) [-1488.089] -- 0:01:53
294000 -- (-1485.078) (-1491.048) [-1485.427] (-1493.352) * (-1489.176) [-1485.652] (-1486.278) (-1486.641) -- 0:01:52
294500 -- (-1484.944) [-1492.185] (-1497.037) (-1491.429) * (-1484.615) [-1485.568] (-1490.140) (-1487.797) -- 0:01:52
295000 -- (-1486.620) (-1486.174) [-1494.199] (-1493.400) * (-1488.402) [-1487.866] (-1495.100) (-1488.071) -- 0:01:52
Average standard deviation of split frequencies: 0.000000
295500 -- [-1486.967] (-1489.554) (-1487.148) (-1487.805) * [-1484.176] (-1491.443) (-1489.693) (-1490.327) -- 0:01:52
296000 -- [-1498.905] (-1489.467) (-1487.169) (-1488.517) * (-1487.216) (-1493.942) (-1492.381) [-1486.408] -- 0:01:51
296500 -- (-1492.739) (-1491.739) [-1485.391] (-1488.792) * (-1487.462) [-1486.023] (-1494.070) (-1488.460) -- 0:01:51
297000 -- [-1487.143] (-1493.631) (-1488.002) (-1488.153) * [-1489.931] (-1483.417) (-1494.029) (-1486.406) -- 0:01:51
297500 -- (-1489.697) [-1489.499] (-1484.827) (-1486.932) * [-1486.074] (-1489.971) (-1492.610) (-1488.742) -- 0:01:53
298000 -- [-1495.774] (-1490.107) (-1486.831) (-1485.479) * [-1483.263] (-1493.221) (-1496.473) (-1486.791) -- 0:01:53
298500 -- (-1488.282) (-1486.434) (-1483.129) [-1490.066] * (-1491.549) (-1489.434) (-1490.132) [-1491.515] -- 0:01:52
299000 -- (-1490.722) (-1491.910) [-1486.829] (-1492.912) * (-1491.367) [-1486.628] (-1485.386) (-1484.245) -- 0:01:52
299500 -- (-1492.254) (-1492.782) [-1490.251] (-1491.452) * [-1484.749] (-1489.347) (-1483.714) (-1489.774) -- 0:01:52
300000 -- (-1488.901) (-1487.354) [-1487.531] (-1486.011) * (-1487.407) (-1488.989) [-1483.634] (-1486.203) -- 0:01:52
Average standard deviation of split frequencies: 0.000000
300500 -- (-1490.395) (-1485.927) [-1486.024] (-1490.534) * [-1486.034] (-1484.926) (-1484.905) (-1485.951) -- 0:01:51
301000 -- (-1489.119) (-1487.624) [-1492.463] (-1487.929) * (-1485.764) (-1483.948) (-1481.816) [-1491.415] -- 0:01:51
301500 -- (-1488.119) (-1487.912) [-1487.330] (-1497.056) * (-1488.703) (-1485.292) (-1489.848) [-1484.257] -- 0:01:51
302000 -- (-1488.788) (-1485.852) [-1488.117] (-1492.238) * (-1486.637) (-1487.990) [-1491.591] (-1488.345) -- 0:01:50
302500 -- (-1487.701) [-1482.680] (-1489.521) (-1489.247) * (-1488.726) [-1492.968] (-1488.860) (-1489.558) -- 0:01:50
303000 -- [-1491.185] (-1490.365) (-1489.227) (-1496.972) * (-1492.761) (-1488.805) (-1491.226) [-1488.194] -- 0:01:50
303500 -- (-1491.136) (-1491.622) [-1491.844] (-1490.119) * [-1482.409] (-1490.503) (-1490.439) (-1493.016) -- 0:01:50
304000 -- (-1488.104) (-1487.804) [-1492.859] (-1486.508) * (-1485.692) [-1482.935] (-1496.822) (-1486.093) -- 0:01:52
304500 -- (-1490.495) (-1486.284) (-1489.892) [-1486.872] * (-1490.494) (-1488.907) (-1491.436) [-1487.664] -- 0:01:51
305000 -- (-1495.060) (-1494.600) (-1489.703) [-1485.683] * (-1485.991) (-1490.333) [-1488.134] (-1483.686) -- 0:01:51
Average standard deviation of split frequencies: 0.000000
305500 -- (-1488.353) (-1488.058) [-1486.639] (-1489.867) * [-1486.975] (-1488.501) (-1483.159) (-1487.425) -- 0:01:51
306000 -- (-1488.638) (-1488.309) [-1487.456] (-1491.776) * (-1488.049) [-1491.676] (-1491.513) (-1485.409) -- 0:01:51
306500 -- (-1487.576) (-1485.425) (-1490.716) [-1489.946] * (-1488.250) (-1487.196) [-1486.959] (-1485.993) -- 0:01:50
307000 -- (-1487.556) (-1485.924) (-1490.094) [-1487.216] * (-1490.935) [-1488.721] (-1491.694) (-1490.662) -- 0:01:50
307500 -- (-1493.185) [-1487.034] (-1482.842) (-1491.938) * (-1493.563) (-1487.084) [-1487.973] (-1488.315) -- 0:01:50
308000 -- (-1494.997) [-1484.873] (-1488.241) (-1493.320) * (-1490.558) [-1485.614] (-1490.304) (-1495.466) -- 0:01:50
308500 -- [-1490.089] (-1490.723) (-1486.875) (-1490.510) * (-1491.256) (-1491.756) (-1487.800) [-1489.731] -- 0:01:49
309000 -- (-1490.335) (-1492.940) [-1490.331] (-1497.541) * [-1485.160] (-1488.449) (-1484.303) (-1489.576) -- 0:01:49
309500 -- [-1489.749] (-1491.233) (-1488.354) (-1485.821) * (-1488.180) (-1489.905) [-1487.428] (-1489.488) -- 0:01:49
310000 -- (-1490.264) (-1493.635) (-1490.124) [-1483.265] * (-1491.574) (-1487.231) [-1490.829] (-1488.370) -- 0:01:51
Average standard deviation of split frequencies: 0.000000
310500 -- (-1486.640) (-1490.940) [-1483.901] (-1485.041) * (-1491.062) (-1494.317) (-1484.619) [-1489.903] -- 0:01:51
311000 -- (-1493.012) [-1494.292] (-1489.182) (-1484.352) * (-1490.050) (-1489.971) [-1490.118] (-1492.307) -- 0:01:50
311500 -- [-1490.726] (-1496.568) (-1495.050) (-1484.761) * (-1490.324) (-1487.362) (-1488.204) [-1493.069] -- 0:01:50
312000 -- (-1487.050) [-1488.902] (-1495.938) (-1487.769) * (-1487.862) [-1488.577] (-1485.209) (-1497.258) -- 0:01:50
312500 -- (-1491.468) (-1493.171) (-1503.896) [-1485.462] * (-1490.345) [-1487.027] (-1488.316) (-1489.413) -- 0:01:50
313000 -- (-1498.893) [-1484.233] (-1496.357) (-1488.352) * (-1485.987) [-1486.293] (-1485.706) (-1491.909) -- 0:01:49
313500 -- (-1497.663) [-1487.068] (-1497.574) (-1491.562) * (-1490.124) (-1486.008) [-1491.398] (-1490.189) -- 0:01:49
314000 -- (-1486.844) [-1482.391] (-1495.603) (-1493.485) * (-1487.521) [-1488.279] (-1490.578) (-1491.101) -- 0:01:49
314500 -- (-1492.618) (-1488.782) (-1487.366) [-1486.112] * (-1489.986) (-1483.983) [-1490.325] (-1484.900) -- 0:01:48
315000 -- (-1489.210) (-1493.673) [-1490.537] (-1489.031) * (-1484.656) [-1490.102] (-1485.944) (-1489.324) -- 0:01:48
Average standard deviation of split frequencies: 0.000000
315500 -- [-1491.406] (-1485.169) (-1493.825) (-1488.473) * (-1490.616) [-1485.338] (-1484.022) (-1492.056) -- 0:01:48
316000 -- (-1489.403) [-1486.495] (-1487.306) (-1492.710) * (-1493.668) [-1482.896] (-1490.081) (-1493.793) -- 0:01:48
316500 -- (-1493.775) (-1488.277) (-1484.388) [-1490.276] * (-1491.456) [-1490.118] (-1487.622) (-1488.015) -- 0:01:50
317000 -- [-1490.236] (-1494.973) (-1483.507) (-1492.143) * (-1489.873) (-1485.513) (-1488.197) [-1485.531] -- 0:01:49
317500 -- (-1490.975) (-1497.370) [-1483.594] (-1488.187) * [-1494.441] (-1487.970) (-1490.455) (-1488.187) -- 0:01:49
318000 -- (-1491.486) (-1490.702) [-1489.679] (-1490.437) * [-1484.710] (-1487.934) (-1487.297) (-1487.132) -- 0:01:49
318500 -- (-1489.341) [-1488.142] (-1483.374) (-1487.097) * (-1490.058) [-1490.785] (-1486.673) (-1488.084) -- 0:01:49
319000 -- (-1490.740) (-1488.319) (-1486.477) [-1485.023] * (-1498.381) [-1491.180] (-1490.812) (-1494.119) -- 0:01:48
319500 -- (-1492.975) [-1486.460] (-1489.878) (-1486.241) * (-1494.928) [-1491.207] (-1492.739) (-1488.727) -- 0:01:48
320000 -- [-1491.236] (-1489.273) (-1489.494) (-1490.361) * (-1504.698) [-1487.179] (-1489.968) (-1485.954) -- 0:01:48
Average standard deviation of split frequencies: 0.000000
320500 -- (-1494.939) (-1490.930) (-1496.681) [-1488.803] * (-1491.097) (-1487.182) [-1486.677] (-1496.794) -- 0:01:48
321000 -- (-1491.815) (-1489.347) (-1489.304) [-1485.869] * [-1487.167] (-1494.448) (-1494.186) (-1490.149) -- 0:01:47
321500 -- (-1485.059) (-1494.264) (-1483.928) [-1485.600] * (-1495.001) (-1490.906) [-1487.858] (-1491.995) -- 0:01:47
322000 -- [-1488.692] (-1492.381) (-1488.543) (-1490.680) * (-1490.994) (-1495.726) [-1484.602] (-1488.039) -- 0:01:47
322500 -- (-1488.557) (-1494.685) [-1487.636] (-1489.164) * [-1485.492] (-1494.873) (-1487.855) (-1492.603) -- 0:01:49
323000 -- [-1490.445] (-1491.668) (-1485.816) (-1489.781) * (-1486.640) (-1495.809) (-1490.136) [-1487.697] -- 0:01:48
323500 -- (-1489.254) (-1485.672) [-1484.434] (-1494.017) * (-1495.498) (-1485.757) (-1492.592) [-1487.713] -- 0:01:48
324000 -- (-1488.212) [-1489.661] (-1484.468) (-1493.103) * (-1488.354) (-1486.404) (-1488.013) [-1484.559] -- 0:01:48
324500 -- (-1489.376) (-1488.116) [-1486.095] (-1485.275) * [-1488.441] (-1491.628) (-1489.118) (-1486.023) -- 0:01:48
325000 -- (-1486.218) (-1484.815) (-1493.106) [-1485.822] * (-1491.077) (-1492.339) (-1486.855) [-1490.047] -- 0:01:48
Average standard deviation of split frequencies: 0.000000
325500 -- (-1490.539) [-1488.942] (-1487.363) (-1491.085) * (-1486.346) (-1486.150) (-1486.628) [-1486.292] -- 0:01:47
326000 -- (-1490.649) (-1489.155) [-1483.441] (-1490.068) * (-1484.385) [-1483.499] (-1496.416) (-1491.003) -- 0:01:47
326500 -- (-1499.394) [-1493.350] (-1492.346) (-1491.727) * (-1491.812) (-1492.993) [-1487.765] (-1483.614) -- 0:01:47
327000 -- (-1489.121) [-1486.844] (-1490.139) (-1495.550) * (-1491.729) [-1489.627] (-1493.961) (-1485.928) -- 0:01:47
327500 -- [-1488.536] (-1486.178) (-1489.456) (-1487.987) * (-1492.832) (-1486.531) [-1486.641] (-1487.930) -- 0:01:46
328000 -- [-1491.384] (-1486.431) (-1484.069) (-1490.236) * [-1485.198] (-1484.054) (-1485.465) (-1486.418) -- 0:01:48
328500 -- (-1496.716) [-1487.902] (-1483.235) (-1490.078) * (-1494.971) [-1486.597] (-1490.990) (-1482.540) -- 0:01:48
329000 -- (-1495.850) (-1490.334) [-1484.051] (-1484.938) * (-1492.958) (-1488.715) [-1490.631] (-1485.650) -- 0:01:48
329500 -- (-1495.152) (-1488.993) [-1484.353] (-1485.793) * (-1489.018) (-1484.787) (-1489.012) [-1490.472] -- 0:01:47
330000 -- (-1494.297) (-1487.132) [-1483.684] (-1485.985) * (-1486.400) (-1486.068) [-1486.205] (-1486.498) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
330500 -- (-1484.206) (-1484.046) [-1489.486] (-1485.861) * (-1489.204) (-1488.794) [-1484.324] (-1492.928) -- 0:01:47
331000 -- (-1486.505) (-1487.056) (-1488.484) [-1484.063] * (-1488.319) (-1495.922) [-1489.003] (-1486.046) -- 0:01:47
331500 -- (-1494.109) (-1487.283) [-1488.060] (-1492.076) * (-1491.334) [-1483.913] (-1486.207) (-1483.400) -- 0:01:46
332000 -- [-1487.253] (-1487.131) (-1489.963) (-1485.953) * (-1485.384) (-1487.557) [-1483.954] (-1488.518) -- 0:01:46
332500 -- (-1496.557) (-1490.434) (-1492.030) [-1488.171] * (-1483.016) (-1485.707) [-1489.303] (-1482.589) -- 0:01:46
333000 -- (-1488.660) [-1486.011] (-1487.178) (-1488.806) * (-1483.480) (-1497.007) [-1483.109] (-1486.306) -- 0:01:46
333500 -- (-1489.353) (-1491.526) [-1490.688] (-1490.266) * (-1492.102) (-1496.212) (-1493.381) [-1490.458] -- 0:01:45
334000 -- [-1489.066] (-1485.652) (-1488.613) (-1490.292) * (-1487.756) (-1486.969) (-1495.642) [-1489.855] -- 0:01:47
334500 -- (-1486.493) (-1490.776) (-1488.257) [-1488.916] * (-1491.421) [-1483.481] (-1487.671) (-1487.515) -- 0:01:47
335000 -- [-1483.565] (-1491.221) (-1486.498) (-1490.067) * (-1487.666) [-1488.156] (-1483.630) (-1487.491) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
335500 -- [-1485.029] (-1485.980) (-1498.135) (-1486.007) * [-1488.882] (-1489.650) (-1488.269) (-1484.048) -- 0:01:46
336000 -- (-1485.165) [-1487.707] (-1486.809) (-1489.587) * (-1486.500) (-1487.359) [-1486.100] (-1489.055) -- 0:01:46
336500 -- (-1487.428) (-1485.909) (-1484.126) [-1483.606] * [-1485.300] (-1488.449) (-1486.840) (-1483.866) -- 0:01:46
337000 -- (-1486.325) (-1489.371) [-1487.931] (-1483.441) * [-1486.243] (-1487.279) (-1491.221) (-1485.243) -- 0:01:46
337500 -- [-1488.683] (-1487.694) (-1493.943) (-1491.419) * (-1493.352) (-1484.710) [-1488.346] (-1486.796) -- 0:01:46
338000 -- (-1486.653) (-1494.102) [-1499.100] (-1488.472) * (-1493.059) (-1495.264) [-1485.603] (-1484.333) -- 0:01:45
338500 -- (-1495.431) (-1494.414) [-1491.115] (-1493.949) * (-1491.551) (-1486.987) (-1490.718) [-1480.690] -- 0:01:45
339000 -- (-1486.641) (-1498.762) [-1487.910] (-1497.896) * (-1487.386) (-1487.604) [-1485.026] (-1487.206) -- 0:01:45
339500 -- (-1489.769) (-1497.810) (-1496.068) [-1490.748] * (-1494.669) (-1488.771) [-1486.040] (-1483.040) -- 0:01:45
340000 -- [-1485.702] (-1498.586) (-1492.127) (-1486.974) * (-1486.756) [-1490.044] (-1487.868) (-1488.145) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
340500 -- (-1495.607) (-1496.521) [-1485.039] (-1486.996) * (-1488.477) (-1485.929) [-1488.180] (-1487.872) -- 0:01:46
341000 -- (-1490.339) (-1493.228) [-1482.966] (-1486.385) * [-1481.829] (-1491.450) (-1488.447) (-1488.282) -- 0:01:46
341500 -- (-1489.664) [-1492.482] (-1489.432) (-1484.396) * (-1494.492) [-1489.447] (-1487.832) (-1492.460) -- 0:01:46
342000 -- (-1494.951) (-1496.742) [-1485.324] (-1485.248) * [-1482.835] (-1491.700) (-1488.489) (-1486.164) -- 0:01:45
342500 -- (-1485.139) (-1495.144) [-1482.995] (-1484.141) * (-1482.541) (-1501.745) [-1485.911] (-1487.522) -- 0:01:45
343000 -- [-1488.143] (-1494.000) (-1486.874) (-1487.290) * (-1486.190) (-1487.241) [-1489.442] (-1499.953) -- 0:01:45
343500 -- (-1494.169) [-1487.468] (-1491.795) (-1487.737) * (-1485.097) (-1499.768) [-1487.481] (-1485.275) -- 0:01:45
344000 -- (-1483.624) [-1494.439] (-1489.586) (-1487.748) * (-1486.831) (-1487.409) [-1490.055] (-1486.795) -- 0:01:44
344500 -- (-1488.784) (-1487.624) [-1490.969] (-1486.405) * (-1490.576) (-1489.711) [-1487.081] (-1488.602) -- 0:01:44
345000 -- (-1485.379) (-1490.940) (-1483.292) [-1483.385] * (-1482.802) (-1488.040) [-1486.410] (-1486.381) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
345500 -- (-1487.955) (-1491.016) (-1484.664) [-1488.499] * (-1489.094) (-1492.505) (-1486.868) [-1487.131] -- 0:01:44
346000 -- (-1489.998) (-1487.599) [-1484.575] (-1496.611) * [-1488.687] (-1495.250) (-1488.014) (-1487.516) -- 0:01:43
346500 -- (-1489.783) [-1483.989] (-1490.334) (-1495.214) * (-1483.501) [-1495.818] (-1493.874) (-1484.817) -- 0:01:45
347000 -- (-1490.478) (-1482.827) [-1487.725] (-1491.917) * [-1486.878] (-1500.808) (-1491.392) (-1485.428) -- 0:01:45
347500 -- (-1487.346) (-1484.613) [-1489.631] (-1490.187) * (-1489.820) (-1491.169) (-1488.170) [-1485.869] -- 0:01:45
348000 -- (-1489.181) (-1485.880) (-1490.760) [-1491.302] * (-1486.482) (-1489.448) (-1485.818) [-1485.298] -- 0:01:44
348500 -- [-1488.717] (-1496.918) (-1485.961) (-1487.936) * (-1488.418) [-1488.430] (-1486.538) (-1486.931) -- 0:01:44
349000 -- (-1491.097) [-1486.812] (-1488.095) (-1489.705) * [-1491.692] (-1486.735) (-1494.501) (-1489.849) -- 0:01:44
349500 -- (-1492.813) [-1488.226] (-1491.625) (-1488.239) * (-1493.543) (-1491.920) (-1484.170) [-1486.557] -- 0:01:44
350000 -- (-1486.413) (-1492.608) (-1491.498) [-1484.511] * (-1488.223) (-1491.774) [-1484.484] (-1482.826) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
350500 -- (-1489.962) [-1490.891] (-1490.509) (-1489.194) * (-1489.970) (-1493.929) (-1491.198) [-1484.213] -- 0:01:43
351000 -- (-1489.082) [-1484.788] (-1488.542) (-1490.151) * (-1491.887) (-1494.525) (-1487.957) [-1486.009] -- 0:01:43
351500 -- [-1489.275] (-1490.062) (-1496.097) (-1495.856) * (-1487.462) (-1487.636) [-1486.761] (-1486.630) -- 0:01:43
352000 -- [-1486.136] (-1486.954) (-1485.590) (-1490.989) * (-1491.440) (-1485.033) [-1483.056] (-1492.148) -- 0:01:43
352500 -- (-1486.591) (-1488.694) [-1489.603] (-1491.995) * (-1489.161) (-1489.112) (-1491.844) [-1484.871] -- 0:01:44
353000 -- (-1482.663) [-1486.847] (-1488.058) (-1485.902) * (-1484.712) (-1488.942) (-1492.595) [-1486.352] -- 0:01:44
353500 -- (-1490.194) (-1489.574) (-1484.655) [-1490.295] * (-1483.738) [-1491.572] (-1488.793) (-1496.317) -- 0:01:44
354000 -- (-1493.555) [-1488.882] (-1487.947) (-1492.359) * [-1489.286] (-1482.748) (-1492.244) (-1493.401) -- 0:01:44
354500 -- (-1489.707) [-1487.597] (-1484.073) (-1492.321) * (-1500.819) [-1483.615] (-1495.758) (-1485.028) -- 0:01:43
355000 -- [-1491.231] (-1488.973) (-1485.804) (-1494.772) * (-1489.387) [-1488.131] (-1491.588) (-1488.107) -- 0:01:43
Average standard deviation of split frequencies: 0.000000
355500 -- [-1491.106] (-1496.239) (-1487.271) (-1491.057) * (-1493.144) [-1487.940] (-1487.858) (-1489.086) -- 0:01:43
356000 -- [-1487.341] (-1493.298) (-1486.925) (-1490.852) * (-1489.403) (-1485.868) (-1492.590) [-1490.662] -- 0:01:43
356500 -- (-1486.983) (-1486.101) [-1486.764] (-1489.085) * (-1491.904) (-1487.619) [-1483.622] (-1491.001) -- 0:01:42
357000 -- (-1490.307) [-1487.341] (-1487.885) (-1489.762) * (-1486.104) [-1489.060] (-1488.967) (-1484.462) -- 0:01:42
357500 -- (-1485.273) (-1486.708) [-1487.744] (-1489.905) * (-1487.282) (-1482.400) (-1493.804) [-1483.165] -- 0:01:42
358000 -- (-1483.223) [-1487.731] (-1494.092) (-1490.046) * (-1487.613) [-1485.666] (-1487.320) (-1494.482) -- 0:01:42
358500 -- (-1483.632) [-1486.377] (-1493.768) (-1487.015) * (-1484.674) (-1485.806) (-1493.352) [-1487.936] -- 0:01:43
359000 -- [-1489.007] (-1487.598) (-1488.043) (-1492.177) * (-1490.282) [-1487.734] (-1489.471) (-1484.567) -- 0:01:43
359500 -- (-1484.902) (-1484.093) (-1482.385) [-1490.706] * [-1487.826] (-1490.570) (-1488.724) (-1486.656) -- 0:01:43
360000 -- (-1488.215) (-1488.998) [-1484.986] (-1493.255) * (-1493.528) [-1491.509] (-1488.030) (-1489.803) -- 0:01:43
Average standard deviation of split frequencies: 0.000000
360500 -- [-1489.222] (-1491.160) (-1486.728) (-1491.220) * (-1493.035) (-1488.042) (-1491.778) [-1486.671] -- 0:01:42
361000 -- [-1489.845] (-1489.895) (-1495.387) (-1489.046) * (-1488.466) [-1491.657] (-1490.306) (-1492.097) -- 0:01:42
361500 -- (-1497.291) (-1486.692) (-1484.661) [-1488.618] * [-1492.078] (-1496.681) (-1490.300) (-1483.717) -- 0:01:42
362000 -- (-1488.941) (-1486.486) [-1485.646] (-1497.143) * [-1487.776] (-1497.249) (-1489.056) (-1488.494) -- 0:01:42
362500 -- (-1485.865) [-1486.788] (-1494.951) (-1502.066) * [-1488.579] (-1489.927) (-1488.689) (-1495.280) -- 0:01:42
363000 -- [-1483.252] (-1489.172) (-1494.090) (-1487.530) * [-1490.458] (-1492.492) (-1489.374) (-1484.461) -- 0:01:41
363500 -- (-1491.219) [-1487.806] (-1488.430) (-1488.184) * (-1485.295) (-1490.496) [-1482.350] (-1485.280) -- 0:01:41
364000 -- (-1487.478) (-1487.369) (-1485.312) [-1488.484] * (-1483.759) (-1487.470) [-1485.163] (-1485.957) -- 0:01:41
364500 -- (-1482.949) (-1487.421) (-1490.523) [-1483.249] * (-1489.291) (-1493.145) [-1487.846] (-1482.868) -- 0:01:42
365000 -- [-1488.185] (-1485.442) (-1491.952) (-1488.646) * [-1486.511] (-1495.523) (-1488.476) (-1487.463) -- 0:01:42
Average standard deviation of split frequencies: 0.000000
365500 -- (-1498.694) (-1488.307) [-1489.465] (-1496.040) * (-1488.106) (-1493.993) (-1485.094) [-1490.070] -- 0:01:42
366000 -- (-1492.604) [-1494.824] (-1494.580) (-1489.460) * (-1490.271) (-1488.958) (-1492.808) [-1488.036] -- 0:01:42
366500 -- (-1487.394) (-1490.203) (-1488.073) [-1489.701] * (-1501.297) [-1487.162] (-1487.128) (-1484.108) -- 0:01:41
367000 -- [-1489.449] (-1494.129) (-1498.663) (-1490.264) * [-1486.350] (-1481.209) (-1486.596) (-1488.087) -- 0:01:41
367500 -- (-1489.574) (-1486.904) (-1486.162) [-1484.729] * (-1493.322) [-1486.466] (-1490.393) (-1484.189) -- 0:01:41
368000 -- (-1491.727) [-1486.146] (-1490.420) (-1485.314) * [-1493.954] (-1491.541) (-1490.214) (-1489.409) -- 0:01:41
368500 -- (-1485.778) [-1486.222] (-1489.963) (-1491.361) * [-1488.591] (-1487.907) (-1488.425) (-1491.760) -- 0:01:41
369000 -- (-1487.420) [-1485.452] (-1487.018) (-1485.339) * (-1494.462) (-1486.414) (-1487.163) [-1490.952] -- 0:01:40
369500 -- (-1491.431) (-1487.905) (-1487.921) [-1484.321] * (-1491.471) [-1490.617] (-1485.652) (-1497.541) -- 0:01:40
370000 -- (-1488.410) (-1486.695) (-1484.554) [-1490.132] * (-1486.563) (-1490.284) [-1486.312] (-1490.082) -- 0:01:40
Average standard deviation of split frequencies: 0.000000
370500 -- (-1494.359) (-1485.520) (-1488.681) [-1488.150] * (-1484.359) (-1494.577) [-1491.878] (-1487.516) -- 0:01:40
371000 -- (-1499.355) (-1484.478) (-1484.362) [-1484.809] * (-1485.762) (-1493.339) [-1486.773] (-1489.468) -- 0:01:41
371500 -- (-1488.274) (-1490.482) [-1481.677] (-1491.715) * (-1486.520) (-1490.799) (-1486.684) [-1491.678] -- 0:01:41
372000 -- (-1487.643) (-1489.755) (-1484.587) [-1486.220] * (-1486.445) (-1493.508) (-1483.967) [-1484.436] -- 0:01:41
372500 -- (-1492.115) (-1484.970) [-1489.406] (-1489.805) * (-1490.169) [-1485.552] (-1491.985) (-1483.785) -- 0:01:41
373000 -- [-1486.482] (-1484.514) (-1488.714) (-1495.081) * (-1489.939) (-1487.169) [-1487.204] (-1491.350) -- 0:01:40
373500 -- (-1489.593) [-1481.976] (-1488.847) (-1487.007) * (-1489.415) (-1496.837) [-1483.764] (-1490.851) -- 0:01:40
374000 -- (-1489.124) [-1485.609] (-1486.673) (-1496.172) * (-1492.236) [-1488.774] (-1486.052) (-1488.839) -- 0:01:40
374500 -- (-1497.369) (-1486.961) [-1487.204] (-1494.514) * (-1490.450) (-1491.085) (-1490.327) [-1493.514] -- 0:01:40
375000 -- (-1503.449) (-1488.193) [-1485.978] (-1489.294) * (-1496.112) (-1491.682) (-1493.028) [-1485.781] -- 0:01:40
Average standard deviation of split frequencies: 0.000000
375500 -- (-1501.260) (-1487.402) [-1484.743] (-1483.671) * (-1487.037) (-1483.097) (-1492.722) [-1488.057] -- 0:01:39
376000 -- (-1490.085) (-1485.923) (-1486.936) [-1485.355] * (-1489.521) (-1483.856) (-1491.617) [-1485.471] -- 0:01:39
376500 -- (-1493.785) (-1489.934) (-1491.396) [-1485.599] * (-1492.785) [-1482.051] (-1487.868) (-1489.355) -- 0:01:39
377000 -- (-1490.417) (-1487.134) [-1493.412] (-1486.441) * (-1494.279) (-1486.852) [-1496.349] (-1487.486) -- 0:01:40
377500 -- (-1490.448) (-1483.588) (-1494.153) [-1485.080] * (-1494.463) [-1484.584] (-1488.550) (-1488.524) -- 0:01:40
378000 -- (-1489.275) [-1490.139] (-1491.858) (-1483.814) * (-1490.632) (-1487.858) (-1489.504) [-1486.773] -- 0:01:40
378500 -- (-1488.175) (-1487.504) [-1491.570] (-1496.739) * [-1495.920] (-1489.676) (-1488.061) (-1492.852) -- 0:01:40
379000 -- (-1483.197) (-1487.258) (-1488.523) [-1495.927] * (-1487.054) [-1486.611] (-1491.308) (-1493.081) -- 0:01:39
379500 -- [-1485.417] (-1489.660) (-1486.263) (-1494.010) * [-1490.349] (-1487.992) (-1493.003) (-1485.097) -- 0:01:39
380000 -- (-1490.990) [-1486.764] (-1482.986) (-1488.841) * (-1493.190) [-1486.989] (-1490.906) (-1487.192) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
380500 -- (-1485.786) (-1487.911) [-1486.998] (-1494.678) * (-1489.864) (-1485.946) [-1491.213] (-1489.792) -- 0:01:39
381000 -- [-1488.631] (-1490.967) (-1486.555) (-1495.123) * (-1497.169) (-1496.290) [-1485.096] (-1491.186) -- 0:01:39
381500 -- [-1484.317] (-1489.938) (-1494.038) (-1488.344) * (-1491.756) (-1492.284) [-1492.563] (-1489.655) -- 0:01:38
382000 -- [-1499.618] (-1484.470) (-1488.573) (-1485.445) * (-1492.287) (-1488.742) (-1489.040) [-1486.471] -- 0:01:38
382500 -- (-1488.055) (-1486.644) (-1499.541) [-1488.993] * (-1492.647) [-1488.194] (-1485.508) (-1488.166) -- 0:01:38
383000 -- [-1486.322] (-1487.874) (-1489.990) (-1486.904) * (-1485.542) (-1486.844) (-1488.547) [-1487.356] -- 0:01:38
383500 -- [-1490.970] (-1488.750) (-1487.576) (-1489.431) * (-1488.836) (-1484.362) [-1487.469] (-1488.935) -- 0:01:39
384000 -- (-1493.460) (-1491.561) (-1487.201) [-1488.873] * (-1490.451) [-1484.536] (-1485.606) (-1490.542) -- 0:01:39
384500 -- (-1490.423) (-1489.078) (-1485.822) [-1494.727] * (-1496.756) (-1486.315) [-1483.579] (-1488.709) -- 0:01:39
385000 -- (-1485.380) [-1485.021] (-1493.324) (-1491.017) * (-1484.835) (-1486.900) [-1485.239] (-1484.349) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
385500 -- [-1484.731] (-1492.265) (-1492.814) (-1491.999) * (-1486.106) (-1498.336) [-1487.583] (-1488.923) -- 0:01:38
386000 -- [-1490.275] (-1483.353) (-1487.586) (-1497.743) * [-1491.395] (-1488.238) (-1492.645) (-1490.928) -- 0:01:38
386500 -- [-1484.226] (-1487.349) (-1491.582) (-1487.879) * (-1490.507) (-1486.728) [-1491.616] (-1485.891) -- 0:01:38
387000 -- (-1498.539) (-1485.650) (-1483.336) [-1489.464] * [-1484.491] (-1489.755) (-1485.888) (-1489.735) -- 0:01:38
387500 -- (-1492.323) (-1490.326) (-1484.797) [-1486.361] * (-1489.005) (-1492.947) (-1483.426) [-1491.715] -- 0:01:38
388000 -- [-1489.905] (-1484.475) (-1493.507) (-1492.893) * (-1493.390) (-1491.684) [-1490.505] (-1491.604) -- 0:01:37
388500 -- (-1489.381) [-1485.570] (-1492.653) (-1484.705) * (-1489.920) (-1483.688) (-1501.418) [-1484.893] -- 0:01:37
389000 -- (-1488.265) [-1489.035] (-1489.099) (-1489.125) * [-1490.185] (-1491.293) (-1486.734) (-1485.957) -- 0:01:37
389500 -- (-1487.984) (-1488.375) [-1489.799] (-1487.202) * [-1486.966] (-1487.416) (-1486.998) (-1487.354) -- 0:01:38
390000 -- (-1493.733) (-1491.563) (-1488.014) [-1487.198] * [-1488.968] (-1487.306) (-1489.136) (-1486.302) -- 0:01:38
Average standard deviation of split frequencies: 0.000000
390500 -- (-1491.106) [-1494.686] (-1495.322) (-1489.995) * (-1490.010) [-1486.990] (-1491.592) (-1493.951) -- 0:01:38
391000 -- (-1485.400) (-1488.404) [-1492.109] (-1488.934) * (-1487.001) [-1491.181] (-1492.222) (-1490.147) -- 0:01:38
391500 -- [-1489.025] (-1485.629) (-1484.522) (-1498.207) * (-1489.635) (-1493.166) (-1488.767) [-1489.318] -- 0:01:37
392000 -- (-1492.561) [-1488.967] (-1489.476) (-1502.011) * (-1487.200) (-1497.981) [-1490.895] (-1488.428) -- 0:01:37
392500 -- (-1500.482) [-1485.843] (-1486.869) (-1495.247) * [-1484.248] (-1486.326) (-1488.606) (-1490.080) -- 0:01:37
393000 -- (-1486.628) [-1482.259] (-1488.294) (-1488.444) * (-1485.548) [-1482.662] (-1492.592) (-1496.028) -- 0:01:37
393500 -- (-1487.097) (-1484.348) [-1485.041] (-1489.207) * [-1492.109] (-1486.821) (-1493.277) (-1487.423) -- 0:01:37
394000 -- (-1485.506) (-1484.594) [-1487.658] (-1489.806) * (-1492.242) [-1483.306] (-1495.741) (-1492.177) -- 0:01:36
394500 -- [-1482.125] (-1487.107) (-1488.112) (-1492.331) * (-1486.516) (-1484.835) (-1490.964) [-1487.018] -- 0:01:36
395000 -- [-1485.615] (-1491.192) (-1488.811) (-1494.088) * (-1486.506) (-1485.530) (-1489.886) [-1487.280] -- 0:01:36
Average standard deviation of split frequencies: 0.000000
395500 -- [-1487.167] (-1489.458) (-1488.938) (-1487.111) * [-1488.593] (-1487.885) (-1489.949) (-1488.231) -- 0:01:36
396000 -- (-1490.205) [-1486.714] (-1485.310) (-1490.248) * [-1487.067] (-1492.741) (-1490.421) (-1490.456) -- 0:01:37
396500 -- (-1487.843) [-1487.108] (-1486.442) (-1486.987) * (-1488.771) (-1493.484) (-1488.590) [-1489.267] -- 0:01:37
397000 -- (-1493.312) (-1490.862) [-1484.251] (-1488.343) * [-1494.730] (-1497.080) (-1487.322) (-1489.706) -- 0:01:37
397500 -- (-1497.511) [-1484.440] (-1483.324) (-1484.998) * (-1488.858) (-1494.147) (-1487.058) [-1485.538] -- 0:01:37
398000 -- (-1491.233) [-1486.839] (-1486.593) (-1486.341) * [-1492.964] (-1492.961) (-1487.627) (-1493.362) -- 0:01:36
398500 -- (-1489.725) [-1489.677] (-1487.823) (-1484.281) * (-1493.842) [-1483.636] (-1489.940) (-1485.474) -- 0:01:36
399000 -- (-1491.945) (-1484.724) [-1484.017] (-1486.434) * (-1490.787) [-1486.773] (-1492.812) (-1486.346) -- 0:01:36
399500 -- (-1491.315) (-1488.978) [-1488.690] (-1488.981) * (-1493.129) [-1484.246] (-1494.185) (-1488.620) -- 0:01:36
400000 -- (-1484.143) [-1486.038] (-1489.069) (-1484.302) * (-1492.372) [-1480.961] (-1491.431) (-1484.761) -- 0:01:36
Average standard deviation of split frequencies: 0.000000
400500 -- (-1484.244) (-1483.107) [-1489.212] (-1486.831) * [-1494.580] (-1484.784) (-1490.122) (-1485.910) -- 0:01:35
401000 -- (-1488.490) (-1490.402) (-1488.401) [-1486.398] * (-1494.160) [-1483.527] (-1492.863) (-1491.281) -- 0:01:35
401500 -- (-1491.168) (-1489.368) [-1485.259] (-1487.129) * (-1492.230) [-1487.599] (-1489.592) (-1490.691) -- 0:01:35
402000 -- (-1487.088) (-1495.587) (-1485.903) [-1489.517] * (-1485.670) (-1484.106) (-1494.137) [-1485.004] -- 0:01:35
402500 -- (-1490.031) (-1486.068) (-1484.645) [-1488.256] * (-1484.428) (-1491.174) (-1488.141) [-1484.893] -- 0:01:36
403000 -- (-1488.595) [-1484.417] (-1484.241) (-1488.992) * (-1487.620) (-1487.028) (-1485.004) [-1485.785] -- 0:01:36
403500 -- (-1493.418) (-1488.701) (-1487.812) [-1486.976] * (-1491.097) (-1488.315) (-1490.710) [-1485.645] -- 0:01:36
404000 -- (-1493.632) [-1484.720] (-1486.387) (-1493.819) * (-1492.942) (-1491.355) [-1490.598] (-1487.830) -- 0:01:35
404500 -- (-1487.508) (-1486.969) [-1489.881] (-1488.963) * (-1489.304) (-1489.665) (-1487.714) [-1490.015] -- 0:01:35
405000 -- (-1488.304) [-1486.713] (-1485.951) (-1489.013) * (-1496.987) (-1482.984) [-1489.308] (-1486.743) -- 0:01:35
Average standard deviation of split frequencies: 0.000000
405500 -- (-1487.986) [-1487.008] (-1487.941) (-1486.436) * (-1486.958) [-1483.990] (-1492.098) (-1485.881) -- 0:01:35
406000 -- [-1484.343] (-1488.356) (-1484.200) (-1485.414) * (-1489.642) [-1486.911] (-1486.533) (-1488.469) -- 0:01:35
406500 -- (-1487.095) (-1489.980) [-1485.134] (-1497.828) * (-1489.614) [-1485.902] (-1490.306) (-1489.678) -- 0:01:34
407000 -- (-1487.074) (-1491.339) [-1487.468] (-1487.629) * (-1484.280) (-1484.955) (-1487.364) [-1485.842] -- 0:01:34
407500 -- (-1486.046) (-1488.027) [-1487.600] (-1490.077) * [-1488.564] (-1485.909) (-1490.704) (-1491.863) -- 0:01:34
408000 -- (-1486.440) [-1484.882] (-1485.765) (-1490.169) * (-1495.558) (-1486.051) [-1484.797] (-1488.799) -- 0:01:34
408500 -- (-1488.352) (-1485.309) [-1490.654] (-1489.459) * (-1487.146) (-1486.078) [-1485.001] (-1486.723) -- 0:01:35
409000 -- (-1494.023) [-1487.805] (-1488.780) (-1490.774) * [-1486.498] (-1488.667) (-1490.129) (-1489.320) -- 0:01:35
409500 -- (-1490.896) (-1486.708) [-1492.591] (-1487.782) * (-1492.548) (-1489.939) [-1488.465] (-1493.975) -- 0:01:35
410000 -- (-1488.008) (-1493.037) (-1494.286) [-1488.864] * (-1491.525) (-1488.052) (-1489.143) [-1489.341] -- 0:01:34
Average standard deviation of split frequencies: 0.000000
410500 -- (-1485.894) (-1492.530) [-1488.390] (-1491.424) * (-1497.442) [-1496.369] (-1486.632) (-1491.400) -- 0:01:34
411000 -- [-1484.080] (-1490.467) (-1491.648) (-1488.288) * [-1491.237] (-1495.213) (-1489.379) (-1487.393) -- 0:01:34
411500 -- (-1491.055) [-1488.585] (-1486.713) (-1484.872) * (-1495.610) (-1488.999) [-1491.476] (-1488.933) -- 0:01:34
412000 -- (-1484.666) (-1487.724) [-1487.517] (-1486.936) * (-1499.908) (-1497.074) [-1491.275] (-1490.068) -- 0:01:34
412500 -- (-1490.276) (-1492.016) (-1484.949) [-1489.085] * (-1497.783) (-1487.984) (-1488.875) [-1490.958] -- 0:01:34
413000 -- (-1489.517) (-1496.837) [-1485.276] (-1487.494) * (-1496.362) (-1497.636) (-1484.057) [-1490.566] -- 0:01:33
413500 -- (-1494.256) (-1488.734) [-1486.350] (-1486.895) * (-1501.134) (-1489.276) (-1486.361) [-1485.049] -- 0:01:33
414000 -- (-1490.847) [-1485.173] (-1488.707) (-1485.585) * [-1493.398] (-1487.297) (-1488.753) (-1495.447) -- 0:01:33
414500 -- (-1488.600) (-1486.918) [-1486.437] (-1485.144) * (-1494.518) (-1489.756) [-1484.708] (-1491.101) -- 0:01:33
415000 -- (-1491.302) (-1487.141) (-1488.434) [-1490.187] * (-1492.814) (-1486.348) (-1489.871) [-1483.059] -- 0:01:34
Average standard deviation of split frequencies: 0.000000
415500 -- (-1491.620) (-1489.677) (-1487.997) [-1483.892] * (-1490.107) (-1487.604) [-1492.102] (-1490.107) -- 0:01:34
416000 -- (-1497.738) [-1482.646] (-1488.664) (-1482.401) * (-1494.032) [-1489.200] (-1488.817) (-1484.857) -- 0:01:34
416500 -- (-1493.331) [-1482.615] (-1490.298) (-1486.511) * [-1493.778] (-1485.676) (-1487.588) (-1484.200) -- 0:01:33
417000 -- (-1495.897) (-1487.605) [-1490.614] (-1491.139) * [-1486.819] (-1486.629) (-1486.045) (-1483.740) -- 0:01:33
417500 -- (-1492.671) (-1487.454) (-1488.860) [-1487.427] * (-1487.551) (-1487.166) (-1488.892) [-1491.496] -- 0:01:33
418000 -- (-1491.444) (-1485.077) [-1485.542] (-1487.736) * (-1487.975) [-1481.791] (-1487.132) (-1488.782) -- 0:01:33
418500 -- (-1503.442) (-1487.079) [-1486.729] (-1485.224) * (-1485.403) (-1491.216) [-1487.949] (-1492.352) -- 0:01:33
419000 -- (-1491.559) (-1490.836) [-1486.207] (-1485.768) * (-1488.811) (-1486.998) [-1487.464] (-1488.697) -- 0:01:32
419500 -- (-1486.964) [-1488.596] (-1485.521) (-1497.898) * [-1487.237] (-1489.039) (-1490.829) (-1490.430) -- 0:01:32
420000 -- (-1486.697) [-1489.511] (-1485.340) (-1498.896) * (-1491.467) [-1495.657] (-1493.109) (-1486.418) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
420500 -- (-1487.569) (-1486.547) (-1489.637) [-1490.492] * (-1491.079) (-1489.883) (-1488.777) [-1488.301] -- 0:01:32
421000 -- [-1488.246] (-1488.865) (-1487.647) (-1486.290) * (-1499.285) (-1486.984) (-1484.302) [-1484.888] -- 0:01:33
421500 -- [-1489.588] (-1490.046) (-1493.557) (-1494.440) * (-1488.414) [-1485.132] (-1490.888) (-1489.487) -- 0:01:33
422000 -- [-1490.681] (-1484.948) (-1493.668) (-1492.478) * (-1495.524) [-1485.405] (-1486.545) (-1487.451) -- 0:01:33
422500 -- (-1486.897) [-1493.162] (-1488.244) (-1487.264) * (-1485.636) (-1488.513) [-1486.879] (-1495.389) -- 0:01:32
423000 -- [-1484.949] (-1493.579) (-1486.144) (-1489.341) * (-1493.484) (-1486.794) [-1487.130] (-1490.617) -- 0:01:32
423500 -- [-1486.623] (-1485.865) (-1488.926) (-1486.870) * (-1484.252) [-1487.189] (-1490.228) (-1495.291) -- 0:01:32
424000 -- (-1485.374) [-1487.159] (-1488.749) (-1487.096) * (-1485.921) (-1494.365) (-1492.478) [-1487.228] -- 0:01:32
424500 -- [-1487.807] (-1490.982) (-1491.080) (-1490.318) * (-1486.720) [-1488.457] (-1489.576) (-1485.508) -- 0:01:32
425000 -- (-1483.657) (-1485.273) (-1492.740) [-1487.279] * (-1486.720) [-1490.364] (-1489.070) (-1483.060) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
425500 -- [-1486.899] (-1489.230) (-1494.936) (-1483.631) * [-1482.863] (-1495.223) (-1487.678) (-1484.995) -- 0:01:31
426000 -- [-1492.670] (-1489.273) (-1498.657) (-1488.361) * (-1484.491) (-1495.476) [-1487.607] (-1483.991) -- 0:01:31
426500 -- [-1488.131] (-1490.258) (-1492.315) (-1492.785) * [-1488.609] (-1495.625) (-1493.636) (-1491.403) -- 0:01:31
427000 -- (-1492.494) [-1484.204] (-1485.439) (-1485.753) * (-1488.163) [-1489.449] (-1487.252) (-1484.356) -- 0:01:31
427500 -- [-1485.870] (-1491.646) (-1492.133) (-1491.208) * (-1487.170) [-1491.141] (-1489.864) (-1491.068) -- 0:01:32
428000 -- (-1495.239) [-1486.642] (-1490.768) (-1488.192) * (-1485.770) [-1495.688] (-1487.870) (-1485.221) -- 0:01:32
428500 -- (-1489.192) [-1484.690] (-1487.481) (-1491.054) * (-1486.711) [-1488.048] (-1489.154) (-1495.174) -- 0:01:32
429000 -- (-1497.886) (-1486.979) [-1486.986] (-1487.019) * (-1488.475) (-1491.332) (-1487.938) [-1489.333] -- 0:01:31
429500 -- (-1486.629) [-1485.688] (-1484.612) (-1492.304) * (-1487.926) [-1484.245] (-1495.307) (-1490.302) -- 0:01:31
430000 -- (-1486.266) (-1492.138) (-1490.186) [-1488.864] * [-1493.814] (-1482.629) (-1493.270) (-1482.560) -- 0:01:31
Average standard deviation of split frequencies: 0.000000
430500 -- (-1494.920) (-1489.159) [-1488.386] (-1486.212) * [-1487.643] (-1488.252) (-1490.966) (-1487.784) -- 0:01:31
431000 -- (-1488.856) (-1490.577) [-1484.043] (-1495.097) * [-1486.019] (-1491.146) (-1489.231) (-1486.113) -- 0:01:31
431500 -- (-1488.790) (-1487.864) [-1488.711] (-1490.951) * (-1487.784) (-1487.062) [-1489.366] (-1489.924) -- 0:01:30
432000 -- [-1489.346] (-1486.146) (-1492.116) (-1491.923) * (-1492.679) (-1489.203) (-1488.096) [-1486.796] -- 0:01:30
432500 -- (-1484.893) [-1484.780] (-1493.664) (-1492.466) * (-1490.957) (-1487.914) [-1488.013] (-1496.183) -- 0:01:30
433000 -- (-1489.331) (-1487.578) (-1487.247) [-1488.987] * [-1492.495] (-1492.632) (-1489.642) (-1489.263) -- 0:01:30
433500 -- (-1489.189) (-1487.657) [-1489.766] (-1486.415) * (-1484.983) (-1491.864) [-1485.805] (-1489.051) -- 0:01:31
434000 -- (-1493.026) [-1490.811] (-1484.114) (-1484.838) * [-1485.031] (-1486.987) (-1488.366) (-1487.217) -- 0:01:31
434500 -- (-1495.683) [-1487.056] (-1489.256) (-1486.291) * (-1482.816) (-1484.462) (-1491.221) [-1484.574] -- 0:01:31
435000 -- [-1489.208] (-1491.090) (-1489.544) (-1486.654) * (-1488.599) (-1489.159) [-1487.675] (-1489.706) -- 0:01:30
Average standard deviation of split frequencies: 0.000000
435500 -- (-1487.838) (-1488.295) (-1485.267) [-1486.334] * (-1493.270) (-1491.671) [-1490.887] (-1486.784) -- 0:01:30
436000 -- (-1492.233) (-1486.825) (-1487.200) [-1488.424] * (-1487.905) (-1490.958) (-1489.971) [-1486.654] -- 0:01:30
436500 -- (-1486.393) (-1491.889) (-1489.641) [-1484.137] * (-1492.249) [-1484.644] (-1497.822) (-1486.698) -- 0:01:30
437000 -- [-1487.555] (-1487.677) (-1496.800) (-1493.019) * (-1494.747) (-1487.772) [-1492.575] (-1486.786) -- 0:01:30
437500 -- (-1490.826) (-1488.680) (-1487.862) [-1487.732] * (-1500.039) (-1492.925) (-1490.818) [-1485.250] -- 0:01:30
438000 -- (-1488.752) (-1486.074) [-1484.928] (-1487.638) * (-1489.542) [-1492.978] (-1502.089) (-1486.497) -- 0:01:29
438500 -- (-1486.791) (-1491.941) (-1491.758) [-1485.617] * [-1489.891] (-1489.656) (-1494.799) (-1490.296) -- 0:01:29
439000 -- (-1486.686) (-1493.824) (-1489.049) [-1486.824] * (-1493.182) [-1489.924] (-1490.558) (-1491.982) -- 0:01:29
439500 -- (-1493.724) (-1487.064) (-1492.084) [-1488.838] * (-1501.285) (-1488.273) [-1484.865] (-1491.186) -- 0:01:29
440000 -- (-1489.197) (-1485.488) (-1492.819) [-1485.200] * (-1496.510) (-1498.131) [-1491.026] (-1490.170) -- 0:01:30
Average standard deviation of split frequencies: 0.000000
440500 -- (-1485.861) (-1490.991) (-1494.272) [-1487.243] * (-1491.385) (-1492.249) [-1497.209] (-1493.037) -- 0:01:30
441000 -- (-1487.459) (-1488.833) (-1489.855) [-1495.066] * (-1484.877) (-1489.546) (-1490.838) [-1482.686] -- 0:01:29
441500 -- (-1484.386) (-1487.699) [-1485.978] (-1487.877) * [-1485.980] (-1485.873) (-1492.525) (-1482.523) -- 0:01:29
442000 -- [-1485.657] (-1491.262) (-1492.685) (-1486.528) * [-1482.628] (-1496.740) (-1486.649) (-1490.960) -- 0:01:29
442500 -- [-1489.561] (-1483.907) (-1487.478) (-1487.987) * (-1486.999) (-1488.081) (-1488.442) [-1482.047] -- 0:01:29
443000 -- (-1490.265) [-1483.996] (-1498.676) (-1488.358) * (-1491.156) (-1487.146) [-1489.027] (-1494.188) -- 0:01:29
443500 -- (-1490.005) (-1485.371) (-1488.259) [-1488.206] * [-1492.480] (-1486.143) (-1485.586) (-1492.157) -- 0:01:29
444000 -- [-1487.329] (-1494.795) (-1487.599) (-1493.401) * (-1489.629) [-1483.620] (-1485.676) (-1488.088) -- 0:01:28
444500 -- (-1485.544) [-1484.549] (-1490.003) (-1491.271) * (-1494.306) (-1489.429) (-1492.617) [-1489.065] -- 0:01:28
445000 -- (-1486.090) (-1487.417) [-1487.153] (-1492.446) * [-1488.326] (-1486.681) (-1485.700) (-1491.566) -- 0:01:28
Average standard deviation of split frequencies: 0.000000
445500 -- (-1494.235) [-1487.091] (-1493.787) (-1501.549) * (-1494.121) (-1489.526) [-1489.287] (-1485.759) -- 0:01:28
446000 -- (-1488.378) (-1485.471) (-1494.336) [-1496.223] * (-1487.827) [-1487.103] (-1486.095) (-1491.701) -- 0:01:29
446500 -- (-1491.098) [-1487.104] (-1496.305) (-1490.150) * (-1485.284) (-1489.759) [-1486.597] (-1497.507) -- 0:01:29
447000 -- (-1482.273) [-1489.434] (-1493.643) (-1483.368) * (-1488.954) [-1487.668] (-1487.274) (-1489.964) -- 0:01:29
447500 -- (-1484.784) (-1486.667) (-1493.051) [-1486.507] * [-1487.364] (-1491.178) (-1485.842) (-1494.109) -- 0:01:28
448000 -- (-1486.240) (-1487.227) (-1488.821) [-1489.931] * (-1490.133) (-1490.700) [-1485.837] (-1486.122) -- 0:01:28
448500 -- (-1491.006) (-1487.787) (-1485.506) [-1489.708] * (-1499.265) (-1486.721) [-1486.447] (-1489.431) -- 0:01:28
449000 -- [-1490.854] (-1488.779) (-1489.206) (-1485.153) * (-1492.590) [-1490.445] (-1494.335) (-1490.410) -- 0:01:28
449500 -- (-1503.447) [-1482.527] (-1490.506) (-1488.137) * (-1488.365) (-1488.743) (-1489.062) [-1485.741] -- 0:01:28
450000 -- (-1492.343) (-1482.861) [-1483.289] (-1489.012) * [-1486.519] (-1490.287) (-1492.561) (-1490.527) -- 0:01:28
Average standard deviation of split frequencies: 0.000000
450500 -- (-1487.956) (-1492.249) [-1484.855] (-1491.829) * (-1486.767) (-1489.172) (-1489.151) [-1486.410] -- 0:01:27
451000 -- (-1491.701) (-1491.333) (-1488.684) [-1482.105] * (-1490.272) [-1491.210] (-1488.523) (-1483.064) -- 0:01:27
451500 -- (-1503.808) [-1487.007] (-1491.977) (-1490.707) * (-1491.286) (-1485.486) (-1495.025) [-1486.077] -- 0:01:27
452000 -- (-1496.800) (-1498.439) [-1486.720] (-1483.600) * (-1489.461) [-1497.413] (-1494.241) (-1492.477) -- 0:01:28
452500 -- (-1484.962) (-1486.327) [-1487.684] (-1494.724) * (-1495.628) [-1490.235] (-1497.525) (-1487.335) -- 0:01:28
453000 -- (-1491.838) [-1487.851] (-1487.692) (-1500.614) * (-1488.396) (-1493.507) (-1485.560) [-1487.645] -- 0:01:28
453500 -- [-1483.862] (-1491.718) (-1488.074) (-1494.663) * [-1486.764] (-1490.672) (-1487.770) (-1490.530) -- 0:01:27
454000 -- [-1485.726] (-1490.675) (-1489.952) (-1486.444) * (-1490.374) [-1487.546] (-1491.918) (-1486.548) -- 0:01:27
454500 -- [-1487.176] (-1488.938) (-1495.570) (-1487.057) * (-1485.649) (-1497.800) [-1483.480] (-1489.802) -- 0:01:27
455000 -- (-1493.042) (-1486.671) (-1489.536) [-1484.805] * (-1484.983) [-1485.300] (-1485.002) (-1489.178) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
455500 -- (-1491.321) (-1485.819) (-1493.325) [-1488.968] * (-1493.112) (-1489.726) [-1488.279] (-1487.273) -- 0:01:27
456000 -- (-1485.386) (-1486.522) [-1495.159] (-1489.595) * (-1495.196) (-1491.775) (-1490.923) [-1491.310] -- 0:01:27
456500 -- (-1490.164) (-1488.667) (-1494.371) [-1489.406] * [-1486.717] (-1487.677) (-1487.588) (-1486.308) -- 0:01:26
457000 -- (-1482.108) (-1487.920) [-1487.719] (-1489.961) * [-1488.617] (-1491.628) (-1488.856) (-1493.249) -- 0:01:26
457500 -- (-1483.975) [-1484.272] (-1488.676) (-1494.757) * (-1483.516) [-1485.455] (-1489.032) (-1493.529) -- 0:01:26
458000 -- (-1496.133) [-1494.063] (-1489.660) (-1492.576) * (-1487.457) [-1494.025] (-1492.136) (-1489.489) -- 0:01:27
458500 -- [-1485.246] (-1489.740) (-1490.858) (-1485.127) * (-1487.155) (-1482.936) (-1496.838) [-1483.167] -- 0:01:27
459000 -- (-1486.199) (-1485.822) (-1488.297) [-1485.340] * [-1485.264] (-1491.548) (-1491.671) (-1485.766) -- 0:01:27
459500 -- (-1492.889) [-1487.374] (-1490.003) (-1490.214) * (-1488.335) [-1488.311] (-1490.842) (-1485.424) -- 0:01:27
460000 -- [-1484.737] (-1482.018) (-1489.403) (-1489.319) * (-1493.947) [-1485.329] (-1489.749) (-1484.709) -- 0:01:26
Average standard deviation of split frequencies: 0.000000
460500 -- [-1484.937] (-1484.381) (-1487.914) (-1493.075) * (-1490.774) (-1495.497) [-1492.467] (-1484.006) -- 0:01:26
461000 -- (-1484.350) [-1490.377] (-1494.475) (-1489.662) * (-1498.991) [-1485.811] (-1489.932) (-1491.416) -- 0:01:26
461500 -- (-1489.795) (-1484.356) (-1486.999) [-1487.970] * (-1489.498) [-1488.505] (-1489.684) (-1491.714) -- 0:01:26
462000 -- (-1489.707) (-1485.180) (-1492.275) [-1488.172] * (-1483.429) (-1483.997) [-1486.057] (-1489.074) -- 0:01:26
462500 -- [-1488.412] (-1489.329) (-1489.263) (-1488.029) * (-1485.058) [-1484.613] (-1485.398) (-1488.765) -- 0:01:26
463000 -- [-1486.247] (-1482.895) (-1492.436) (-1488.178) * (-1490.688) (-1490.477) [-1492.392] (-1486.270) -- 0:01:25
463500 -- (-1483.854) (-1494.999) (-1489.186) [-1489.153] * (-1488.686) (-1488.434) (-1484.952) [-1488.188] -- 0:01:25
464000 -- [-1485.542] (-1496.373) (-1492.976) (-1494.239) * (-1488.755) [-1484.444] (-1488.806) (-1492.276) -- 0:01:25
464500 -- (-1487.673) (-1486.535) [-1482.509] (-1498.589) * (-1489.167) (-1485.329) (-1485.354) [-1487.575] -- 0:01:26
465000 -- [-1486.945] (-1488.904) (-1486.898) (-1490.015) * (-1483.358) (-1488.190) [-1493.609] (-1487.089) -- 0:01:26
Average standard deviation of split frequencies: 0.000000
465500 -- (-1487.250) (-1491.897) [-1489.526] (-1486.233) * (-1488.296) (-1486.633) (-1498.941) [-1488.758] -- 0:01:26
466000 -- (-1487.645) (-1492.685) (-1487.500) [-1486.529] * (-1496.541) (-1497.769) (-1488.093) [-1488.049] -- 0:01:25
466500 -- [-1489.052] (-1488.571) (-1493.637) (-1488.392) * (-1489.934) (-1491.317) (-1490.154) [-1494.496] -- 0:01:25
467000 -- [-1486.576] (-1492.350) (-1494.339) (-1484.346) * [-1484.794] (-1490.082) (-1485.919) (-1488.276) -- 0:01:25
467500 -- (-1487.023) (-1495.231) [-1492.076] (-1494.477) * (-1499.433) (-1488.115) (-1493.666) [-1487.166] -- 0:01:25
468000 -- (-1488.698) (-1491.927) (-1489.197) [-1486.793] * (-1488.434) (-1488.119) (-1489.116) [-1481.998] -- 0:01:25
468500 -- (-1484.716) (-1489.712) (-1490.902) [-1494.619] * (-1491.115) (-1489.630) (-1485.782) [-1486.232] -- 0:01:25
469000 -- (-1484.412) [-1487.014] (-1498.762) (-1487.855) * [-1491.868] (-1484.984) (-1485.634) (-1487.417) -- 0:01:24
469500 -- [-1484.810] (-1485.309) (-1493.239) (-1485.315) * (-1487.481) [-1486.343] (-1486.844) (-1490.096) -- 0:01:24
470000 -- [-1485.425] (-1484.777) (-1487.584) (-1486.325) * (-1495.410) [-1486.492] (-1486.512) (-1491.000) -- 0:01:24
Average standard deviation of split frequencies: 0.000000
470500 -- (-1490.264) [-1485.284] (-1492.315) (-1487.946) * [-1493.953] (-1497.243) (-1490.254) (-1491.643) -- 0:01:25
471000 -- (-1485.901) (-1488.020) [-1487.312] (-1491.367) * (-1492.103) [-1485.304] (-1483.322) (-1489.249) -- 0:01:25
471500 -- (-1485.157) [-1490.608] (-1490.445) (-1484.686) * (-1490.644) (-1494.672) (-1486.470) [-1484.532] -- 0:01:25
472000 -- [-1488.058] (-1488.634) (-1488.926) (-1495.709) * (-1487.636) (-1491.386) [-1483.748] (-1487.770) -- 0:01:25
472500 -- (-1492.249) [-1488.917] (-1490.809) (-1485.930) * (-1486.648) (-1493.524) (-1489.400) [-1486.434] -- 0:01:24
473000 -- (-1490.205) [-1489.767] (-1488.622) (-1488.955) * (-1495.987) [-1488.298] (-1497.236) (-1490.229) -- 0:01:24
473500 -- (-1491.897) (-1485.529) (-1486.528) [-1488.422] * (-1490.462) (-1487.619) [-1489.271] (-1488.039) -- 0:01:24
474000 -- (-1492.616) (-1486.884) (-1486.939) [-1487.247] * [-1486.204] (-1486.000) (-1488.054) (-1487.098) -- 0:01:24
474500 -- (-1493.319) (-1488.866) [-1491.162] (-1483.759) * (-1487.559) (-1484.969) (-1485.017) [-1486.606] -- 0:01:24
475000 -- [-1486.889] (-1495.683) (-1483.280) (-1483.452) * (-1488.352) (-1488.261) (-1489.021) [-1490.501] -- 0:01:24
Average standard deviation of split frequencies: 0.000000
475500 -- (-1491.019) [-1482.881] (-1486.748) (-1488.002) * (-1486.265) (-1494.451) (-1486.168) [-1494.197] -- 0:01:23
476000 -- (-1489.316) (-1487.500) (-1491.846) [-1487.176] * [-1486.873] (-1492.264) (-1493.759) (-1491.301) -- 0:01:23
476500 -- (-1488.648) [-1489.914] (-1493.090) (-1490.387) * [-1486.092] (-1487.501) (-1489.938) (-1487.403) -- 0:01:24
477000 -- [-1491.842] (-1485.967) (-1491.998) (-1491.667) * [-1488.428] (-1491.380) (-1485.490) (-1496.513) -- 0:01:24
477500 -- (-1484.550) [-1484.017] (-1492.918) (-1487.487) * (-1487.296) (-1488.529) [-1482.338] (-1489.875) -- 0:01:24
478000 -- (-1486.995) (-1485.630) (-1486.826) [-1487.627] * (-1485.947) (-1488.136) [-1486.734] (-1484.867) -- 0:01:24
478500 -- (-1489.428) (-1487.117) (-1487.183) [-1483.525] * (-1495.220) (-1493.432) [-1487.227] (-1489.906) -- 0:01:23
479000 -- [-1492.254] (-1493.759) (-1489.456) (-1486.813) * (-1499.553) (-1490.090) [-1492.552] (-1489.724) -- 0:01:23
479500 -- (-1487.716) (-1485.060) (-1484.345) [-1490.746] * (-1489.196) (-1487.907) [-1484.777] (-1494.938) -- 0:01:23
480000 -- (-1486.319) (-1484.942) (-1485.742) [-1483.798] * (-1491.530) [-1490.666] (-1487.563) (-1494.449) -- 0:01:23
Average standard deviation of split frequencies: 0.000000
480500 -- (-1490.183) (-1487.701) [-1490.539] (-1485.138) * (-1494.176) [-1489.965] (-1490.314) (-1496.946) -- 0:01:23
481000 -- (-1484.010) [-1484.572] (-1484.756) (-1488.365) * [-1490.332] (-1488.730) (-1485.014) (-1487.245) -- 0:01:23
481500 -- (-1491.047) [-1489.446] (-1495.475) (-1489.304) * [-1494.188] (-1495.182) (-1485.371) (-1493.111) -- 0:01:22
482000 -- (-1489.812) [-1486.311] (-1494.758) (-1486.024) * [-1488.994] (-1486.593) (-1485.363) (-1482.621) -- 0:01:22
482500 -- [-1484.847] (-1484.299) (-1487.515) (-1488.039) * (-1489.044) (-1485.693) (-1489.392) [-1486.324] -- 0:01:23
483000 -- (-1483.374) (-1489.525) [-1490.074] (-1491.194) * (-1499.278) (-1493.712) [-1491.896] (-1490.105) -- 0:01:23
483500 -- (-1487.874) (-1494.723) [-1496.000] (-1489.900) * [-1488.220] (-1490.618) (-1490.277) (-1494.954) -- 0:01:23
484000 -- (-1488.011) [-1489.164] (-1493.055) (-1488.041) * (-1487.290) (-1489.989) [-1492.336] (-1492.782) -- 0:01:23
484500 -- [-1488.798] (-1485.985) (-1489.015) (-1491.527) * (-1488.124) (-1488.556) [-1489.503] (-1486.262) -- 0:01:22
485000 -- (-1485.935) [-1482.789] (-1491.101) (-1490.559) * [-1487.205] (-1488.191) (-1484.595) (-1488.996) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
485500 -- (-1485.072) (-1492.673) [-1491.632] (-1494.960) * (-1496.858) [-1491.005] (-1489.243) (-1487.960) -- 0:01:22
486000 -- (-1487.974) [-1485.154] (-1497.759) (-1500.060) * [-1487.934] (-1484.804) (-1490.656) (-1506.328) -- 0:01:22
486500 -- (-1493.714) (-1487.458) [-1488.067] (-1489.500) * (-1492.111) [-1488.444] (-1490.637) (-1489.581) -- 0:01:22
487000 -- [-1484.621] (-1489.335) (-1489.628) (-1489.793) * (-1492.139) [-1489.619] (-1493.197) (-1486.641) -- 0:01:22
487500 -- (-1484.804) (-1487.325) (-1487.148) [-1491.648] * [-1490.415] (-1488.919) (-1494.876) (-1488.009) -- 0:01:22
488000 -- [-1489.063] (-1487.648) (-1487.017) (-1492.111) * (-1488.814) [-1488.418] (-1491.432) (-1487.371) -- 0:01:21
488500 -- (-1489.365) (-1484.660) [-1489.644] (-1487.261) * (-1497.625) (-1496.321) (-1491.436) [-1485.786] -- 0:01:22
489000 -- (-1491.791) (-1489.181) (-1487.975) [-1484.546] * (-1492.470) (-1488.355) [-1490.731] (-1496.132) -- 0:01:22
489500 -- (-1491.495) (-1494.197) (-1487.500) [-1486.747] * (-1490.346) (-1490.489) [-1487.498] (-1491.761) -- 0:01:22
490000 -- (-1486.551) (-1488.699) (-1488.931) [-1486.286] * (-1490.266) [-1489.228] (-1489.217) (-1484.094) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
490500 -- (-1484.725) [-1488.633] (-1490.271) (-1487.182) * (-1482.618) (-1490.203) (-1490.033) [-1490.611] -- 0:01:22
491000 -- (-1490.980) [-1485.232] (-1489.419) (-1488.988) * [-1491.107] (-1486.289) (-1491.162) (-1490.323) -- 0:01:21
491500 -- (-1488.985) (-1492.871) [-1488.285] (-1491.568) * (-1485.880) [-1486.565] (-1492.543) (-1493.612) -- 0:01:21
492000 -- (-1484.281) (-1489.420) [-1487.883] (-1490.304) * [-1487.828] (-1494.576) (-1493.452) (-1494.305) -- 0:01:21
492500 -- [-1484.286] (-1486.329) (-1490.128) (-1490.584) * [-1484.911] (-1499.976) (-1489.121) (-1493.583) -- 0:01:21
493000 -- (-1482.547) [-1484.693] (-1491.785) (-1488.701) * (-1487.039) (-1499.428) (-1486.402) [-1497.751] -- 0:01:21
493500 -- [-1485.547] (-1484.105) (-1492.214) (-1488.669) * (-1487.321) (-1495.416) (-1490.286) [-1487.369] -- 0:01:21
494000 -- (-1486.049) (-1489.604) [-1485.798] (-1490.742) * (-1486.268) (-1490.748) (-1487.206) [-1490.538] -- 0:01:20
494500 -- (-1492.018) (-1488.574) (-1491.096) [-1490.991] * [-1487.788] (-1484.937) (-1492.439) (-1489.080) -- 0:01:21
495000 -- (-1489.518) [-1490.032] (-1488.098) (-1490.357) * [-1491.465] (-1486.125) (-1493.561) (-1496.584) -- 0:01:21
Average standard deviation of split frequencies: 0.000000
495500 -- (-1487.089) [-1485.974] (-1490.595) (-1488.164) * (-1486.833) [-1486.724] (-1495.373) (-1488.773) -- 0:01:21
496000 -- (-1488.227) [-1488.404] (-1491.689) (-1491.840) * (-1487.709) (-1486.968) (-1488.590) [-1485.898] -- 0:01:21
496500 -- [-1489.792] (-1485.516) (-1487.813) (-1484.811) * (-1489.923) [-1490.025] (-1491.397) (-1488.538) -- 0:01:21
497000 -- (-1492.300) (-1488.148) (-1485.540) [-1485.968] * (-1487.985) (-1491.574) [-1495.279] (-1486.789) -- 0:01:20
497500 -- (-1487.112) (-1486.067) [-1489.086] (-1486.308) * (-1491.400) (-1490.613) [-1488.631] (-1483.328) -- 0:01:20
498000 -- (-1484.511) [-1493.123] (-1487.398) (-1489.359) * [-1485.646] (-1486.101) (-1491.264) (-1485.157) -- 0:01:20
498500 -- (-1488.378) (-1501.089) [-1488.581] (-1487.560) * (-1486.681) (-1489.676) [-1485.160] (-1485.646) -- 0:01:20
499000 -- (-1487.400) [-1488.672] (-1493.237) (-1483.495) * (-1489.408) (-1487.793) (-1490.023) [-1488.872] -- 0:01:20
499500 -- (-1486.172) (-1485.898) [-1486.637] (-1490.851) * (-1487.249) (-1486.119) (-1484.414) [-1488.319] -- 0:01:20
500000 -- (-1490.522) [-1487.539] (-1485.879) (-1489.842) * (-1486.865) (-1488.844) [-1488.908] (-1486.014) -- 0:01:20
Average standard deviation of split frequencies: 0.000000
500500 -- [-1487.026] (-1492.118) (-1489.530) (-1489.775) * (-1487.535) (-1485.930) [-1485.493] (-1491.287) -- 0:01:20
501000 -- [-1487.961] (-1488.368) (-1498.907) (-1494.004) * (-1489.792) (-1490.423) (-1489.813) [-1485.310] -- 0:01:20
501500 -- (-1486.675) (-1487.682) (-1489.860) [-1490.700] * [-1485.677] (-1487.646) (-1486.971) (-1487.272) -- 0:01:20
502000 -- (-1483.220) (-1489.667) (-1490.438) [-1487.274] * [-1486.790] (-1488.610) (-1483.293) (-1487.266) -- 0:01:20
502500 -- (-1487.187) (-1489.955) (-1486.330) [-1489.183] * [-1483.857] (-1495.282) (-1491.000) (-1487.239) -- 0:01:20
503000 -- (-1492.828) (-1484.137) [-1489.715] (-1485.162) * (-1492.809) [-1486.709] (-1488.191) (-1496.796) -- 0:01:20
503500 -- (-1487.287) (-1490.612) (-1488.402) [-1487.763] * (-1485.924) (-1491.629) [-1491.186] (-1492.619) -- 0:01:19
504000 -- (-1495.007) (-1486.908) (-1488.698) [-1484.474] * (-1487.326) (-1489.833) [-1486.800] (-1493.277) -- 0:01:19
504500 -- (-1485.997) (-1486.699) [-1486.711] (-1492.185) * (-1491.000) [-1484.719] (-1490.853) (-1484.804) -- 0:01:19
505000 -- (-1493.005) (-1485.113) [-1487.333] (-1488.384) * (-1483.467) (-1483.684) (-1488.184) [-1491.329] -- 0:01:19
Average standard deviation of split frequencies: 0.000000
505500 -- (-1489.222) (-1488.420) [-1484.737] (-1490.197) * (-1485.447) [-1489.267] (-1485.910) (-1487.431) -- 0:01:19
506000 -- (-1491.655) (-1490.705) [-1485.551] (-1487.255) * [-1484.132] (-1494.189) (-1484.174) (-1487.345) -- 0:01:19
506500 -- [-1487.626] (-1487.949) (-1483.388) (-1489.439) * (-1491.368) (-1491.917) [-1485.474] (-1483.689) -- 0:01:18
507000 -- (-1489.606) (-1487.561) (-1488.596) [-1484.372] * (-1497.504) (-1485.621) [-1491.552] (-1485.324) -- 0:01:19
507500 -- (-1488.836) (-1487.555) (-1493.029) [-1484.534] * (-1488.358) [-1491.697] (-1489.218) (-1485.939) -- 0:01:19
508000 -- [-1490.543] (-1488.757) (-1492.201) (-1485.548) * (-1489.573) [-1485.417] (-1483.657) (-1489.222) -- 0:01:19
508500 -- (-1488.927) (-1493.027) (-1488.112) [-1486.145] * (-1489.731) (-1487.453) (-1487.581) [-1489.347] -- 0:01:19
509000 -- (-1489.616) [-1488.959] (-1494.692) (-1487.606) * (-1485.730) (-1482.551) [-1483.907] (-1490.728) -- 0:01:19
509500 -- (-1485.021) (-1486.650) [-1491.578] (-1493.597) * (-1484.051) (-1490.895) [-1483.828] (-1492.734) -- 0:01:18
510000 -- (-1485.606) [-1486.708] (-1485.419) (-1490.503) * (-1487.550) (-1486.225) [-1485.288] (-1493.290) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
510500 -- (-1495.124) (-1484.517) (-1488.306) [-1491.218] * (-1493.890) [-1482.856] (-1487.655) (-1489.556) -- 0:01:18
511000 -- [-1486.209] (-1486.434) (-1488.015) (-1491.387) * (-1491.925) (-1484.463) (-1488.685) [-1492.648] -- 0:01:18
511500 -- (-1487.910) (-1486.666) (-1484.722) [-1490.803] * (-1489.871) (-1494.457) (-1488.093) [-1485.194] -- 0:01:18
512000 -- (-1486.475) (-1488.639) (-1491.545) [-1491.023] * [-1490.423] (-1489.965) (-1488.903) (-1486.327) -- 0:01:18
512500 -- [-1483.907] (-1487.381) (-1486.964) (-1485.991) * (-1488.797) [-1484.716] (-1492.673) (-1482.156) -- 0:01:18
513000 -- (-1487.003) [-1484.128] (-1487.182) (-1495.438) * (-1493.436) (-1488.995) [-1487.441] (-1482.235) -- 0:01:18
513500 -- (-1487.156) (-1488.604) [-1488.573] (-1489.386) * (-1489.144) [-1486.289] (-1488.483) (-1486.269) -- 0:01:18
514000 -- [-1485.125] (-1497.724) (-1490.495) (-1492.701) * (-1488.629) (-1489.201) (-1494.755) [-1485.664] -- 0:01:18
514500 -- (-1488.974) (-1491.368) [-1488.115] (-1500.043) * (-1493.843) [-1492.393] (-1486.565) (-1485.671) -- 0:01:18
515000 -- (-1491.298) (-1492.160) [-1484.518] (-1489.710) * [-1488.042] (-1488.021) (-1487.990) (-1494.481) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
515500 -- [-1489.044] (-1486.026) (-1483.587) (-1490.084) * (-1488.160) (-1493.737) [-1487.853] (-1493.498) -- 0:01:18
516000 -- [-1488.419] (-1489.738) (-1493.347) (-1483.249) * (-1490.021) [-1486.847] (-1493.395) (-1493.667) -- 0:01:17
516500 -- (-1490.117) (-1487.238) [-1486.782] (-1490.508) * (-1486.952) [-1483.226] (-1493.355) (-1492.594) -- 0:01:17
517000 -- (-1485.402) (-1488.398) (-1489.446) [-1485.647] * [-1483.598] (-1488.899) (-1494.319) (-1488.406) -- 0:01:17
517500 -- (-1485.567) (-1493.348) (-1491.755) [-1487.267] * [-1488.970] (-1485.960) (-1491.764) (-1487.016) -- 0:01:17
518000 -- (-1488.952) [-1491.396] (-1488.109) (-1490.036) * (-1490.432) [-1491.430] (-1485.329) (-1489.797) -- 0:01:17
518500 -- (-1485.659) (-1492.274) (-1492.489) [-1488.421] * [-1486.676] (-1491.321) (-1488.136) (-1486.264) -- 0:01:17
519000 -- [-1483.924] (-1484.779) (-1489.428) (-1489.946) * (-1486.190) [-1487.448] (-1489.218) (-1487.290) -- 0:01:17
519500 -- (-1485.209) (-1487.895) [-1488.780] (-1487.078) * (-1495.609) (-1484.586) (-1488.398) [-1482.147] -- 0:01:17
520000 -- (-1491.359) (-1487.525) [-1486.605] (-1488.057) * (-1493.941) (-1487.768) (-1485.000) [-1485.816] -- 0:01:17
Average standard deviation of split frequencies: 0.000000
520500 -- (-1492.795) [-1483.609] (-1490.394) (-1488.285) * (-1487.283) (-1493.873) (-1485.358) [-1485.757] -- 0:01:17
521000 -- (-1485.316) (-1485.107) (-1486.012) [-1486.992] * (-1489.869) [-1489.866] (-1488.512) (-1488.363) -- 0:01:17
521500 -- (-1487.200) [-1485.474] (-1490.893) (-1490.987) * [-1484.481] (-1487.766) (-1490.298) (-1483.315) -- 0:01:17
522000 -- [-1486.335] (-1486.646) (-1491.622) (-1492.511) * (-1493.545) (-1493.963) (-1489.273) [-1483.449] -- 0:01:16
522500 -- (-1487.537) (-1493.039) [-1496.324] (-1489.634) * (-1494.118) (-1490.101) [-1487.906] (-1485.655) -- 0:01:16
523000 -- (-1495.476) (-1484.115) (-1488.588) [-1488.327] * (-1486.668) (-1486.652) (-1486.036) [-1484.576] -- 0:01:16
523500 -- [-1489.944] (-1486.146) (-1492.312) (-1491.081) * (-1487.705) (-1483.489) (-1489.464) [-1485.779] -- 0:01:16
524000 -- [-1486.691] (-1482.236) (-1491.213) (-1486.385) * (-1489.238) [-1488.420] (-1485.205) (-1498.394) -- 0:01:16
524500 -- [-1489.101] (-1488.843) (-1491.361) (-1491.164) * (-1487.717) [-1487.202] (-1487.490) (-1493.598) -- 0:01:16
525000 -- (-1497.572) (-1491.752) (-1489.723) [-1490.919] * (-1494.727) (-1489.097) [-1497.309] (-1493.744) -- 0:01:16
Average standard deviation of split frequencies: 0.000000
525500 -- (-1487.859) (-1493.974) [-1488.999] (-1494.354) * (-1489.527) [-1488.167] (-1491.004) (-1492.267) -- 0:01:16
526000 -- (-1486.981) (-1485.049) (-1490.287) [-1490.793] * (-1493.212) [-1488.498] (-1484.810) (-1494.201) -- 0:01:16
526500 -- (-1493.915) [-1484.972] (-1487.214) (-1495.965) * (-1489.756) (-1485.250) [-1487.210] (-1488.833) -- 0:01:16
527000 -- (-1497.731) [-1484.794] (-1487.475) (-1492.007) * (-1481.405) [-1489.507] (-1492.971) (-1488.460) -- 0:01:16
527500 -- [-1488.864] (-1484.916) (-1489.417) (-1489.589) * (-1493.180) (-1486.505) (-1488.192) [-1488.634] -- 0:01:16
528000 -- (-1498.759) [-1487.042] (-1488.735) (-1487.913) * (-1490.254) (-1487.154) (-1484.776) [-1489.178] -- 0:01:15
528500 -- (-1496.741) (-1487.606) (-1489.572) [-1486.561] * (-1489.821) (-1490.780) [-1487.977] (-1493.237) -- 0:01:15
529000 -- (-1493.941) (-1495.825) [-1488.365] (-1490.316) * (-1487.049) (-1490.506) (-1491.922) [-1485.835] -- 0:01:15
529500 -- [-1483.623] (-1488.819) (-1488.767) (-1490.764) * [-1487.560] (-1487.823) (-1490.945) (-1489.681) -- 0:01:15
530000 -- [-1485.853] (-1485.277) (-1488.131) (-1486.607) * (-1488.367) [-1486.172] (-1491.961) (-1486.072) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
530500 -- (-1486.114) (-1490.694) (-1492.077) [-1491.139] * (-1487.295) [-1482.160] (-1484.727) (-1494.638) -- 0:01:15
531000 -- [-1486.920] (-1490.272) (-1491.542) (-1492.051) * (-1489.617) [-1483.607] (-1488.992) (-1485.776) -- 0:01:15
531500 -- [-1488.337] (-1484.611) (-1492.998) (-1491.350) * (-1487.295) (-1487.118) (-1488.752) [-1489.674] -- 0:01:15
532000 -- (-1498.750) [-1491.529] (-1499.117) (-1487.244) * (-1491.621) (-1490.993) (-1487.958) [-1488.884] -- 0:01:15
532500 -- [-1490.088] (-1490.517) (-1488.536) (-1484.732) * (-1487.565) [-1485.801] (-1483.912) (-1484.124) -- 0:01:15
533000 -- (-1485.691) [-1486.630] (-1488.420) (-1489.069) * (-1491.652) [-1486.834] (-1489.245) (-1488.964) -- 0:01:15
533500 -- (-1489.012) (-1485.155) (-1491.604) [-1485.751] * [-1493.036] (-1491.179) (-1486.593) (-1492.100) -- 0:01:15
534000 -- (-1487.920) (-1487.067) [-1485.615] (-1485.984) * (-1489.419) [-1487.390] (-1492.997) (-1491.183) -- 0:01:15
534500 -- [-1486.701] (-1488.529) (-1483.950) (-1490.345) * (-1491.828) (-1489.867) (-1484.133) [-1486.683] -- 0:01:14
535000 -- [-1484.586] (-1486.041) (-1483.655) (-1486.080) * (-1492.587) [-1489.163] (-1484.538) (-1493.601) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
535500 -- (-1491.307) (-1483.947) [-1488.068] (-1492.698) * (-1487.468) [-1486.097] (-1487.574) (-1485.991) -- 0:01:14
536000 -- (-1492.805) (-1486.698) (-1489.197) [-1488.835] * [-1495.785] (-1487.008) (-1487.258) (-1489.503) -- 0:01:14
536500 -- [-1489.947] (-1489.682) (-1491.251) (-1491.339) * (-1488.530) (-1487.034) (-1485.650) [-1483.795] -- 0:01:15
537000 -- (-1489.538) [-1486.683] (-1491.851) (-1488.933) * (-1493.415) (-1488.741) (-1484.357) [-1482.693] -- 0:01:15
537500 -- (-1489.278) (-1484.940) (-1493.996) [-1488.147] * (-1492.596) (-1491.618) (-1490.142) [-1482.003] -- 0:01:14
538000 -- (-1489.886) [-1483.733] (-1490.794) (-1488.542) * (-1485.383) [-1493.827] (-1495.529) (-1486.236) -- 0:01:14
538500 -- (-1488.307) (-1486.246) (-1493.791) [-1487.643] * (-1486.671) (-1488.131) [-1499.143] (-1487.302) -- 0:01:14
539000 -- (-1488.221) [-1489.100] (-1489.163) (-1492.066) * (-1483.943) (-1491.295) (-1493.425) [-1486.404] -- 0:01:14
539500 -- [-1487.434] (-1488.592) (-1489.041) (-1485.466) * (-1490.238) (-1491.060) [-1485.044] (-1491.003) -- 0:01:14
540000 -- (-1486.981) [-1488.917] (-1494.824) (-1484.784) * (-1486.677) [-1486.362] (-1495.286) (-1487.723) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
540500 -- [-1488.634] (-1484.747) (-1494.483) (-1486.434) * (-1483.461) (-1492.847) (-1489.589) [-1487.181] -- 0:01:13
541000 -- [-1490.336] (-1486.572) (-1486.953) (-1484.163) * (-1490.076) (-1484.067) (-1497.751) [-1485.462] -- 0:01:13
541500 -- (-1490.986) [-1486.771] (-1483.660) (-1489.219) * (-1486.933) (-1486.260) [-1487.339] (-1489.373) -- 0:01:13
542000 -- [-1488.066] (-1484.488) (-1483.638) (-1491.083) * [-1488.848] (-1485.046) (-1485.495) (-1487.732) -- 0:01:13
542500 -- (-1485.393) (-1495.586) [-1490.686] (-1488.871) * (-1488.299) (-1488.113) [-1487.021] (-1485.611) -- 0:01:14
543000 -- [-1486.415] (-1485.002) (-1488.936) (-1492.279) * (-1494.264) [-1491.060] (-1487.623) (-1497.655) -- 0:01:14
543500 -- (-1484.414) (-1487.303) [-1481.885] (-1491.802) * (-1492.994) (-1489.112) [-1483.985] (-1493.674) -- 0:01:13
544000 -- [-1483.332] (-1487.231) (-1488.039) (-1486.979) * [-1494.605] (-1489.392) (-1485.005) (-1488.540) -- 0:01:13
544500 -- (-1489.835) (-1487.733) (-1489.892) [-1483.416] * (-1491.741) (-1487.206) (-1490.283) [-1489.505] -- 0:01:13
545000 -- (-1491.024) [-1487.252] (-1496.131) (-1484.219) * (-1487.637) (-1488.918) [-1482.573] (-1487.676) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
545500 -- [-1488.737] (-1486.046) (-1490.685) (-1484.244) * (-1489.921) (-1488.223) [-1487.365] (-1501.072) -- 0:01:13
546000 -- (-1492.971) (-1486.135) (-1487.064) [-1487.259] * (-1501.345) (-1491.635) (-1490.508) [-1487.037] -- 0:01:13
546500 -- (-1484.214) (-1487.899) [-1486.157] (-1489.158) * [-1487.336] (-1486.991) (-1485.350) (-1489.825) -- 0:01:13
547000 -- (-1491.021) (-1487.600) [-1491.501] (-1486.069) * (-1483.995) (-1488.891) (-1490.147) [-1486.845] -- 0:01:12
547500 -- (-1488.137) [-1486.757] (-1493.433) (-1489.528) * (-1491.353) (-1487.828) (-1488.952) [-1487.845] -- 0:01:12
548000 -- (-1495.014) (-1493.578) (-1490.081) [-1487.061] * [-1484.571] (-1494.067) (-1488.390) (-1484.590) -- 0:01:12
548500 -- (-1489.779) (-1484.392) (-1486.732) [-1487.539] * (-1494.229) [-1488.701] (-1491.039) (-1487.751) -- 0:01:13
549000 -- (-1495.376) (-1489.075) [-1486.324] (-1487.440) * (-1485.905) (-1497.257) [-1488.337] (-1488.779) -- 0:01:13
549500 -- (-1494.693) (-1486.781) (-1485.972) [-1489.087] * (-1487.846) (-1493.110) (-1490.462) [-1488.012] -- 0:01:12
550000 -- (-1486.398) [-1489.961] (-1488.224) (-1488.932) * (-1492.144) [-1484.303] (-1487.075) (-1487.750) -- 0:01:12
Average standard deviation of split frequencies: 0.000000
550500 -- (-1486.568) (-1487.129) (-1492.883) [-1487.588] * (-1490.458) [-1487.668] (-1492.990) (-1484.241) -- 0:01:12
551000 -- (-1490.001) [-1484.453] (-1489.996) (-1496.932) * [-1487.600] (-1490.576) (-1488.088) (-1490.714) -- 0:01:12
551500 -- (-1486.652) (-1489.588) (-1493.402) [-1487.220] * (-1491.200) [-1487.638] (-1488.741) (-1486.265) -- 0:01:12
552000 -- (-1484.203) [-1489.540] (-1489.910) (-1485.746) * (-1487.075) [-1488.828] (-1488.303) (-1485.107) -- 0:01:12
552500 -- (-1488.733) (-1491.974) [-1485.612] (-1490.666) * [-1491.851] (-1493.745) (-1484.321) (-1492.242) -- 0:01:12
553000 -- (-1487.536) (-1488.567) (-1488.818) [-1488.670] * [-1494.375] (-1489.167) (-1487.839) (-1489.393) -- 0:01:11
553500 -- (-1488.117) (-1484.994) (-1484.029) [-1486.849] * [-1484.786] (-1488.376) (-1489.840) (-1491.784) -- 0:01:11
554000 -- (-1483.680) (-1484.758) [-1482.162] (-1490.118) * (-1484.119) (-1486.293) [-1490.110] (-1496.165) -- 0:01:11
554500 -- (-1491.330) [-1484.849] (-1490.641) (-1486.786) * (-1487.566) (-1489.521) [-1486.671] (-1485.920) -- 0:01:12
555000 -- [-1490.550] (-1486.535) (-1493.579) (-1492.208) * (-1489.679) [-1483.583] (-1490.060) (-1486.916) -- 0:01:12
Average standard deviation of split frequencies: 0.000000
555500 -- (-1484.138) (-1489.651) (-1486.272) [-1486.795] * (-1489.252) (-1484.601) (-1495.606) [-1486.272] -- 0:01:12
556000 -- (-1483.733) (-1489.587) [-1484.355] (-1499.941) * [-1485.272] (-1487.706) (-1494.828) (-1482.320) -- 0:01:11
556500 -- [-1489.940] (-1486.569) (-1485.784) (-1497.074) * (-1490.020) (-1484.174) [-1487.449] (-1485.807) -- 0:01:11
557000 -- (-1488.050) (-1489.900) [-1487.782] (-1494.684) * (-1493.002) [-1486.668] (-1488.743) (-1492.011) -- 0:01:11
557500 -- (-1484.970) (-1489.802) (-1482.420) [-1487.179] * [-1487.884] (-1490.053) (-1488.553) (-1485.462) -- 0:01:11
558000 -- [-1484.236] (-1492.993) (-1487.339) (-1485.834) * [-1485.925] (-1486.311) (-1485.456) (-1488.416) -- 0:01:11
558500 -- (-1486.680) [-1486.446] (-1491.706) (-1493.737) * [-1485.533] (-1489.367) (-1495.340) (-1490.590) -- 0:01:11
559000 -- (-1487.028) (-1486.455) [-1489.890] (-1495.811) * (-1485.665) (-1486.322) [-1487.994] (-1497.214) -- 0:01:11
559500 -- (-1497.556) [-1488.705] (-1497.663) (-1496.976) * (-1487.259) (-1486.658) [-1486.936] (-1487.871) -- 0:01:10
560000 -- (-1489.054) (-1484.628) (-1487.916) [-1486.164] * [-1484.549] (-1483.394) (-1485.085) (-1490.053) -- 0:01:10
Average standard deviation of split frequencies: 0.000000
560500 -- (-1490.545) (-1496.497) [-1486.029] (-1491.905) * (-1490.223) (-1483.890) [-1483.276] (-1484.663) -- 0:01:11
561000 -- (-1487.713) (-1493.074) (-1488.537) [-1487.448] * (-1489.384) [-1486.668] (-1489.898) (-1487.333) -- 0:01:11
561500 -- [-1488.018] (-1497.994) (-1487.993) (-1487.131) * [-1485.855] (-1483.393) (-1488.078) (-1488.366) -- 0:01:11
562000 -- (-1498.509) (-1496.263) [-1490.554] (-1495.874) * [-1486.141] (-1489.256) (-1494.276) (-1489.413) -- 0:01:10
562500 -- (-1486.750) [-1494.267] (-1490.296) (-1493.524) * [-1486.441] (-1487.263) (-1488.943) (-1487.485) -- 0:01:10
563000 -- [-1485.341] (-1488.509) (-1497.060) (-1489.376) * [-1484.410] (-1487.160) (-1495.677) (-1487.219) -- 0:01:10
563500 -- (-1492.210) (-1491.706) (-1496.233) [-1486.047] * [-1484.555] (-1484.051) (-1484.695) (-1490.709) -- 0:01:10
564000 -- (-1493.519) [-1484.386] (-1486.156) (-1486.289) * (-1487.743) (-1485.745) [-1486.568] (-1487.643) -- 0:01:10
564500 -- (-1495.200) [-1488.067] (-1488.778) (-1485.420) * (-1490.127) (-1491.481) (-1488.740) [-1486.571] -- 0:01:10
565000 -- (-1491.146) (-1486.683) [-1486.199] (-1488.939) * (-1491.845) [-1490.338] (-1496.535) (-1488.046) -- 0:01:10
Average standard deviation of split frequencies: 0.000000
565500 -- [-1487.578] (-1485.398) (-1485.986) (-1493.028) * (-1486.925) [-1492.794] (-1487.420) (-1492.440) -- 0:01:09
566000 -- (-1485.511) (-1493.323) [-1484.859] (-1490.204) * (-1483.657) (-1492.189) [-1487.533] (-1483.003) -- 0:01:09
566500 -- (-1485.106) (-1491.483) [-1491.090] (-1487.847) * (-1489.633) (-1496.005) (-1487.612) [-1482.691] -- 0:01:10
567000 -- (-1489.198) [-1487.282] (-1484.632) (-1489.075) * (-1496.088) (-1488.955) (-1488.214) [-1486.197] -- 0:01:10
567500 -- (-1488.475) (-1491.058) [-1487.053] (-1486.814) * (-1490.431) [-1487.196] (-1486.657) (-1487.534) -- 0:01:10
568000 -- (-1492.919) (-1491.792) (-1493.003) [-1486.238] * (-1495.377) (-1489.715) (-1482.296) [-1491.883] -- 0:01:09
568500 -- [-1488.314] (-1499.870) (-1487.231) (-1501.243) * (-1488.395) (-1489.162) (-1485.401) [-1488.576] -- 0:01:09
569000 -- (-1487.703) (-1496.668) [-1485.914] (-1489.331) * (-1486.876) (-1488.550) (-1488.100) [-1486.401] -- 0:01:09
569500 -- (-1487.711) (-1488.495) (-1484.820) [-1484.001] * [-1494.388] (-1496.447) (-1487.916) (-1489.850) -- 0:01:09
570000 -- (-1489.676) [-1487.795] (-1485.682) (-1484.979) * (-1486.871) (-1487.320) (-1490.578) [-1489.249] -- 0:01:09
Average standard deviation of split frequencies: 0.000000
570500 -- (-1488.868) (-1487.842) (-1486.877) [-1488.576] * (-1489.370) (-1486.764) [-1484.353] (-1493.571) -- 0:01:09
571000 -- (-1494.670) [-1486.269] (-1489.176) (-1487.468) * [-1483.968] (-1489.653) (-1493.095) (-1486.190) -- 0:01:09
571500 -- [-1487.489] (-1489.944) (-1488.920) (-1483.710) * [-1486.300] (-1494.242) (-1488.268) (-1486.352) -- 0:01:08
572000 -- (-1487.388) [-1489.824] (-1483.266) (-1489.226) * (-1496.497) (-1484.945) [-1488.853] (-1493.113) -- 0:01:08
572500 -- (-1492.872) [-1491.470] (-1490.683) (-1489.098) * (-1494.410) [-1487.531] (-1488.270) (-1486.029) -- 0:01:09
573000 -- (-1490.549) (-1489.361) [-1488.371] (-1489.275) * (-1487.131) (-1488.689) [-1489.270] (-1490.820) -- 0:01:09
573500 -- (-1487.281) [-1488.227] (-1486.846) (-1486.861) * (-1483.740) [-1489.810] (-1485.836) (-1484.483) -- 0:01:09
574000 -- (-1488.386) [-1487.718] (-1490.407) (-1487.962) * [-1489.289] (-1491.973) (-1490.841) (-1484.016) -- 0:01:09
574500 -- (-1486.452) (-1490.723) (-1492.187) [-1484.879] * (-1485.768) [-1492.368] (-1486.539) (-1485.504) -- 0:01:08
575000 -- (-1486.060) (-1489.412) [-1485.676] (-1485.893) * (-1496.315) (-1487.043) (-1486.567) [-1483.428] -- 0:01:08
Average standard deviation of split frequencies: 0.000000
575500 -- (-1491.320) (-1486.816) (-1491.255) [-1491.318] * (-1492.196) [-1485.293] (-1487.577) (-1487.588) -- 0:01:08
576000 -- (-1490.154) (-1490.919) [-1486.538] (-1486.641) * (-1486.024) (-1486.759) [-1486.443] (-1488.545) -- 0:01:08
576500 -- (-1485.771) (-1491.581) (-1485.306) [-1491.281] * (-1487.142) (-1487.295) (-1491.758) [-1483.647] -- 0:01:08
577000 -- (-1490.003) [-1491.595] (-1493.326) (-1489.845) * (-1486.684) (-1499.286) (-1485.828) [-1485.686] -- 0:01:08
577500 -- (-1489.883) (-1488.959) (-1486.692) [-1488.864] * (-1488.203) (-1491.496) (-1486.955) [-1485.671] -- 0:01:08
578000 -- (-1485.289) (-1492.311) (-1483.933) [-1485.134] * (-1491.849) (-1486.243) (-1491.461) [-1487.342] -- 0:01:07
578500 -- (-1487.623) (-1485.512) [-1488.839] (-1482.729) * (-1488.097) [-1482.944] (-1492.919) (-1486.437) -- 0:01:08
579000 -- [-1487.452] (-1488.337) (-1496.217) (-1494.044) * (-1488.284) (-1484.832) [-1488.397] (-1483.340) -- 0:01:08
579500 -- (-1491.777) (-1487.376) (-1492.996) [-1494.269] * (-1487.331) (-1482.033) (-1488.656) [-1490.768] -- 0:01:08
580000 -- [-1492.305] (-1489.371) (-1488.773) (-1487.985) * (-1484.114) [-1492.029] (-1488.927) (-1484.795) -- 0:01:08
Average standard deviation of split frequencies: 0.000000
580500 -- (-1488.766) (-1488.489) (-1498.121) [-1484.785] * (-1491.412) (-1492.717) (-1488.525) [-1490.488] -- 0:01:07
581000 -- (-1485.739) (-1488.707) [-1486.875] (-1493.210) * (-1487.761) [-1483.160] (-1487.714) (-1490.106) -- 0:01:07
581500 -- [-1484.677] (-1485.263) (-1492.528) (-1496.871) * [-1490.899] (-1490.173) (-1485.549) (-1484.470) -- 0:01:07
582000 -- [-1484.643] (-1487.807) (-1486.876) (-1489.217) * (-1486.219) (-1494.517) (-1492.863) [-1487.845] -- 0:01:07
582500 -- [-1484.103] (-1482.678) (-1489.767) (-1491.202) * [-1485.953] (-1492.768) (-1491.568) (-1487.702) -- 0:01:07
583000 -- (-1496.292) (-1487.489) (-1489.910) [-1488.343] * (-1486.598) [-1493.128] (-1491.076) (-1492.328) -- 0:01:07
583500 -- (-1485.611) (-1492.514) (-1488.772) [-1487.129] * (-1489.536) (-1499.773) (-1494.657) [-1491.373] -- 0:01:07
584000 -- (-1489.853) (-1483.738) [-1484.039] (-1493.713) * (-1493.000) (-1494.031) (-1490.481) [-1488.529] -- 0:01:06
584500 -- [-1486.381] (-1488.701) (-1490.831) (-1491.013) * (-1486.551) [-1486.843] (-1496.866) (-1491.238) -- 0:01:07
585000 -- [-1485.152] (-1486.766) (-1490.380) (-1486.601) * (-1486.484) [-1484.512] (-1491.886) (-1484.727) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
585500 -- (-1491.546) (-1496.503) (-1492.112) [-1484.999] * (-1486.214) [-1483.992] (-1491.704) (-1485.878) -- 0:01:07
586000 -- (-1489.817) (-1489.524) (-1484.742) [-1487.086] * (-1491.841) (-1489.426) (-1491.392) [-1490.327] -- 0:01:07
586500 -- (-1493.801) (-1493.554) [-1494.346] (-1491.757) * [-1485.419] (-1490.102) (-1486.596) (-1489.635) -- 0:01:06
587000 -- (-1486.270) [-1486.334] (-1486.773) (-1486.381) * (-1487.673) (-1490.468) (-1490.490) [-1489.653] -- 0:01:06
587500 -- (-1489.875) (-1486.721) (-1486.329) [-1487.693] * (-1484.057) [-1492.915] (-1494.315) (-1484.478) -- 0:01:06
588000 -- (-1490.247) [-1484.818] (-1482.173) (-1487.397) * (-1491.045) [-1487.683] (-1489.344) (-1490.346) -- 0:01:06
588500 -- (-1487.714) (-1489.964) [-1488.056] (-1491.215) * (-1493.123) (-1487.120) [-1484.351] (-1482.978) -- 0:01:06
589000 -- (-1493.416) (-1486.201) [-1485.181] (-1486.797) * (-1490.985) (-1489.315) [-1485.305] (-1487.430) -- 0:01:06
589500 -- (-1485.554) (-1495.946) [-1483.947] (-1487.798) * [-1486.117] (-1486.862) (-1487.492) (-1486.923) -- 0:01:06
590000 -- (-1492.153) [-1488.176] (-1490.321) (-1491.876) * [-1486.059] (-1486.569) (-1490.490) (-1486.565) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
590500 -- [-1490.533] (-1489.071) (-1490.052) (-1487.586) * (-1487.969) [-1484.111] (-1488.100) (-1488.786) -- 0:01:06
591000 -- (-1493.206) (-1487.415) [-1495.626] (-1490.757) * (-1485.919) (-1487.434) (-1495.258) [-1484.052] -- 0:01:06
591500 -- (-1489.859) (-1487.521) [-1487.882] (-1483.726) * (-1487.032) (-1485.849) [-1487.567] (-1484.322) -- 0:01:06
592000 -- (-1486.057) [-1486.442] (-1486.675) (-1486.434) * (-1484.628) (-1487.458) (-1489.253) [-1491.866] -- 0:01:06
592500 -- (-1490.186) [-1488.588] (-1490.915) (-1486.335) * (-1482.653) (-1488.304) (-1491.211) [-1487.080] -- 0:01:06
593000 -- (-1490.004) (-1487.699) (-1487.969) [-1493.283] * (-1485.542) (-1498.820) [-1485.349] (-1487.676) -- 0:01:05
593500 -- (-1497.871) [-1486.473] (-1494.512) (-1486.228) * [-1490.306] (-1488.951) (-1489.918) (-1485.927) -- 0:01:05
594000 -- (-1497.895) (-1491.309) (-1487.947) [-1490.384] * (-1487.566) (-1488.940) [-1490.456] (-1490.945) -- 0:01:05
594500 -- (-1492.430) (-1494.571) [-1486.764] (-1485.604) * (-1489.159) (-1490.173) [-1489.342] (-1487.397) -- 0:01:05
595000 -- [-1486.615] (-1487.770) (-1489.021) (-1487.246) * [-1487.499] (-1488.079) (-1486.859) (-1487.586) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
595500 -- (-1489.649) (-1486.997) (-1489.889) [-1490.283] * (-1486.861) (-1484.597) (-1491.808) [-1495.093] -- 0:01:05
596000 -- (-1487.858) [-1490.900] (-1485.444) (-1486.740) * (-1489.084) (-1486.225) [-1487.632] (-1491.276) -- 0:01:05
596500 -- (-1486.304) [-1488.740] (-1489.847) (-1494.281) * (-1496.404) (-1493.451) [-1485.446] (-1488.439) -- 0:01:05
597000 -- (-1490.428) (-1483.379) [-1485.193] (-1485.405) * (-1489.839) (-1491.536) (-1486.940) [-1488.988] -- 0:01:05
597500 -- (-1485.703) [-1488.764] (-1491.158) (-1485.751) * (-1489.042) (-1495.038) (-1485.632) [-1489.418] -- 0:01:05
598000 -- (-1491.285) [-1484.117] (-1489.278) (-1485.630) * (-1488.026) [-1489.179] (-1484.801) (-1488.320) -- 0:01:05
598500 -- [-1491.494] (-1494.384) (-1492.187) (-1490.469) * (-1495.508) (-1482.679) (-1502.516) [-1488.206] -- 0:01:05
599000 -- (-1488.199) [-1485.754] (-1489.150) (-1485.285) * (-1490.143) [-1487.352] (-1491.084) (-1489.841) -- 0:01:04
599500 -- (-1490.482) (-1486.041) (-1486.835) [-1483.271] * (-1489.370) (-1487.203) [-1487.325] (-1490.002) -- 0:01:04
600000 -- [-1487.985] (-1489.228) (-1489.002) (-1485.197) * [-1487.730] (-1487.422) (-1490.937) (-1489.003) -- 0:01:04
Average standard deviation of split frequencies: 0.000000
600500 -- (-1490.975) [-1482.021] (-1486.470) (-1491.037) * (-1498.758) (-1489.758) (-1494.000) [-1487.317] -- 0:01:04
601000 -- (-1489.579) (-1487.198) (-1488.616) [-1488.067] * (-1486.084) (-1488.328) (-1491.138) [-1487.191] -- 0:01:04
601500 -- (-1491.206) (-1490.094) (-1494.798) [-1485.778] * (-1488.008) [-1484.185] (-1496.282) (-1488.877) -- 0:01:04
602000 -- (-1494.421) (-1490.813) [-1488.270] (-1485.868) * [-1486.916] (-1495.409) (-1492.668) (-1491.345) -- 0:01:04
602500 -- (-1492.855) (-1498.697) (-1496.094) [-1486.720] * (-1486.624) [-1490.555] (-1493.338) (-1493.896) -- 0:01:04
603000 -- [-1489.235] (-1505.028) (-1490.132) (-1487.240) * (-1487.923) [-1485.324] (-1500.090) (-1487.922) -- 0:01:04
603500 -- (-1489.528) (-1496.154) (-1493.287) [-1486.060] * (-1492.041) (-1486.451) [-1487.642] (-1485.178) -- 0:01:04
604000 -- [-1501.258] (-1495.209) (-1496.420) (-1486.683) * [-1484.186] (-1485.038) (-1491.808) (-1487.902) -- 0:01:04
604500 -- (-1494.442) (-1493.984) [-1484.265] (-1487.271) * (-1489.946) (-1498.422) [-1489.670] (-1490.319) -- 0:01:04
605000 -- (-1503.719) (-1493.324) (-1485.743) [-1490.419] * (-1490.358) (-1491.454) (-1488.947) [-1493.355] -- 0:01:03
Average standard deviation of split frequencies: 0.000000
605500 -- (-1499.959) (-1495.951) (-1486.945) [-1484.774] * (-1489.495) (-1485.768) (-1488.663) [-1492.744] -- 0:01:03
606000 -- (-1497.389) (-1489.482) (-1487.000) [-1489.018] * (-1486.560) [-1486.366] (-1487.594) (-1489.201) -- 0:01:03
606500 -- [-1487.982] (-1489.155) (-1489.276) (-1489.463) * (-1487.919) [-1487.715] (-1486.270) (-1488.415) -- 0:01:03
607000 -- [-1486.877] (-1497.229) (-1483.748) (-1487.653) * (-1487.725) (-1484.033) [-1489.774] (-1485.011) -- 0:01:03
607500 -- (-1491.927) (-1486.695) (-1494.397) [-1484.304] * [-1487.137] (-1498.133) (-1486.452) (-1491.159) -- 0:01:03
608000 -- [-1485.302] (-1491.422) (-1489.524) (-1483.859) * (-1490.524) [-1487.412] (-1485.951) (-1486.900) -- 0:01:03
608500 -- [-1484.221] (-1492.006) (-1487.343) (-1485.712) * (-1486.237) [-1485.997] (-1487.491) (-1486.387) -- 0:01:03
609000 -- (-1492.144) (-1489.646) [-1492.651] (-1483.030) * (-1486.644) [-1488.495] (-1495.967) (-1490.447) -- 0:01:03
609500 -- (-1490.672) [-1484.692] (-1489.769) (-1492.453) * (-1494.610) [-1486.066] (-1486.399) (-1488.655) -- 0:01:03
610000 -- (-1489.021) (-1489.910) (-1496.186) [-1484.081] * (-1493.515) [-1488.931] (-1485.886) (-1487.279) -- 0:01:03
Average standard deviation of split frequencies: 0.000000
610500 -- (-1495.488) (-1489.969) [-1489.396] (-1490.342) * (-1486.319) (-1491.346) (-1486.006) [-1484.753] -- 0:01:03
611000 -- [-1492.038] (-1485.081) (-1493.601) (-1493.450) * [-1493.937] (-1494.326) (-1486.390) (-1489.260) -- 0:01:03
611500 -- [-1486.742] (-1495.018) (-1493.179) (-1489.370) * (-1485.160) (-1494.724) [-1494.024] (-1487.532) -- 0:01:02
612000 -- [-1491.245] (-1496.326) (-1488.898) (-1483.079) * (-1483.762) [-1489.183] (-1488.712) (-1486.122) -- 0:01:02
612500 -- [-1487.189] (-1485.639) (-1488.618) (-1485.144) * (-1481.870) [-1487.151] (-1489.682) (-1487.541) -- 0:01:02
613000 -- (-1488.071) [-1486.648] (-1488.696) (-1486.361) * [-1487.523] (-1483.418) (-1487.883) (-1483.231) -- 0:01:02
613500 -- (-1490.650) (-1486.725) [-1489.075] (-1487.507) * [-1486.054] (-1485.558) (-1488.701) (-1486.074) -- 0:01:02
614000 -- [-1487.778] (-1488.815) (-1489.250) (-1494.908) * (-1488.165) (-1487.593) [-1489.121] (-1485.233) -- 0:01:02
614500 -- (-1488.417) [-1483.958] (-1488.062) (-1491.473) * (-1488.713) (-1484.583) (-1490.625) [-1489.945] -- 0:01:02
615000 -- (-1484.824) [-1482.904] (-1491.927) (-1492.111) * [-1486.360] (-1491.922) (-1487.467) (-1487.065) -- 0:01:02
Average standard deviation of split frequencies: 0.000000
615500 -- [-1488.419] (-1485.232) (-1487.688) (-1492.657) * (-1491.332) (-1485.321) (-1489.169) [-1486.776] -- 0:01:02
616000 -- (-1485.685) [-1490.505] (-1487.170) (-1496.021) * (-1486.274) (-1495.703) [-1482.258] (-1497.737) -- 0:01:02
616500 -- [-1487.368] (-1487.891) (-1485.774) (-1490.135) * (-1485.761) (-1492.508) (-1493.337) [-1487.472] -- 0:01:02
617000 -- [-1491.255] (-1491.339) (-1493.417) (-1493.371) * (-1487.838) (-1487.021) (-1491.354) [-1485.337] -- 0:01:02
617500 -- (-1493.022) [-1490.614] (-1486.022) (-1488.661) * (-1485.831) (-1488.763) (-1485.425) [-1490.812] -- 0:01:01
618000 -- (-1487.701) (-1487.688) [-1488.102] (-1487.850) * [-1486.976] (-1483.546) (-1491.802) (-1486.427) -- 0:01:01
618500 -- (-1491.241) (-1498.433) [-1490.508] (-1490.548) * (-1485.028) [-1483.251] (-1488.402) (-1486.662) -- 0:01:01
619000 -- [-1488.573] (-1489.077) (-1486.159) (-1484.276) * (-1491.650) (-1487.590) [-1490.937] (-1484.754) -- 0:01:01
619500 -- [-1486.169] (-1489.659) (-1487.854) (-1493.962) * (-1489.841) (-1487.937) (-1485.896) [-1482.857] -- 0:01:01
620000 -- [-1488.283] (-1489.923) (-1487.093) (-1497.722) * (-1485.076) (-1488.673) (-1489.644) [-1488.338] -- 0:01:01
Average standard deviation of split frequencies: 0.000000
620500 -- (-1490.014) (-1487.351) [-1484.794] (-1501.399) * [-1489.162] (-1483.131) (-1484.999) (-1487.565) -- 0:01:01
621000 -- (-1487.240) (-1483.983) [-1485.173] (-1490.151) * (-1485.997) [-1493.383] (-1486.550) (-1489.410) -- 0:01:01
621500 -- [-1485.568] (-1490.914) (-1490.008) (-1496.030) * [-1489.191] (-1487.452) (-1492.104) (-1491.357) -- 0:01:01
622000 -- [-1485.633] (-1482.731) (-1485.605) (-1489.757) * (-1486.280) (-1486.285) (-1491.592) [-1488.712] -- 0:01:01
622500 -- [-1487.875] (-1487.062) (-1488.794) (-1488.620) * (-1485.514) (-1491.824) (-1486.701) [-1487.038] -- 0:01:01
623000 -- (-1487.790) (-1491.010) (-1486.211) [-1485.364] * (-1488.222) (-1493.033) [-1488.391] (-1489.300) -- 0:01:01
623500 -- (-1487.687) (-1489.162) (-1492.543) [-1483.045] * (-1487.736) (-1490.781) [-1487.039] (-1492.236) -- 0:01:00
624000 -- (-1485.617) (-1489.660) (-1495.676) [-1485.219] * (-1489.120) (-1487.432) (-1486.847) [-1489.220] -- 0:01:00
624500 -- (-1490.411) [-1485.301] (-1487.928) (-1487.831) * [-1488.122] (-1490.044) (-1485.787) (-1489.922) -- 0:01:00
625000 -- (-1488.117) (-1492.672) [-1491.834] (-1492.667) * (-1491.300) (-1487.020) [-1486.943] (-1488.559) -- 0:01:00
Average standard deviation of split frequencies: 0.000000
625500 -- (-1488.786) (-1488.980) [-1486.120] (-1490.008) * (-1487.366) [-1483.974] (-1487.796) (-1486.151) -- 0:01:00
626000 -- (-1487.169) [-1490.716] (-1488.410) (-1493.197) * (-1493.908) [-1489.495] (-1485.185) (-1484.705) -- 0:01:00
626500 -- [-1491.265] (-1487.600) (-1490.484) (-1490.330) * [-1494.160] (-1490.324) (-1486.484) (-1489.360) -- 0:01:00
627000 -- (-1488.579) [-1489.967] (-1489.232) (-1492.138) * (-1488.126) (-1490.777) (-1487.870) [-1484.837] -- 0:01:00
627500 -- [-1485.261] (-1487.776) (-1492.721) (-1488.636) * (-1493.811) (-1487.474) [-1488.305] (-1484.917) -- 0:01:00
628000 -- [-1483.643] (-1487.510) (-1494.326) (-1483.715) * (-1484.186) (-1490.314) (-1485.920) [-1490.662] -- 0:01:00
628500 -- [-1490.896] (-1485.518) (-1492.413) (-1482.918) * (-1492.751) (-1492.675) [-1486.611] (-1484.919) -- 0:01:00
629000 -- (-1489.152) (-1489.931) [-1490.918] (-1489.600) * (-1485.932) (-1489.027) (-1488.869) [-1498.309] -- 0:01:00
629500 -- [-1485.127] (-1491.612) (-1486.681) (-1485.738) * (-1492.445) [-1488.484] (-1487.325) (-1492.963) -- 0:01:00
630000 -- [-1487.206] (-1492.423) (-1486.595) (-1489.100) * (-1491.207) (-1487.979) [-1492.168] (-1489.452) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
630500 -- (-1489.400) (-1486.058) (-1491.927) [-1483.485] * (-1490.474) [-1488.327] (-1494.849) (-1489.763) -- 0:00:59
631000 -- (-1495.925) [-1486.736] (-1488.864) (-1489.372) * (-1488.172) (-1488.588) (-1489.357) [-1483.860] -- 0:00:59
631500 -- (-1493.623) (-1486.121) [-1488.132] (-1492.175) * (-1488.515) [-1488.471] (-1490.627) (-1492.318) -- 0:00:59
632000 -- (-1494.505) (-1489.112) [-1486.041] (-1488.513) * [-1485.596] (-1491.166) (-1488.628) (-1489.535) -- 0:00:59
632500 -- (-1494.591) (-1486.168) [-1486.664] (-1488.262) * (-1490.506) (-1487.097) [-1488.459] (-1486.939) -- 0:00:59
633000 -- (-1490.898) (-1486.910) (-1489.782) [-1487.480] * (-1492.700) (-1483.891) (-1490.240) [-1487.515] -- 0:00:59
633500 -- (-1486.310) [-1489.215] (-1491.122) (-1486.539) * (-1498.658) (-1488.677) [-1490.032] (-1485.883) -- 0:00:59
634000 -- (-1488.738) (-1486.160) [-1491.373] (-1492.522) * [-1496.520] (-1494.247) (-1486.731) (-1485.728) -- 0:00:59
634500 -- [-1483.326] (-1491.390) (-1491.422) (-1485.449) * (-1487.614) (-1493.985) (-1497.850) [-1485.589] -- 0:00:59
635000 -- (-1489.059) (-1490.227) [-1489.083] (-1484.996) * [-1488.608] (-1486.328) (-1496.795) (-1483.600) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
635500 -- (-1486.671) (-1487.667) (-1485.998) [-1486.040] * [-1483.980] (-1492.314) (-1488.981) (-1490.796) -- 0:00:59
636000 -- (-1485.505) (-1486.636) [-1485.614] (-1492.041) * (-1483.262) [-1484.400] (-1487.929) (-1488.804) -- 0:00:58
636500 -- (-1491.227) (-1495.225) [-1486.445] (-1488.615) * [-1489.339] (-1488.757) (-1489.279) (-1488.397) -- 0:00:58
637000 -- [-1489.233] (-1485.013) (-1491.034) (-1491.164) * (-1494.469) (-1491.182) [-1492.923] (-1487.668) -- 0:00:58
637500 -- (-1488.509) (-1492.736) (-1489.266) [-1487.742] * (-1492.171) [-1484.526] (-1485.926) (-1488.054) -- 0:00:58
638000 -- (-1484.078) [-1485.826] (-1488.331) (-1490.830) * (-1489.623) (-1484.936) (-1488.360) [-1487.616] -- 0:00:58
638500 -- [-1486.103] (-1489.594) (-1492.821) (-1498.839) * (-1485.280) (-1485.345) [-1486.575] (-1485.480) -- 0:00:58
639000 -- (-1489.836) (-1486.596) [-1486.604] (-1493.138) * (-1488.684) [-1487.050] (-1486.858) (-1493.938) -- 0:00:58
639500 -- (-1490.910) [-1491.232] (-1489.142) (-1493.063) * (-1486.467) [-1487.457] (-1492.713) (-1491.142) -- 0:00:58
640000 -- (-1489.934) [-1492.637] (-1492.447) (-1494.049) * (-1492.121) [-1488.839] (-1490.505) (-1492.183) -- 0:00:58
Average standard deviation of split frequencies: 0.000000
640500 -- [-1486.959] (-1491.676) (-1489.760) (-1493.792) * (-1487.043) (-1488.185) [-1482.142] (-1491.973) -- 0:00:58
641000 -- (-1488.942) (-1489.844) (-1488.200) [-1489.106] * (-1486.980) [-1494.335] (-1489.169) (-1486.362) -- 0:00:58
641500 -- [-1489.199] (-1495.754) (-1491.501) (-1491.981) * (-1491.110) (-1493.059) [-1487.737] (-1487.197) -- 0:00:58
642000 -- [-1486.339] (-1484.679) (-1492.053) (-1487.454) * (-1483.957) (-1491.581) (-1489.559) [-1486.226] -- 0:00:57
642500 -- (-1488.802) [-1492.029] (-1485.617) (-1486.181) * (-1487.856) [-1487.778] (-1493.285) (-1489.400) -- 0:00:57
643000 -- (-1484.356) (-1489.037) [-1487.963] (-1486.207) * (-1485.441) (-1488.935) [-1490.546] (-1490.072) -- 0:00:57
643500 -- (-1485.019) (-1491.930) (-1484.833) [-1483.842] * [-1491.175] (-1489.038) (-1488.553) (-1493.668) -- 0:00:57
644000 -- [-1487.669] (-1490.495) (-1488.391) (-1489.044) * (-1490.479) [-1489.967] (-1485.430) (-1487.601) -- 0:00:57
644500 -- (-1486.131) [-1488.657] (-1489.656) (-1492.616) * (-1489.969) (-1484.420) (-1498.897) [-1486.958] -- 0:00:57
645000 -- [-1483.879] (-1490.165) (-1487.879) (-1487.344) * (-1488.382) (-1484.430) [-1500.578] (-1489.131) -- 0:00:57
Average standard deviation of split frequencies: 0.000000
645500 -- (-1485.077) (-1486.583) [-1483.686] (-1488.407) * (-1486.807) [-1485.657] (-1485.937) (-1488.806) -- 0:00:57
646000 -- [-1485.024] (-1485.821) (-1489.966) (-1486.057) * [-1487.351] (-1487.154) (-1490.520) (-1488.665) -- 0:00:57
646500 -- (-1492.789) (-1486.565) (-1487.164) [-1488.759] * (-1486.291) (-1490.993) (-1485.733) [-1484.362] -- 0:00:57
647000 -- (-1490.669) [-1486.957] (-1486.500) (-1487.674) * (-1489.072) [-1486.093] (-1487.374) (-1486.784) -- 0:00:57
647500 -- [-1489.018] (-1485.530) (-1491.308) (-1484.907) * (-1484.460) (-1486.616) (-1489.445) [-1485.280] -- 0:00:57
648000 -- [-1489.790] (-1487.421) (-1488.977) (-1484.395) * [-1487.916] (-1485.863) (-1492.204) (-1488.742) -- 0:00:57
648500 -- (-1488.273) [-1498.562] (-1498.369) (-1490.981) * (-1492.090) [-1486.150] (-1489.013) (-1500.983) -- 0:00:56
649000 -- (-1491.053) (-1488.607) (-1492.373) [-1488.354] * (-1489.537) [-1487.075] (-1489.101) (-1487.236) -- 0:00:56
649500 -- (-1485.602) (-1489.723) [-1486.088] (-1491.598) * (-1485.164) (-1485.659) [-1489.961] (-1488.990) -- 0:00:56
650000 -- (-1486.088) (-1484.012) (-1492.875) [-1487.170] * [-1493.294] (-1493.771) (-1488.896) (-1489.269) -- 0:00:56
Average standard deviation of split frequencies: 0.000000
650500 -- [-1483.835] (-1483.382) (-1489.535) (-1492.162) * (-1488.087) (-1487.768) [-1490.753] (-1496.469) -- 0:00:56
651000 -- [-1488.085] (-1486.409) (-1493.668) (-1485.540) * (-1489.769) (-1486.373) [-1485.123] (-1493.763) -- 0:00:56
651500 -- (-1489.209) (-1486.049) (-1493.797) [-1484.948] * (-1499.924) [-1487.442] (-1484.327) (-1489.771) -- 0:00:56
652000 -- (-1496.607) [-1484.463] (-1489.132) (-1486.737) * (-1491.462) (-1486.571) (-1491.270) [-1491.922] -- 0:00:56
652500 -- (-1503.311) (-1484.643) (-1489.827) [-1488.173] * [-1489.681] (-1490.033) (-1487.407) (-1491.528) -- 0:00:56
653000 -- (-1496.322) (-1492.404) [-1489.037] (-1485.587) * (-1493.291) [-1484.901] (-1492.324) (-1485.939) -- 0:00:56
653500 -- (-1494.709) (-1490.821) (-1487.791) [-1487.932] * (-1489.151) (-1488.357) [-1486.708] (-1489.318) -- 0:00:56
654000 -- [-1485.000] (-1485.163) (-1489.018) (-1487.261) * (-1485.705) (-1491.464) (-1487.147) [-1487.180] -- 0:00:56
654500 -- (-1497.068) (-1488.481) (-1493.080) [-1491.928] * (-1494.335) (-1500.053) [-1486.365] (-1493.309) -- 0:00:55
655000 -- (-1493.864) [-1483.757] (-1488.391) (-1488.995) * [-1483.826] (-1492.188) (-1486.005) (-1489.339) -- 0:00:55
Average standard deviation of split frequencies: 0.000000
655500 -- (-1489.066) (-1493.277) [-1483.477] (-1489.682) * (-1482.997) (-1496.511) (-1488.953) [-1485.007] -- 0:00:55
656000 -- (-1487.674) (-1495.817) [-1487.525] (-1488.966) * (-1487.591) [-1485.521] (-1489.198) (-1488.026) -- 0:00:55
656500 -- (-1482.895) (-1484.638) [-1489.187] (-1486.365) * (-1488.241) (-1486.665) (-1495.318) [-1490.768] -- 0:00:55
657000 -- [-1489.572] (-1488.601) (-1490.556) (-1487.065) * [-1485.088] (-1486.021) (-1489.585) (-1485.612) -- 0:00:55
657500 -- (-1489.943) (-1484.705) (-1488.475) [-1483.258] * (-1487.654) (-1490.172) [-1491.167] (-1495.539) -- 0:00:55
658000 -- (-1496.999) (-1490.987) [-1484.651] (-1484.535) * (-1489.761) (-1497.527) [-1489.139] (-1484.809) -- 0:00:55
658500 -- (-1495.977) (-1487.338) [-1487.997] (-1484.269) * (-1489.064) (-1488.127) [-1487.068] (-1488.697) -- 0:00:55
659000 -- (-1491.205) (-1485.747) (-1492.739) [-1488.732] * (-1493.768) (-1493.114) (-1488.664) [-1490.824] -- 0:00:55
659500 -- (-1489.810) (-1490.672) (-1483.133) [-1490.828] * (-1487.517) (-1497.798) (-1489.666) [-1490.954] -- 0:00:55
660000 -- (-1485.115) [-1484.747] (-1491.276) (-1490.917) * (-1487.061) [-1492.144] (-1491.311) (-1488.137) -- 0:00:55
Average standard deviation of split frequencies: 0.000000
660500 -- (-1487.591) (-1489.569) [-1487.863] (-1490.322) * (-1490.195) (-1489.384) [-1484.038] (-1492.048) -- 0:00:54
661000 -- [-1491.842] (-1488.243) (-1501.333) (-1500.302) * (-1489.312) (-1492.863) (-1484.415) [-1488.213] -- 0:00:54
661500 -- (-1494.400) [-1484.959] (-1487.991) (-1491.628) * (-1486.167) [-1490.175] (-1485.150) (-1488.287) -- 0:00:54
662000 -- (-1491.444) (-1485.009) (-1483.956) [-1486.648] * (-1489.102) (-1490.291) (-1487.136) [-1488.141] -- 0:00:54
662500 -- (-1489.023) (-1488.609) (-1489.480) [-1490.159] * (-1486.488) [-1487.058] (-1489.104) (-1487.497) -- 0:00:55
663000 -- (-1494.972) (-1491.105) (-1489.809) [-1494.873] * (-1487.541) (-1495.784) (-1489.063) [-1484.525] -- 0:00:54
663500 -- (-1489.116) (-1488.513) (-1485.592) [-1482.871] * (-1491.150) (-1495.426) (-1484.757) [-1488.583] -- 0:00:54
664000 -- (-1491.896) (-1486.793) (-1488.447) [-1483.036] * (-1488.467) [-1489.275] (-1485.199) (-1485.337) -- 0:00:54
664500 -- [-1488.778] (-1487.837) (-1486.729) (-1485.992) * (-1492.304) (-1486.280) [-1485.097] (-1493.025) -- 0:00:54
665000 -- [-1492.253] (-1489.369) (-1490.059) (-1485.608) * (-1496.381) [-1485.536] (-1493.479) (-1489.002) -- 0:00:54
Average standard deviation of split frequencies: 0.000000
665500 -- (-1487.246) (-1485.174) [-1486.012] (-1484.616) * (-1487.829) (-1489.744) (-1484.521) [-1484.372] -- 0:00:54
666000 -- (-1484.822) (-1482.724) [-1489.850] (-1483.279) * (-1487.887) (-1488.286) [-1485.235] (-1485.456) -- 0:00:54
666500 -- (-1488.607) [-1483.220] (-1489.050) (-1484.977) * [-1489.746] (-1490.576) (-1488.768) (-1488.613) -- 0:00:54
667000 -- (-1488.102) (-1488.027) [-1488.173] (-1488.416) * (-1491.030) [-1489.853] (-1483.806) (-1489.130) -- 0:00:53
667500 -- (-1495.817) [-1490.938] (-1488.562) (-1492.203) * (-1487.537) (-1494.930) (-1486.107) [-1486.229] -- 0:00:53
668000 -- [-1484.261] (-1487.216) (-1490.431) (-1488.419) * (-1491.490) (-1489.372) [-1486.138] (-1484.815) -- 0:00:53
668500 -- [-1486.361] (-1485.466) (-1498.850) (-1486.752) * (-1495.366) [-1488.317] (-1484.030) (-1486.925) -- 0:00:54
669000 -- (-1489.493) [-1482.782] (-1486.644) (-1488.913) * (-1483.349) (-1487.030) (-1491.972) [-1489.251] -- 0:00:53
669500 -- [-1484.474] (-1490.416) (-1485.966) (-1485.370) * (-1492.102) (-1492.583) (-1488.313) [-1483.964] -- 0:00:53
670000 -- [-1487.553] (-1493.853) (-1492.307) (-1485.909) * (-1491.056) [-1485.725] (-1492.598) (-1490.073) -- 0:00:53
Average standard deviation of split frequencies: 0.000000
670500 -- (-1485.811) (-1493.805) (-1485.140) [-1484.156] * (-1489.935) [-1492.747] (-1485.689) (-1488.767) -- 0:00:53
671000 -- [-1481.402] (-1488.779) (-1491.624) (-1491.897) * (-1488.361) [-1491.627] (-1487.690) (-1490.454) -- 0:00:53
671500 -- (-1490.254) (-1486.488) (-1496.035) [-1490.428] * (-1489.250) (-1497.316) (-1489.135) [-1494.691] -- 0:00:53
672000 -- (-1491.125) (-1485.266) (-1493.257) [-1485.135] * (-1488.586) (-1490.048) [-1490.919] (-1486.593) -- 0:00:53
672500 -- (-1491.020) (-1490.551) (-1489.903) [-1485.541] * (-1491.207) (-1488.143) (-1490.702) [-1482.299] -- 0:00:53
673000 -- (-1489.636) (-1492.261) (-1489.693) [-1488.236] * (-1492.312) [-1487.442] (-1499.698) (-1487.023) -- 0:00:52
673500 -- (-1486.034) (-1488.455) [-1489.374] (-1491.418) * [-1482.824] (-1487.132) (-1492.159) (-1490.936) -- 0:00:52
674000 -- (-1490.092) (-1493.185) [-1486.232] (-1495.921) * [-1489.709] (-1488.338) (-1487.364) (-1488.399) -- 0:00:52
674500 -- (-1490.967) (-1487.639) [-1488.499] (-1490.277) * (-1491.271) [-1486.899] (-1490.778) (-1490.407) -- 0:00:53
675000 -- (-1491.431) [-1488.437] (-1484.717) (-1484.903) * (-1489.861) (-1483.420) [-1486.918] (-1488.758) -- 0:00:52
Average standard deviation of split frequencies: 0.000000
675500 -- (-1490.171) (-1488.215) [-1486.806] (-1488.282) * (-1490.079) (-1485.871) [-1486.978] (-1486.544) -- 0:00:52
676000 -- (-1495.133) (-1493.070) (-1490.406) [-1488.619] * (-1488.161) (-1485.620) (-1482.230) [-1484.116] -- 0:00:52
676500 -- (-1498.428) (-1488.624) [-1492.573] (-1492.737) * (-1482.323) [-1484.836] (-1486.226) (-1495.325) -- 0:00:52
677000 -- [-1489.062] (-1487.323) (-1490.057) (-1491.946) * (-1488.407) (-1484.096) (-1486.115) [-1492.631] -- 0:00:52
677500 -- (-1496.046) (-1498.916) (-1490.253) [-1485.409] * (-1488.086) (-1493.644) [-1490.249] (-1490.927) -- 0:00:52
678000 -- (-1487.520) [-1488.741] (-1490.245) (-1493.120) * (-1487.335) [-1482.240] (-1483.778) (-1486.948) -- 0:00:52
678500 -- (-1493.101) [-1484.046] (-1487.997) (-1484.992) * (-1486.359) [-1489.438] (-1485.319) (-1487.602) -- 0:00:52
679000 -- (-1496.848) (-1483.946) [-1488.220] (-1490.542) * (-1493.690) [-1487.826] (-1485.607) (-1486.698) -- 0:00:52
679500 -- [-1487.605] (-1485.127) (-1493.222) (-1491.387) * (-1489.535) (-1486.471) (-1491.621) [-1492.595] -- 0:00:51
680000 -- (-1491.707) [-1483.459] (-1485.546) (-1494.174) * (-1490.089) (-1498.156) [-1487.633] (-1487.180) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
680500 -- [-1491.057] (-1482.750) (-1488.481) (-1494.727) * [-1491.591] (-1489.206) (-1492.445) (-1490.895) -- 0:00:51
681000 -- (-1500.473) (-1486.084) [-1486.360] (-1489.059) * (-1489.454) (-1485.869) [-1495.689] (-1487.314) -- 0:00:51
681500 -- (-1488.399) (-1492.126) (-1488.414) [-1482.510] * (-1484.879) [-1491.741] (-1492.258) (-1494.020) -- 0:00:51
682000 -- [-1488.389] (-1489.244) (-1485.371) (-1491.764) * [-1484.814] (-1489.694) (-1493.478) (-1488.965) -- 0:00:51
682500 -- (-1487.568) (-1485.352) (-1485.487) [-1486.075] * (-1488.457) (-1487.455) [-1488.538] (-1499.688) -- 0:00:51
683000 -- (-1484.412) [-1490.549] (-1484.074) (-1489.573) * (-1491.671) [-1487.522] (-1486.517) (-1489.225) -- 0:00:51
683500 -- (-1489.353) [-1485.281] (-1486.102) (-1489.974) * [-1486.320] (-1487.161) (-1482.281) (-1500.497) -- 0:00:51
684000 -- (-1496.316) (-1486.477) (-1484.641) [-1484.961] * [-1491.898] (-1485.247) (-1485.820) (-1487.310) -- 0:00:51
684500 -- (-1491.357) (-1489.990) [-1488.458] (-1493.683) * (-1488.192) (-1493.114) (-1483.487) [-1483.097] -- 0:00:51
685000 -- (-1484.714) [-1483.924] (-1492.581) (-1488.129) * (-1489.602) (-1486.303) [-1491.579] (-1483.383) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
685500 -- (-1484.635) (-1490.536) (-1486.536) [-1487.244] * (-1482.932) (-1489.753) (-1494.626) [-1485.758] -- 0:00:50
686000 -- (-1485.836) (-1485.970) [-1486.757] (-1491.839) * (-1488.819) (-1489.079) (-1487.527) [-1487.732] -- 0:00:50
686500 -- (-1486.462) (-1488.677) (-1490.894) [-1487.197] * (-1490.936) (-1491.394) (-1495.784) [-1489.538] -- 0:00:50
687000 -- (-1483.004) [-1482.095] (-1482.754) (-1484.903) * (-1488.470) (-1485.995) (-1500.052) [-1484.786] -- 0:00:51
687500 -- (-1485.277) [-1484.134] (-1484.861) (-1491.659) * (-1489.596) (-1488.084) (-1489.243) [-1487.642] -- 0:00:50
688000 -- (-1488.891) [-1488.551] (-1487.070) (-1487.920) * (-1484.218) (-1488.421) (-1491.002) [-1486.597] -- 0:00:50
688500 -- (-1489.506) (-1493.444) [-1487.980] (-1487.113) * (-1485.172) (-1484.922) [-1493.471] (-1485.436) -- 0:00:50
689000 -- (-1487.755) (-1486.854) (-1487.296) [-1488.767] * (-1487.595) (-1485.377) [-1491.163] (-1493.490) -- 0:00:50
689500 -- (-1486.733) (-1494.284) (-1485.531) [-1488.834] * (-1490.903) [-1486.701] (-1485.987) (-1488.686) -- 0:00:50
690000 -- (-1492.214) (-1484.643) [-1486.100] (-1486.380) * (-1498.500) [-1484.104] (-1493.699) (-1493.229) -- 0:00:50
Average standard deviation of split frequencies: 0.000000
690500 -- [-1486.770] (-1485.568) (-1499.189) (-1484.679) * (-1485.763) (-1484.738) (-1490.765) [-1489.990] -- 0:00:50
691000 -- (-1485.917) (-1484.264) (-1491.413) [-1487.986] * (-1487.882) (-1485.175) (-1492.154) [-1489.129] -- 0:00:50
691500 -- [-1492.005] (-1493.447) (-1487.264) (-1486.965) * [-1488.457] (-1492.455) (-1492.524) (-1490.082) -- 0:00:49
692000 -- [-1483.251] (-1488.967) (-1488.779) (-1494.148) * (-1489.824) (-1485.296) (-1493.626) [-1482.534] -- 0:00:49
692500 -- [-1486.688] (-1488.705) (-1490.630) (-1488.630) * (-1492.161) [-1485.054] (-1488.079) (-1486.529) -- 0:00:49
693000 -- (-1487.056) [-1485.967] (-1486.082) (-1484.580) * (-1492.929) [-1486.278] (-1488.169) (-1484.516) -- 0:00:49
693500 -- [-1489.406] (-1488.528) (-1492.103) (-1494.574) * (-1488.580) (-1486.059) [-1488.622] (-1486.902) -- 0:00:49
694000 -- [-1487.445] (-1490.558) (-1495.625) (-1493.644) * [-1485.438] (-1497.648) (-1489.541) (-1487.559) -- 0:00:49
694500 -- [-1494.650] (-1485.338) (-1490.308) (-1492.937) * (-1486.695) (-1488.863) [-1486.464] (-1487.916) -- 0:00:49
695000 -- [-1488.833] (-1487.384) (-1487.405) (-1488.810) * [-1488.349] (-1486.367) (-1487.528) (-1488.919) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
695500 -- (-1492.476) (-1488.774) [-1488.251] (-1486.560) * [-1490.026] (-1488.497) (-1485.022) (-1485.264) -- 0:00:49
696000 -- [-1487.334] (-1487.430) (-1488.658) (-1486.607) * [-1491.953] (-1485.968) (-1496.411) (-1484.316) -- 0:00:49
696500 -- (-1487.344) [-1483.154] (-1489.057) (-1488.210) * (-1488.205) [-1485.842] (-1485.331) (-1492.425) -- 0:00:49
697000 -- (-1482.674) [-1489.649] (-1482.914) (-1488.113) * (-1497.581) [-1488.462] (-1486.114) (-1487.924) -- 0:00:49
697500 -- (-1486.824) (-1488.676) (-1487.290) [-1489.536] * [-1486.498] (-1490.836) (-1487.026) (-1493.890) -- 0:00:49
698000 -- [-1484.767] (-1489.919) (-1491.371) (-1488.857) * (-1489.833) (-1489.915) [-1487.590] (-1489.477) -- 0:00:48
698500 -- (-1490.869) (-1489.871) (-1493.275) [-1489.190] * [-1488.986] (-1484.722) (-1489.440) (-1490.949) -- 0:00:48
699000 -- (-1495.104) (-1495.333) [-1490.085] (-1485.060) * (-1496.250) (-1490.057) (-1487.489) [-1486.970] -- 0:00:48
699500 -- (-1491.593) [-1489.881] (-1496.281) (-1488.172) * [-1484.242] (-1488.233) (-1485.511) (-1490.386) -- 0:00:48
700000 -- (-1486.960) [-1484.027] (-1491.342) (-1489.367) * (-1486.543) (-1490.522) (-1486.413) [-1485.879] -- 0:00:48
Average standard deviation of split frequencies: 0.000000
700500 -- (-1489.611) [-1488.424] (-1487.772) (-1485.876) * (-1493.235) (-1489.065) (-1491.006) [-1488.872] -- 0:00:48
701000 -- (-1493.905) (-1494.320) (-1487.803) [-1489.188] * [-1483.061] (-1489.181) (-1481.815) (-1489.351) -- 0:00:48
701500 -- (-1489.483) (-1490.674) (-1487.337) [-1487.737] * (-1491.851) (-1489.286) [-1485.581] (-1483.520) -- 0:00:48
702000 -- (-1490.289) (-1487.557) [-1487.001] (-1494.163) * (-1494.864) (-1489.385) (-1489.702) [-1482.427] -- 0:00:48
702500 -- (-1483.439) (-1493.253) (-1489.485) [-1484.605] * (-1492.000) [-1487.386] (-1486.058) (-1485.217) -- 0:00:48
703000 -- [-1481.978] (-1489.900) (-1490.788) (-1489.295) * (-1489.881) (-1486.811) [-1483.031] (-1489.496) -- 0:00:48
703500 -- (-1489.730) (-1490.869) [-1487.790] (-1487.502) * (-1491.958) (-1489.543) (-1488.393) [-1485.003] -- 0:00:48
704000 -- [-1487.512] (-1491.271) (-1493.381) (-1489.008) * (-1496.308) (-1496.419) [-1488.415] (-1488.037) -- 0:00:47
704500 -- (-1489.833) (-1485.226) [-1489.967] (-1482.798) * (-1487.454) [-1493.177] (-1493.161) (-1486.541) -- 0:00:47
705000 -- (-1492.549) (-1494.312) (-1487.050) [-1485.146] * [-1488.908] (-1491.493) (-1495.013) (-1487.627) -- 0:00:47
Average standard deviation of split frequencies: 0.000000
705500 -- (-1481.719) (-1484.524) [-1489.240] (-1489.642) * (-1486.139) (-1501.965) (-1494.523) [-1489.697] -- 0:00:48
706000 -- (-1490.005) [-1485.346] (-1487.778) (-1492.048) * (-1489.409) (-1496.246) (-1494.711) [-1484.421] -- 0:00:47
706500 -- [-1487.313] (-1492.237) (-1483.147) (-1485.555) * (-1491.003) (-1493.443) (-1490.938) [-1485.640] -- 0:00:47
707000 -- (-1489.413) (-1483.125) [-1488.155] (-1487.843) * (-1485.569) (-1494.488) (-1488.000) [-1483.791] -- 0:00:47
707500 -- (-1486.904) (-1485.626) (-1490.589) [-1493.301] * [-1487.412] (-1498.245) (-1488.056) (-1487.173) -- 0:00:47
708000 -- (-1491.997) (-1488.072) (-1495.087) [-1484.461] * (-1484.177) [-1488.381] (-1488.297) (-1488.502) -- 0:00:47
708500 -- (-1488.042) [-1491.129] (-1490.182) (-1483.496) * (-1488.179) (-1486.232) (-1492.494) [-1486.372] -- 0:00:47
709000 -- (-1487.199) [-1485.221] (-1493.334) (-1487.387) * (-1486.769) [-1486.578] (-1492.373) (-1484.765) -- 0:00:47
709500 -- (-1492.717) [-1490.747] (-1488.819) (-1488.379) * [-1489.842] (-1486.955) (-1489.953) (-1488.260) -- 0:00:47
710000 -- [-1487.596] (-1484.398) (-1489.158) (-1485.607) * [-1491.573] (-1484.149) (-1494.935) (-1489.958) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
710500 -- (-1488.238) (-1487.391) (-1492.099) [-1492.414] * [-1485.386] (-1487.743) (-1487.654) (-1489.474) -- 0:00:46
711000 -- (-1493.670) (-1494.113) (-1488.125) [-1488.723] * (-1486.211) [-1485.773] (-1489.927) (-1492.174) -- 0:00:46
711500 -- [-1484.407] (-1495.385) (-1489.007) (-1488.233) * (-1494.020) [-1493.717] (-1493.542) (-1491.362) -- 0:00:46
712000 -- (-1484.235) (-1495.357) (-1486.178) [-1487.992] * (-1492.561) (-1493.636) (-1495.402) [-1494.099] -- 0:00:46
712500 -- (-1487.110) (-1481.403) (-1487.542) [-1484.351] * (-1485.867) [-1485.276] (-1485.795) (-1492.165) -- 0:00:46
713000 -- (-1486.837) [-1485.767] (-1488.028) (-1485.111) * (-1496.617) (-1487.627) [-1489.350] (-1483.034) -- 0:00:46
713500 -- (-1488.065) [-1488.419] (-1481.277) (-1489.492) * (-1486.514) (-1488.015) (-1486.814) [-1488.694] -- 0:00:46
714000 -- (-1486.402) (-1489.529) [-1488.099] (-1486.164) * (-1483.195) [-1484.695] (-1491.769) (-1487.611) -- 0:00:46
714500 -- (-1486.140) (-1486.586) (-1487.712) [-1486.648] * (-1486.080) [-1484.357] (-1501.870) (-1486.083) -- 0:00:46
715000 -- (-1488.522) [-1486.506] (-1485.073) (-1494.080) * (-1488.828) (-1495.354) [-1489.206] (-1492.013) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
715500 -- (-1489.761) (-1489.951) (-1485.231) [-1493.160] * [-1485.336] (-1495.627) (-1488.995) (-1485.840) -- 0:00:46
716000 -- (-1493.826) (-1487.605) (-1485.264) [-1486.566] * [-1484.314] (-1495.633) (-1485.249) (-1490.649) -- 0:00:46
716500 -- (-1489.453) (-1489.440) (-1491.048) [-1492.315] * (-1490.770) (-1484.832) (-1491.395) [-1484.614] -- 0:00:45
717000 -- (-1488.005) (-1492.037) [-1487.631] (-1494.691) * (-1493.953) (-1484.694) (-1487.575) [-1485.389] -- 0:00:45
717500 -- (-1494.223) (-1487.695) (-1486.466) [-1485.475] * (-1492.266) (-1497.940) [-1484.771] (-1488.234) -- 0:00:45
718000 -- (-1492.028) (-1490.247) [-1487.669] (-1488.834) * (-1498.411) (-1491.006) (-1487.215) [-1487.292] -- 0:00:45
718500 -- (-1493.144) [-1499.306] (-1490.943) (-1490.321) * (-1489.896) (-1493.277) (-1487.743) [-1492.996] -- 0:00:45
719000 -- (-1489.258) [-1484.687] (-1487.701) (-1491.636) * [-1485.935] (-1491.726) (-1491.061) (-1491.483) -- 0:00:45
719500 -- (-1489.397) (-1490.643) [-1488.966] (-1494.670) * (-1487.898) (-1491.324) [-1490.307] (-1491.285) -- 0:00:45
720000 -- (-1490.120) (-1484.385) [-1486.001] (-1489.265) * [-1492.566] (-1485.889) (-1486.107) (-1495.590) -- 0:00:45
Average standard deviation of split frequencies: 0.000000
720500 -- (-1491.208) (-1502.706) [-1487.468] (-1484.114) * (-1489.256) (-1488.403) [-1487.745] (-1486.373) -- 0:00:45
721000 -- (-1485.732) (-1496.286) (-1482.818) [-1483.973] * (-1490.201) [-1489.039] (-1496.996) (-1493.725) -- 0:00:45
721500 -- [-1491.860] (-1492.452) (-1491.839) (-1486.489) * [-1488.207] (-1491.005) (-1486.737) (-1485.411) -- 0:00:45
722000 -- (-1486.879) (-1493.388) (-1492.014) [-1489.233] * (-1488.415) (-1490.094) [-1488.396] (-1491.753) -- 0:00:45
722500 -- (-1487.332) [-1491.727] (-1487.219) (-1487.420) * [-1483.462] (-1495.478) (-1490.148) (-1487.331) -- 0:00:44
723000 -- (-1488.427) (-1486.824) (-1489.747) [-1485.745] * (-1490.687) (-1495.537) [-1488.215] (-1487.676) -- 0:00:44
723500 -- (-1488.628) (-1488.561) (-1486.372) [-1492.295] * [-1487.357] (-1491.325) (-1484.433) (-1491.177) -- 0:00:44
724000 -- [-1493.100] (-1485.862) (-1490.987) (-1487.033) * [-1488.678] (-1485.724) (-1492.761) (-1484.664) -- 0:00:44
724500 -- (-1489.589) (-1488.154) (-1487.275) [-1488.310] * [-1485.422] (-1486.236) (-1491.616) (-1495.581) -- 0:00:44
725000 -- (-1484.585) [-1489.628] (-1488.438) (-1485.789) * (-1481.366) [-1486.188] (-1495.872) (-1487.044) -- 0:00:44
Average standard deviation of split frequencies: 0.000000
725500 -- (-1489.724) [-1488.861] (-1486.277) (-1493.391) * (-1485.806) [-1483.220] (-1497.696) (-1484.547) -- 0:00:44
726000 -- (-1493.222) (-1487.280) [-1489.549] (-1488.931) * (-1490.368) [-1486.786] (-1486.966) (-1486.265) -- 0:00:44
726500 -- [-1485.048] (-1488.117) (-1489.367) (-1489.839) * (-1492.947) (-1494.631) [-1486.788] (-1485.971) -- 0:00:44
727000 -- (-1490.761) (-1482.640) [-1487.046] (-1484.607) * (-1499.880) (-1489.335) (-1490.337) [-1485.909] -- 0:00:44
727500 -- (-1485.918) (-1493.038) [-1487.929] (-1488.828) * (-1488.346) (-1489.237) [-1487.163] (-1490.583) -- 0:00:44
728000 -- (-1496.488) (-1487.900) (-1488.853) [-1493.244] * [-1486.196] (-1491.592) (-1486.821) (-1490.355) -- 0:00:44
728500 -- (-1488.270) (-1500.228) [-1486.086] (-1493.171) * (-1498.000) (-1487.202) [-1490.705] (-1489.887) -- 0:00:43
729000 -- (-1497.815) (-1493.320) (-1487.527) [-1489.334] * (-1493.583) (-1489.074) (-1486.952) [-1491.515] -- 0:00:43
729500 -- (-1493.442) (-1492.371) [-1486.120] (-1488.949) * (-1496.640) (-1487.267) (-1488.530) [-1486.339] -- 0:00:43
730000 -- (-1488.939) (-1484.827) (-1487.940) [-1490.521] * (-1493.731) [-1486.110] (-1487.343) (-1490.839) -- 0:00:43
Average standard deviation of split frequencies: 0.000000
730500 -- (-1487.982) (-1490.326) (-1492.793) [-1488.085] * (-1492.069) (-1487.478) [-1486.683] (-1491.765) -- 0:00:43
731000 -- (-1488.971) [-1484.495] (-1492.667) (-1485.808) * [-1495.558] (-1486.477) (-1487.628) (-1485.988) -- 0:00:43
731500 -- (-1487.640) (-1487.882) (-1497.737) [-1489.373] * [-1485.507] (-1492.022) (-1483.265) (-1500.391) -- 0:00:43
732000 -- (-1483.330) [-1485.706] (-1493.363) (-1489.879) * (-1484.230) [-1490.874] (-1484.522) (-1489.024) -- 0:00:43
732500 -- (-1490.682) [-1484.548] (-1493.110) (-1493.286) * (-1490.307) (-1486.152) [-1488.763] (-1489.128) -- 0:00:43
733000 -- (-1486.366) [-1485.927] (-1488.246) (-1489.003) * (-1489.415) [-1484.595] (-1491.050) (-1485.934) -- 0:00:43
733500 -- [-1488.070] (-1490.472) (-1484.290) (-1484.313) * [-1487.351] (-1487.515) (-1484.812) (-1495.593) -- 0:00:43
734000 -- (-1487.161) (-1492.668) [-1486.446] (-1487.647) * (-1490.991) (-1484.364) [-1484.926] (-1492.072) -- 0:00:43
734500 -- (-1486.759) (-1494.170) (-1485.389) [-1486.862] * (-1492.865) [-1492.324] (-1486.751) (-1493.499) -- 0:00:43
735000 -- (-1488.095) (-1488.396) (-1484.012) [-1485.321] * [-1486.464] (-1488.309) (-1492.839) (-1494.922) -- 0:00:42
Average standard deviation of split frequencies: 0.000000
735500 -- (-1488.612) [-1488.093] (-1485.950) (-1490.975) * (-1487.860) [-1485.261] (-1489.522) (-1488.482) -- 0:00:42
736000 -- [-1484.681] (-1492.497) (-1489.318) (-1486.644) * [-1485.451] (-1490.871) (-1487.925) (-1488.580) -- 0:00:42
736500 -- (-1487.262) (-1484.801) (-1492.044) [-1486.657] * (-1487.061) [-1484.016] (-1488.484) (-1485.475) -- 0:00:42
737000 -- (-1491.282) (-1492.117) (-1495.503) [-1484.339] * (-1491.116) (-1493.997) [-1486.555] (-1485.304) -- 0:00:42
737500 -- (-1488.209) (-1485.422) [-1486.730] (-1491.031) * (-1493.657) (-1500.513) [-1487.662] (-1484.348) -- 0:00:42
738000 -- (-1486.070) (-1493.963) [-1486.444] (-1494.665) * (-1487.863) (-1485.247) (-1483.811) [-1488.471] -- 0:00:42
738500 -- [-1484.276] (-1488.285) (-1486.512) (-1495.057) * (-1483.237) [-1486.778] (-1483.683) (-1490.080) -- 0:00:42
739000 -- (-1492.429) (-1486.482) [-1484.373] (-1494.716) * (-1492.020) [-1486.015] (-1488.581) (-1490.685) -- 0:00:42
739500 -- (-1494.606) [-1484.944] (-1489.528) (-1496.303) * (-1490.039) (-1490.512) [-1492.594] (-1482.662) -- 0:00:42
740000 -- (-1486.965) [-1491.036] (-1491.361) (-1495.667) * [-1486.697] (-1486.122) (-1492.730) (-1485.992) -- 0:00:42
Average standard deviation of split frequencies: 0.000000
740500 -- (-1489.003) (-1482.456) [-1489.914] (-1498.234) * [-1483.569] (-1489.924) (-1486.641) (-1484.617) -- 0:00:42
741000 -- (-1492.902) (-1486.249) [-1488.058] (-1489.376) * (-1486.843) (-1483.877) [-1486.853] (-1488.937) -- 0:00:41
741500 -- (-1490.865) (-1487.920) [-1493.315] (-1491.060) * (-1486.685) (-1487.245) [-1490.483] (-1488.670) -- 0:00:41
742000 -- (-1493.895) [-1486.083] (-1484.413) (-1490.541) * (-1488.306) (-1498.220) [-1487.853] (-1484.479) -- 0:00:41
742500 -- (-1492.169) [-1493.164] (-1488.399) (-1493.049) * [-1486.667] (-1490.997) (-1500.181) (-1493.953) -- 0:00:41
743000 -- (-1489.584) (-1488.469) [-1495.108] (-1495.018) * [-1490.685] (-1492.627) (-1498.110) (-1498.628) -- 0:00:41
743500 -- (-1488.029) (-1488.721) (-1489.826) [-1487.593] * (-1492.425) (-1485.808) (-1492.443) [-1487.290] -- 0:00:41
744000 -- (-1488.112) [-1491.604] (-1488.346) (-1490.952) * (-1490.768) (-1492.980) [-1483.682] (-1483.953) -- 0:00:41
744500 -- (-1493.133) [-1489.062] (-1495.737) (-1489.663) * [-1487.727] (-1493.735) (-1488.658) (-1485.187) -- 0:00:41
745000 -- (-1488.435) (-1484.856) [-1494.258] (-1486.049) * (-1488.345) (-1487.705) (-1495.949) [-1487.885] -- 0:00:41
Average standard deviation of split frequencies: 0.000000
745500 -- (-1492.873) [-1484.284] (-1488.253) (-1488.074) * [-1488.377] (-1492.023) (-1490.576) (-1487.176) -- 0:00:41
746000 -- (-1497.576) (-1487.553) (-1491.408) [-1486.690] * (-1486.847) (-1493.950) (-1488.144) [-1487.299] -- 0:00:41
746500 -- (-1490.134) (-1484.416) [-1490.554] (-1486.580) * (-1488.679) (-1484.092) [-1486.272] (-1488.414) -- 0:00:41
747000 -- [-1487.107] (-1483.263) (-1490.096) (-1498.398) * (-1482.077) (-1489.104) (-1485.332) [-1484.177] -- 0:00:40
747500 -- (-1488.844) (-1489.973) (-1487.234) [-1484.520] * (-1490.060) (-1485.750) (-1484.098) [-1486.912] -- 0:00:40
748000 -- (-1488.382) [-1491.718] (-1490.010) (-1484.413) * [-1488.418] (-1486.721) (-1486.143) (-1485.130) -- 0:00:40
748500 -- (-1489.252) [-1492.656] (-1495.259) (-1489.097) * [-1487.283] (-1487.305) (-1497.966) (-1491.062) -- 0:00:40
749000 -- [-1487.796] (-1491.000) (-1492.035) (-1485.693) * (-1500.220) (-1486.971) (-1484.327) [-1488.695] -- 0:00:40
749500 -- (-1489.656) (-1485.847) (-1494.278) [-1484.955] * (-1484.461) [-1482.886] (-1486.792) (-1487.863) -- 0:00:40
750000 -- (-1487.420) (-1486.088) (-1486.277) [-1491.545] * [-1490.452] (-1489.699) (-1484.682) (-1483.743) -- 0:00:40
Average standard deviation of split frequencies: 0.000000
750500 -- [-1486.710] (-1485.846) (-1482.971) (-1488.596) * [-1486.120] (-1496.073) (-1490.951) (-1489.959) -- 0:00:40
751000 -- (-1486.940) (-1487.505) [-1486.323] (-1487.602) * [-1483.529] (-1491.386) (-1486.203) (-1487.936) -- 0:00:40
751500 -- (-1487.012) (-1494.865) (-1487.181) [-1487.181] * [-1487.669] (-1492.497) (-1485.646) (-1485.254) -- 0:00:40
752000 -- (-1490.604) (-1487.894) [-1486.500] (-1495.677) * (-1492.712) (-1490.840) [-1490.846] (-1490.150) -- 0:00:40
752500 -- (-1491.046) (-1492.513) [-1485.758] (-1488.684) * (-1489.696) (-1487.006) (-1486.188) [-1488.242] -- 0:00:40
753000 -- [-1486.262] (-1492.337) (-1483.059) (-1487.854) * [-1489.500] (-1484.154) (-1492.844) (-1492.176) -- 0:00:40
753500 -- [-1487.029] (-1490.156) (-1483.714) (-1487.559) * (-1494.264) (-1487.736) [-1484.751] (-1488.153) -- 0:00:39
754000 -- (-1487.131) (-1492.475) (-1489.858) [-1488.794] * (-1496.348) (-1484.869) [-1485.602] (-1490.013) -- 0:00:39
754500 -- (-1486.315) (-1491.949) [-1484.738] (-1485.862) * [-1483.297] (-1489.660) (-1499.100) (-1491.091) -- 0:00:40
755000 -- (-1496.949) [-1487.174] (-1486.570) (-1492.432) * (-1489.531) (-1486.492) (-1492.877) [-1487.774] -- 0:00:39
Average standard deviation of split frequencies: 0.000000
755500 -- (-1491.360) (-1488.915) (-1487.593) [-1489.639] * [-1488.442] (-1488.588) (-1487.770) (-1488.364) -- 0:00:39
756000 -- [-1487.813] (-1487.070) (-1493.387) (-1489.755) * (-1486.749) [-1496.819] (-1485.140) (-1488.420) -- 0:00:39
756500 -- (-1485.269) (-1490.559) [-1490.618] (-1489.249) * (-1484.978) [-1489.037] (-1488.459) (-1490.059) -- 0:00:39
757000 -- (-1483.295) [-1490.185] (-1494.343) (-1488.789) * [-1484.976] (-1491.528) (-1490.146) (-1491.260) -- 0:00:39
757500 -- (-1484.828) (-1487.402) [-1490.843] (-1488.559) * (-1489.033) (-1485.922) (-1490.718) [-1489.811] -- 0:00:39
758000 -- [-1485.558] (-1492.807) (-1491.452) (-1483.337) * (-1491.124) [-1483.210] (-1484.660) (-1488.671) -- 0:00:39
758500 -- (-1491.805) (-1493.259) [-1494.726] (-1485.057) * (-1490.690) (-1487.340) (-1488.501) [-1488.945] -- 0:00:39
759000 -- (-1491.051) [-1485.554] (-1489.966) (-1488.814) * (-1488.356) [-1487.951] (-1487.183) (-1486.862) -- 0:00:39
759500 -- (-1496.271) [-1485.253] (-1500.871) (-1491.906) * [-1486.829] (-1488.499) (-1483.071) (-1490.108) -- 0:00:38
760000 -- (-1489.096) [-1497.548] (-1496.994) (-1481.228) * (-1491.929) [-1492.284] (-1484.833) (-1484.629) -- 0:00:38
Average standard deviation of split frequencies: 0.000000
760500 -- (-1492.161) (-1493.426) (-1491.278) [-1486.942] * [-1491.410] (-1491.343) (-1487.700) (-1488.960) -- 0:00:39
761000 -- (-1490.437) (-1494.764) [-1486.416] (-1486.157) * (-1497.240) [-1488.820] (-1488.592) (-1498.975) -- 0:00:38
761500 -- (-1487.765) (-1491.129) (-1489.000) [-1485.704] * (-1491.469) [-1486.276] (-1488.727) (-1498.193) -- 0:00:38
762000 -- (-1486.185) (-1487.233) (-1491.007) [-1488.408] * (-1487.769) (-1494.134) [-1486.459] (-1499.793) -- 0:00:38
762500 -- (-1490.166) (-1489.070) (-1485.533) [-1492.712] * (-1489.971) [-1490.308] (-1487.682) (-1492.843) -- 0:00:38
763000 -- [-1491.231] (-1485.697) (-1483.243) (-1490.702) * (-1489.469) (-1485.691) [-1489.349] (-1488.914) -- 0:00:38
763500 -- (-1490.711) (-1485.499) [-1481.286] (-1491.216) * [-1485.176] (-1484.995) (-1488.391) (-1490.863) -- 0:00:38
764000 -- (-1486.964) [-1487.683] (-1488.121) (-1491.896) * (-1488.605) [-1486.431] (-1485.813) (-1487.890) -- 0:00:38
764500 -- [-1489.936] (-1501.608) (-1491.094) (-1490.636) * (-1490.329) [-1490.003] (-1490.467) (-1494.171) -- 0:00:38
765000 -- (-1491.375) [-1487.816] (-1488.592) (-1486.222) * (-1494.512) (-1485.201) (-1495.361) [-1484.989] -- 0:00:38
Average standard deviation of split frequencies: 0.000000
765500 -- (-1486.717) (-1491.437) [-1484.991] (-1485.373) * (-1486.909) (-1486.384) (-1489.264) [-1486.782] -- 0:00:37
766000 -- (-1484.376) (-1487.438) (-1489.594) [-1486.086] * (-1491.791) (-1483.936) [-1485.838] (-1489.385) -- 0:00:38
766500 -- (-1487.970) [-1487.020] (-1486.440) (-1484.954) * (-1488.415) [-1495.379] (-1484.646) (-1484.330) -- 0:00:38
767000 -- (-1489.369) [-1485.487] (-1488.563) (-1488.586) * (-1489.702) (-1485.853) (-1488.614) [-1487.824] -- 0:00:37
767500 -- [-1492.186] (-1485.424) (-1491.067) (-1489.773) * [-1489.517] (-1488.184) (-1492.803) (-1491.568) -- 0:00:37
768000 -- (-1493.828) (-1487.548) (-1485.696) [-1485.380] * (-1490.582) [-1488.552] (-1489.247) (-1491.387) -- 0:00:37
768500 -- (-1490.783) [-1485.755] (-1484.509) (-1487.678) * (-1490.185) (-1486.029) (-1488.911) [-1493.523] -- 0:00:37
769000 -- (-1487.560) (-1489.938) [-1489.106] (-1486.964) * (-1493.732) [-1489.023] (-1486.921) (-1492.715) -- 0:00:37
769500 -- [-1483.677] (-1486.584) (-1489.549) (-1490.013) * (-1489.327) [-1483.395] (-1486.355) (-1485.735) -- 0:00:37
770000 -- (-1490.543) (-1492.143) (-1485.413) [-1486.923] * (-1487.960) (-1486.191) (-1483.324) [-1484.306] -- 0:00:37
Average standard deviation of split frequencies: 0.000000
770500 -- (-1482.346) (-1487.440) (-1488.141) [-1486.545] * (-1491.694) [-1482.910] (-1492.144) (-1492.082) -- 0:00:37
771000 -- [-1487.082] (-1484.612) (-1489.308) (-1499.633) * (-1493.633) [-1485.693] (-1486.699) (-1483.972) -- 0:00:37
771500 -- (-1485.133) (-1491.303) [-1490.343] (-1501.581) * (-1493.735) (-1486.578) [-1483.461] (-1487.974) -- 0:00:37
772000 -- (-1484.709) (-1490.337) [-1483.337] (-1502.689) * (-1487.133) [-1482.955] (-1485.712) (-1492.948) -- 0:00:37
772500 -- [-1485.622] (-1489.080) (-1490.470) (-1493.797) * (-1488.633) (-1494.359) (-1486.908) [-1486.567] -- 0:00:37
773000 -- [-1487.751] (-1487.872) (-1490.714) (-1489.955) * (-1486.025) [-1488.346] (-1488.837) (-1490.767) -- 0:00:37
773500 -- (-1491.586) (-1489.395) [-1488.346] (-1493.253) * (-1485.779) (-1486.126) (-1487.606) [-1496.826] -- 0:00:36
774000 -- (-1491.688) [-1485.520] (-1487.285) (-1489.105) * (-1486.286) [-1490.282] (-1494.429) (-1489.036) -- 0:00:36
774500 -- [-1484.008] (-1492.129) (-1488.635) (-1487.741) * [-1488.624] (-1487.833) (-1495.529) (-1489.799) -- 0:00:36
775000 -- [-1485.364] (-1484.205) (-1485.699) (-1483.715) * (-1491.135) [-1484.429] (-1485.851) (-1484.428) -- 0:00:36
Average standard deviation of split frequencies: 0.000000
775500 -- (-1492.954) (-1493.279) [-1487.149] (-1486.727) * (-1491.127) (-1491.879) (-1491.050) [-1489.088] -- 0:00:36
776000 -- (-1489.126) [-1486.705] (-1486.702) (-1489.150) * (-1490.528) (-1488.696) [-1490.497] (-1485.743) -- 0:00:36
776500 -- (-1497.717) (-1486.842) (-1490.282) [-1485.202] * (-1487.042) [-1486.707] (-1483.396) (-1496.136) -- 0:00:36
777000 -- (-1492.480) (-1487.532) (-1488.154) [-1486.473] * (-1485.840) (-1490.348) (-1490.585) [-1487.645] -- 0:00:36
777500 -- (-1487.516) [-1483.703] (-1485.620) (-1488.579) * (-1485.681) (-1491.549) (-1485.211) [-1483.360] -- 0:00:36
778000 -- (-1489.786) [-1488.680] (-1486.053) (-1492.220) * (-1486.257) [-1484.511] (-1484.259) (-1488.276) -- 0:00:36
778500 -- (-1492.644) [-1488.000] (-1487.792) (-1486.603) * (-1489.032) (-1487.912) [-1484.234] (-1489.995) -- 0:00:36
779000 -- [-1491.422] (-1484.665) (-1488.987) (-1486.712) * [-1483.891] (-1488.152) (-1491.363) (-1489.809) -- 0:00:36
779500 -- (-1492.045) [-1487.220] (-1493.079) (-1486.221) * [-1487.073] (-1492.139) (-1488.823) (-1490.763) -- 0:00:35
780000 -- (-1492.974) (-1485.446) [-1485.123] (-1488.819) * [-1485.632] (-1492.716) (-1486.999) (-1489.054) -- 0:00:35
Average standard deviation of split frequencies: 0.000000
780500 -- (-1488.088) [-1491.877] (-1489.254) (-1488.163) * (-1483.792) [-1490.698] (-1484.210) (-1486.185) -- 0:00:35
781000 -- (-1487.399) [-1485.491] (-1489.923) (-1486.986) * (-1485.795) (-1489.546) [-1485.171] (-1488.049) -- 0:00:35
781500 -- (-1487.639) (-1486.972) [-1485.655] (-1488.067) * [-1485.793] (-1487.159) (-1491.691) (-1490.363) -- 0:00:35
782000 -- (-1490.063) (-1487.739) (-1490.161) [-1486.124] * (-1486.673) (-1490.971) (-1489.184) [-1490.803] -- 0:00:35
782500 -- (-1487.571) (-1487.602) [-1487.413] (-1488.558) * (-1502.292) (-1498.491) (-1487.526) [-1484.110] -- 0:00:35
783000 -- (-1493.049) [-1484.450] (-1490.372) (-1491.588) * (-1490.595) [-1487.706] (-1482.939) (-1486.968) -- 0:00:35
783500 -- (-1490.607) [-1488.764] (-1491.203) (-1494.610) * (-1493.163) (-1489.883) (-1496.655) [-1486.377] -- 0:00:35
784000 -- (-1492.288) [-1486.289] (-1488.077) (-1489.338) * (-1487.345) (-1497.407) [-1489.840] (-1489.760) -- 0:00:35
784500 -- (-1484.341) (-1484.725) [-1483.627] (-1493.559) * (-1485.908) [-1491.815] (-1486.521) (-1486.322) -- 0:00:35
785000 -- (-1486.873) (-1489.035) (-1489.310) [-1485.973] * (-1486.836) (-1483.929) [-1485.557] (-1488.898) -- 0:00:35
Average standard deviation of split frequencies: 0.000000
785500 -- (-1487.424) (-1500.376) [-1483.511] (-1492.169) * (-1488.015) [-1491.155] (-1484.809) (-1487.416) -- 0:00:34
786000 -- (-1499.603) (-1493.953) (-1487.451) [-1486.479] * (-1489.390) [-1483.474] (-1489.309) (-1493.174) -- 0:00:34
786500 -- (-1492.284) [-1490.639] (-1486.606) (-1486.301) * (-1485.971) (-1490.103) [-1485.288] (-1489.498) -- 0:00:34
787000 -- (-1487.805) (-1485.247) (-1494.127) [-1485.890] * [-1493.740] (-1488.279) (-1490.731) (-1490.432) -- 0:00:34
787500 -- (-1490.021) [-1485.834] (-1490.856) (-1488.949) * [-1488.150] (-1492.652) (-1485.516) (-1485.979) -- 0:00:34
788000 -- [-1484.915] (-1490.240) (-1489.377) (-1486.944) * (-1486.098) [-1490.519] (-1490.638) (-1487.807) -- 0:00:34
788500 -- (-1488.863) (-1492.002) [-1495.787] (-1491.598) * (-1489.433) (-1487.204) [-1486.675] (-1488.502) -- 0:00:34
789000 -- (-1489.588) [-1484.332] (-1487.489) (-1489.560) * (-1486.958) (-1487.764) [-1487.387] (-1493.974) -- 0:00:34
789500 -- (-1489.957) (-1489.662) (-1488.116) [-1486.771] * (-1489.258) (-1488.563) (-1491.849) [-1485.871] -- 0:00:34
790000 -- (-1483.270) [-1490.257] (-1483.598) (-1488.831) * (-1491.996) (-1485.891) [-1487.465] (-1481.518) -- 0:00:34
Average standard deviation of split frequencies: 0.000000
790500 -- (-1484.700) [-1492.035] (-1485.079) (-1485.858) * (-1492.745) (-1484.646) (-1485.080) [-1482.276] -- 0:00:34
791000 -- (-1498.807) (-1486.901) [-1490.369] (-1485.849) * (-1489.508) (-1492.943) [-1487.385] (-1484.875) -- 0:00:34
791500 -- (-1493.335) [-1485.101] (-1484.256) (-1492.858) * (-1486.704) (-1491.091) (-1485.083) [-1485.783] -- 0:00:33
792000 -- (-1492.293) [-1485.004] (-1486.669) (-1492.972) * (-1490.035) (-1485.526) (-1484.897) [-1486.009] -- 0:00:33
792500 -- [-1489.387] (-1489.423) (-1484.930) (-1484.598) * (-1486.750) (-1487.315) (-1486.427) [-1489.861] -- 0:00:33
793000 -- (-1495.732) (-1493.092) [-1483.304] (-1487.848) * (-1482.374) (-1491.513) (-1487.029) [-1488.106] -- 0:00:33
793500 -- (-1489.204) (-1496.364) [-1488.078] (-1484.933) * (-1491.180) (-1491.000) (-1494.514) [-1491.992] -- 0:00:33
794000 -- (-1490.401) (-1493.972) [-1485.606] (-1492.654) * (-1489.071) (-1485.415) [-1490.270] (-1492.347) -- 0:00:33
794500 -- (-1487.384) (-1490.317) (-1491.987) [-1489.874] * (-1487.290) [-1489.470] (-1487.255) (-1487.119) -- 0:00:33
795000 -- (-1488.393) (-1493.953) (-1492.003) [-1486.676] * (-1484.945) (-1485.616) (-1484.160) [-1486.290] -- 0:00:33
Average standard deviation of split frequencies: 0.000000
795500 -- (-1486.791) (-1488.873) (-1483.208) [-1488.161] * (-1487.718) (-1487.723) [-1492.370] (-1488.746) -- 0:00:33
796000 -- (-1487.814) [-1487.075] (-1488.376) (-1489.415) * (-1487.683) (-1487.281) [-1483.000] (-1484.778) -- 0:00:33
796500 -- (-1493.475) (-1490.590) [-1481.964] (-1489.765) * [-1486.923] (-1488.290) (-1486.920) (-1490.295) -- 0:00:33
797000 -- (-1487.653) [-1487.757] (-1489.091) (-1487.985) * (-1487.467) (-1490.753) [-1486.726] (-1488.068) -- 0:00:33
797500 -- (-1488.758) (-1491.076) (-1491.797) [-1486.185] * [-1495.598] (-1487.096) (-1493.099) (-1493.903) -- 0:00:33
798000 -- (-1491.233) (-1491.205) [-1485.841] (-1490.734) * (-1487.543) (-1487.122) (-1495.675) [-1487.204] -- 0:00:32
798500 -- [-1497.120] (-1494.586) (-1483.142) (-1489.995) * (-1488.886) [-1489.448] (-1490.010) (-1491.481) -- 0:00:32
799000 -- [-1490.276] (-1489.086) (-1485.311) (-1493.399) * (-1491.040) (-1483.832) (-1499.550) [-1486.749] -- 0:00:32
799500 -- [-1491.126] (-1492.058) (-1487.946) (-1494.101) * (-1489.241) [-1485.978] (-1489.678) (-1490.851) -- 0:00:32
800000 -- [-1484.044] (-1488.235) (-1493.169) (-1494.871) * (-1487.681) [-1485.296] (-1483.724) (-1494.470) -- 0:00:32
Average standard deviation of split frequencies: 0.000000
800500 -- [-1487.009] (-1483.375) (-1486.548) (-1488.317) * (-1492.857) (-1486.114) [-1488.185] (-1488.422) -- 0:00:32
801000 -- (-1485.439) [-1487.879] (-1488.294) (-1487.978) * (-1487.620) [-1484.501] (-1490.408) (-1486.480) -- 0:00:32
801500 -- (-1487.942) [-1487.759] (-1483.815) (-1487.112) * [-1484.909] (-1486.477) (-1492.155) (-1489.900) -- 0:00:32
802000 -- (-1486.782) (-1488.987) (-1489.750) [-1488.306] * (-1485.079) (-1488.826) (-1497.778) [-1487.784] -- 0:00:32
802500 -- (-1485.474) (-1490.836) (-1492.494) [-1484.329] * (-1488.243) [-1485.496] (-1498.571) (-1485.357) -- 0:00:32
803000 -- (-1489.280) (-1485.231) [-1492.070] (-1490.731) * (-1487.873) [-1487.362] (-1490.997) (-1493.187) -- 0:00:32
803500 -- [-1487.900] (-1489.480) (-1488.465) (-1487.252) * (-1495.655) (-1487.499) [-1493.168] (-1490.589) -- 0:00:32
804000 -- (-1492.733) (-1487.487) [-1484.572] (-1489.568) * (-1487.824) (-1487.918) (-1485.179) [-1487.630] -- 0:00:31
804500 -- (-1488.452) [-1486.052] (-1492.615) (-1489.630) * (-1486.580) (-1490.737) (-1490.733) [-1493.035] -- 0:00:31
805000 -- (-1489.131) (-1487.875) [-1485.238] (-1490.949) * [-1485.806] (-1494.268) (-1487.726) (-1488.841) -- 0:00:31
Average standard deviation of split frequencies: 0.000000
805500 -- (-1490.432) (-1489.166) [-1488.719] (-1491.750) * (-1484.454) (-1499.427) [-1489.031] (-1492.170) -- 0:00:31
806000 -- (-1486.678) (-1488.615) [-1481.086] (-1486.721) * [-1484.272] (-1493.175) (-1487.261) (-1492.539) -- 0:00:31
806500 -- [-1489.601] (-1489.760) (-1489.980) (-1482.901) * [-1488.980] (-1491.819) (-1488.012) (-1487.572) -- 0:00:31
807000 -- [-1492.072] (-1484.656) (-1489.730) (-1493.498) * (-1484.018) (-1487.125) (-1485.665) [-1489.323] -- 0:00:31
807500 -- (-1494.219) [-1484.758] (-1488.625) (-1496.445) * (-1492.672) (-1483.434) (-1489.917) [-1487.682] -- 0:00:31
808000 -- (-1491.650) (-1489.662) [-1487.348] (-1485.906) * (-1492.320) [-1485.406] (-1490.747) (-1486.127) -- 0:00:31
808500 -- (-1488.133) (-1492.619) (-1490.245) [-1484.962] * (-1488.679) (-1495.232) (-1490.654) [-1487.092] -- 0:00:31
809000 -- (-1494.543) (-1490.335) [-1492.515] (-1490.687) * [-1489.225] (-1492.648) (-1488.246) (-1492.513) -- 0:00:31
809500 -- (-1490.686) (-1487.243) [-1484.935] (-1485.356) * (-1484.717) (-1490.308) [-1483.569] (-1490.216) -- 0:00:31
810000 -- (-1495.907) (-1493.636) [-1485.401] (-1490.312) * (-1485.057) [-1486.334] (-1486.839) (-1485.083) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
810500 -- (-1494.538) (-1494.375) [-1486.834] (-1486.112) * (-1486.426) (-1491.772) (-1487.087) [-1486.204] -- 0:00:30
811000 -- (-1496.921) [-1482.325] (-1489.392) (-1483.071) * (-1487.165) [-1491.946] (-1486.192) (-1488.628) -- 0:00:30
811500 -- (-1492.270) (-1490.751) (-1494.544) [-1489.513] * (-1489.732) [-1485.815] (-1484.665) (-1487.561) -- 0:00:30
812000 -- [-1484.853] (-1497.984) (-1492.547) (-1490.765) * (-1493.216) [-1484.257] (-1485.423) (-1489.022) -- 0:00:30
812500 -- (-1497.064) (-1496.538) (-1490.384) [-1486.044] * (-1492.185) (-1484.293) (-1489.323) [-1489.467] -- 0:00:30
813000 -- (-1499.156) [-1487.464] (-1495.731) (-1483.308) * (-1495.497) [-1485.712] (-1487.048) (-1485.710) -- 0:00:30
813500 -- (-1493.302) (-1490.536) (-1499.440) [-1485.619] * (-1485.883) [-1487.622] (-1485.326) (-1487.817) -- 0:00:30
814000 -- [-1488.762] (-1488.492) (-1490.284) (-1484.725) * [-1489.617] (-1487.705) (-1490.339) (-1488.386) -- 0:00:30
814500 -- (-1488.417) (-1494.707) [-1488.520] (-1489.975) * [-1489.069] (-1484.557) (-1484.683) (-1485.812) -- 0:00:30
815000 -- (-1485.675) (-1488.992) (-1490.820) [-1492.900] * (-1488.245) (-1500.568) [-1487.396] (-1490.609) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
815500 -- (-1487.726) [-1484.791] (-1492.158) (-1486.959) * (-1492.270) (-1493.070) [-1488.933] (-1485.949) -- 0:00:30
816000 -- (-1487.967) [-1488.323] (-1494.242) (-1490.894) * (-1488.987) (-1488.600) (-1485.295) [-1489.821] -- 0:00:29
816500 -- (-1483.086) [-1485.914] (-1493.858) (-1492.852) * (-1493.966) (-1488.948) [-1483.208] (-1487.146) -- 0:00:29
817000 -- (-1488.481) (-1487.709) [-1487.882] (-1489.139) * (-1489.850) [-1487.243] (-1488.997) (-1485.833) -- 0:00:29
817500 -- (-1485.713) (-1489.775) [-1483.274] (-1492.109) * (-1486.588) (-1491.326) (-1487.037) [-1485.945] -- 0:00:29
818000 -- (-1484.682) (-1486.972) [-1487.534] (-1487.835) * (-1489.043) (-1493.119) [-1484.119] (-1486.820) -- 0:00:29
818500 -- (-1489.646) (-1488.078) [-1484.459] (-1487.417) * [-1490.119] (-1488.044) (-1484.045) (-1485.436) -- 0:00:29
819000 -- [-1485.280] (-1496.867) (-1487.259) (-1487.146) * (-1486.839) (-1489.062) (-1483.605) [-1483.655] -- 0:00:29
819500 -- (-1489.184) (-1493.791) [-1485.242] (-1490.683) * (-1490.028) (-1485.701) (-1487.345) [-1486.368] -- 0:00:29
820000 -- [-1490.234] (-1493.472) (-1489.198) (-1490.057) * (-1487.783) [-1489.507] (-1486.816) (-1489.953) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
820500 -- (-1483.788) [-1490.548] (-1482.893) (-1488.249) * [-1491.425] (-1484.158) (-1487.761) (-1493.841) -- 0:00:29
821000 -- (-1485.115) [-1488.683] (-1490.350) (-1492.140) * (-1492.964) (-1488.240) (-1496.845) [-1487.450] -- 0:00:29
821500 -- (-1482.151) (-1489.632) (-1486.856) [-1487.381] * (-1490.948) [-1483.920] (-1489.034) (-1484.530) -- 0:00:29
822000 -- (-1486.931) (-1498.670) [-1486.847] (-1488.571) * (-1495.559) (-1485.017) [-1484.410] (-1487.877) -- 0:00:29
822500 -- [-1485.087] (-1495.822) (-1487.826) (-1486.441) * (-1490.115) (-1495.684) (-1491.227) [-1485.423] -- 0:00:28
823000 -- (-1487.394) (-1497.964) (-1488.349) [-1484.709] * (-1491.903) (-1488.918) [-1489.762] (-1488.687) -- 0:00:28
823500 -- (-1488.549) (-1486.782) (-1493.421) [-1488.889] * (-1495.992) (-1491.800) [-1484.329] (-1484.311) -- 0:00:28
824000 -- [-1485.932] (-1483.017) (-1492.733) (-1487.099) * (-1489.288) (-1490.524) [-1487.853] (-1486.512) -- 0:00:28
824500 -- (-1487.003) (-1491.106) [-1483.759] (-1487.463) * (-1487.602) (-1494.193) (-1492.865) [-1489.223] -- 0:00:28
825000 -- (-1491.120) [-1490.052] (-1486.259) (-1491.633) * (-1488.432) [-1493.840] (-1490.220) (-1488.205) -- 0:00:28
Average standard deviation of split frequencies: 0.000000
825500 -- (-1483.736) (-1497.726) [-1484.256] (-1494.763) * (-1487.860) [-1482.637] (-1490.927) (-1495.344) -- 0:00:28
826000 -- (-1487.855) [-1492.105] (-1485.755) (-1490.206) * [-1495.234] (-1488.012) (-1493.923) (-1487.019) -- 0:00:28
826500 -- (-1486.385) (-1488.259) (-1490.909) [-1487.849] * (-1496.482) [-1492.444] (-1495.917) (-1487.594) -- 0:00:28
827000 -- (-1490.185) (-1483.748) [-1486.933] (-1490.570) * [-1487.487] (-1492.705) (-1492.853) (-1497.359) -- 0:00:28
827500 -- (-1494.584) [-1484.731] (-1485.848) (-1492.666) * [-1490.724] (-1486.113) (-1486.597) (-1493.237) -- 0:00:28
828000 -- (-1492.910) [-1489.170] (-1490.083) (-1491.754) * (-1483.938) [-1487.900] (-1489.740) (-1492.292) -- 0:00:28
828500 -- (-1484.559) (-1488.717) [-1492.930] (-1491.685) * (-1483.979) [-1489.004] (-1485.338) (-1489.180) -- 0:00:27
829000 -- (-1483.875) (-1488.965) [-1486.161] (-1488.040) * (-1487.916) (-1488.791) (-1490.515) [-1486.282] -- 0:00:27
829500 -- (-1490.846) (-1489.314) [-1486.359] (-1500.207) * (-1489.222) (-1493.994) [-1491.894] (-1488.620) -- 0:00:27
830000 -- (-1490.535) [-1485.574] (-1492.108) (-1489.127) * (-1490.395) [-1484.000] (-1486.537) (-1489.518) -- 0:00:27
Average standard deviation of split frequencies: 0.000000
830500 -- (-1488.410) (-1491.644) (-1487.362) [-1491.350] * (-1489.108) [-1485.038] (-1485.379) (-1486.849) -- 0:00:27
831000 -- (-1491.533) [-1488.896] (-1486.763) (-1488.848) * (-1490.125) [-1488.834] (-1488.608) (-1492.042) -- 0:00:27
831500 -- (-1496.457) (-1492.071) (-1488.602) [-1488.286] * (-1486.820) [-1491.227] (-1491.172) (-1495.052) -- 0:00:27
832000 -- (-1484.482) [-1489.294] (-1488.436) (-1488.475) * (-1484.120) (-1485.300) [-1489.057] (-1484.641) -- 0:00:27
832500 -- (-1489.531) [-1485.582] (-1495.075) (-1490.244) * (-1489.745) [-1482.906] (-1482.416) (-1487.071) -- 0:00:27
833000 -- [-1485.690] (-1485.014) (-1487.938) (-1494.390) * (-1502.749) (-1488.484) [-1481.819] (-1484.881) -- 0:00:27
833500 -- (-1485.762) [-1485.795] (-1490.196) (-1490.138) * (-1500.217) (-1489.672) [-1482.636] (-1484.903) -- 0:00:27
834000 -- (-1493.158) (-1488.072) (-1486.660) [-1489.742] * (-1495.737) (-1485.384) [-1484.572] (-1494.836) -- 0:00:27
834500 -- (-1488.377) (-1488.005) [-1485.991] (-1488.435) * (-1489.864) (-1492.025) (-1486.013) [-1486.356] -- 0:00:26
835000 -- [-1485.762] (-1487.104) (-1486.597) (-1491.258) * (-1487.936) [-1484.377] (-1481.961) (-1486.053) -- 0:00:26
Average standard deviation of split frequencies: 0.000000
835500 -- (-1491.199) (-1488.232) [-1485.680] (-1490.038) * (-1487.889) (-1488.047) (-1487.419) [-1488.305] -- 0:00:26
836000 -- [-1485.351] (-1485.528) (-1486.607) (-1487.810) * (-1488.813) (-1484.306) [-1482.555] (-1493.351) -- 0:00:26
836500 -- [-1485.993] (-1489.102) (-1492.223) (-1486.217) * (-1490.019) (-1492.518) [-1484.600] (-1487.161) -- 0:00:26
837000 -- (-1490.009) (-1485.844) [-1487.796] (-1484.551) * (-1491.682) (-1491.245) (-1485.201) [-1484.898] -- 0:00:26
837500 -- (-1492.191) [-1485.385] (-1490.803) (-1486.095) * (-1491.725) [-1485.282] (-1484.247) (-1493.337) -- 0:00:26
838000 -- (-1486.114) (-1488.914) (-1489.419) [-1490.087] * (-1485.805) (-1485.410) [-1484.283] (-1487.731) -- 0:00:26
838500 -- (-1488.486) (-1487.141) (-1491.261) [-1486.698] * (-1494.921) [-1488.431] (-1489.059) (-1486.020) -- 0:00:26
839000 -- (-1490.916) (-1486.962) [-1487.139] (-1488.915) * (-1485.197) [-1484.817] (-1492.237) (-1488.471) -- 0:00:26
839500 -- (-1491.010) [-1487.774] (-1484.843) (-1489.187) * (-1486.179) (-1488.469) (-1490.654) [-1488.140] -- 0:00:26
840000 -- [-1489.610] (-1487.550) (-1491.107) (-1488.501) * (-1488.523) (-1495.535) (-1489.802) [-1490.179] -- 0:00:26
Average standard deviation of split frequencies: 0.000000
840500 -- (-1486.993) [-1484.803] (-1493.644) (-1490.455) * [-1487.410] (-1492.351) (-1491.813) (-1487.614) -- 0:00:25
841000 -- (-1487.022) (-1488.370) [-1485.035] (-1488.279) * (-1489.934) (-1487.521) (-1486.440) [-1484.252] -- 0:00:25
841500 -- (-1496.304) [-1484.427] (-1484.198) (-1487.583) * (-1486.461) [-1490.604] (-1490.701) (-1486.585) -- 0:00:25
842000 -- (-1488.077) [-1484.071] (-1484.950) (-1485.229) * (-1488.180) [-1487.901] (-1494.270) (-1487.217) -- 0:00:25
842500 -- [-1487.876] (-1489.420) (-1489.348) (-1490.313) * [-1487.087] (-1490.920) (-1486.192) (-1483.785) -- 0:00:25
843000 -- (-1493.443) [-1487.849] (-1487.999) (-1489.511) * (-1490.665) (-1490.374) [-1487.123] (-1487.632) -- 0:00:25
843500 -- (-1495.205) (-1486.170) (-1493.138) [-1486.515] * (-1486.477) (-1498.012) (-1490.697) [-1484.541] -- 0:00:25
844000 -- (-1486.047) (-1487.250) [-1487.132] (-1495.011) * (-1491.001) [-1484.906] (-1493.071) (-1488.050) -- 0:00:25
844500 -- [-1484.125] (-1485.147) (-1498.520) (-1486.346) * (-1483.956) [-1487.160] (-1486.887) (-1493.563) -- 0:00:25
845000 -- [-1487.750] (-1492.232) (-1491.783) (-1485.985) * (-1488.518) (-1486.841) (-1489.488) [-1492.946] -- 0:00:25
Average standard deviation of split frequencies: 0.000000
845500 -- (-1483.809) (-1497.288) [-1490.067] (-1490.522) * [-1486.720] (-1486.281) (-1487.266) (-1494.239) -- 0:00:25
846000 -- [-1490.599] (-1503.799) (-1495.365) (-1491.844) * (-1490.699) [-1489.144] (-1486.370) (-1487.876) -- 0:00:25
846500 -- [-1490.496] (-1485.734) (-1488.759) (-1488.785) * [-1484.991] (-1487.229) (-1488.319) (-1490.401) -- 0:00:25
847000 -- (-1488.471) [-1483.248] (-1488.036) (-1496.588) * (-1490.664) (-1491.807) [-1485.448] (-1489.354) -- 0:00:24
847500 -- (-1488.672) (-1488.790) (-1481.494) [-1491.435] * (-1488.146) (-1493.987) (-1493.494) [-1488.118] -- 0:00:24
848000 -- (-1483.586) [-1481.990] (-1485.386) (-1489.546) * (-1484.856) [-1487.874] (-1485.670) (-1499.868) -- 0:00:24
848500 -- [-1489.292] (-1490.721) (-1483.581) (-1491.299) * (-1485.109) [-1487.842] (-1488.808) (-1489.095) -- 0:00:24
849000 -- (-1488.180) (-1490.923) [-1487.770] (-1492.690) * (-1485.174) [-1490.185] (-1497.215) (-1485.513) -- 0:00:24
849500 -- (-1489.515) (-1486.413) [-1486.179] (-1485.936) * [-1485.920] (-1494.065) (-1486.609) (-1490.374) -- 0:00:24
850000 -- (-1487.561) (-1486.994) [-1489.553] (-1486.134) * (-1492.839) [-1495.391] (-1492.212) (-1488.812) -- 0:00:24
Average standard deviation of split frequencies: 0.000000
850500 -- (-1487.945) (-1485.623) [-1487.405] (-1488.850) * (-1487.652) (-1489.756) [-1491.730] (-1485.269) -- 0:00:24
851000 -- (-1489.514) [-1488.855] (-1487.764) (-1487.765) * (-1490.015) (-1486.316) (-1492.725) [-1487.330] -- 0:00:24
851500 -- [-1484.865] (-1488.161) (-1491.560) (-1489.880) * (-1488.091) (-1486.434) (-1491.537) [-1484.567] -- 0:00:24
852000 -- (-1491.133) (-1488.150) [-1485.966] (-1490.757) * [-1481.660] (-1487.284) (-1488.550) (-1489.259) -- 0:00:24
852500 -- (-1493.049) (-1485.530) (-1491.202) [-1490.486] * [-1487.092] (-1489.010) (-1493.686) (-1489.140) -- 0:00:24
853000 -- [-1487.991] (-1489.370) (-1498.647) (-1486.672) * [-1485.920] (-1493.290) (-1492.374) (-1487.378) -- 0:00:23
853500 -- (-1485.266) [-1489.704] (-1489.129) (-1492.932) * (-1498.749) (-1493.800) [-1490.137] (-1485.422) -- 0:00:23
854000 -- [-1489.250] (-1485.667) (-1483.430) (-1499.683) * (-1487.607) (-1494.329) [-1487.893] (-1490.711) -- 0:00:23
854500 -- (-1488.642) (-1484.546) (-1486.681) [-1491.688] * [-1488.415] (-1497.338) (-1484.117) (-1492.380) -- 0:00:23
855000 -- (-1489.553) [-1488.305] (-1490.293) (-1488.229) * (-1491.077) (-1494.947) (-1486.554) [-1489.366] -- 0:00:23
Average standard deviation of split frequencies: 0.000000
855500 -- (-1496.854) [-1484.591] (-1489.243) (-1488.650) * (-1488.617) [-1488.067] (-1488.078) (-1487.060) -- 0:00:23
856000 -- (-1487.607) (-1488.254) (-1495.731) [-1490.820] * (-1486.411) (-1491.899) (-1490.436) [-1485.481] -- 0:00:23
856500 -- (-1486.069) [-1482.343] (-1499.892) (-1489.617) * [-1486.392] (-1489.040) (-1494.568) (-1488.677) -- 0:00:23
857000 -- (-1483.673) [-1487.933] (-1491.322) (-1487.349) * [-1485.134] (-1488.172) (-1487.553) (-1485.363) -- 0:00:23
857500 -- (-1490.350) (-1489.791) (-1488.248) [-1487.978] * (-1489.071) (-1491.572) (-1489.377) [-1481.977] -- 0:00:23
858000 -- (-1491.495) (-1489.416) (-1487.035) [-1486.731] * (-1496.074) (-1493.102) (-1491.286) [-1493.366] -- 0:00:23
858500 -- (-1497.062) [-1485.676] (-1486.194) (-1488.173) * (-1494.896) [-1486.732] (-1488.618) (-1493.843) -- 0:00:23
859000 -- (-1493.236) (-1489.830) (-1482.871) [-1489.313] * (-1487.665) (-1488.506) [-1491.008] (-1488.286) -- 0:00:22
859500 -- (-1489.856) (-1484.784) (-1484.200) [-1487.908] * (-1488.672) (-1494.222) [-1486.798] (-1483.164) -- 0:00:22
860000 -- (-1489.103) [-1484.860] (-1488.650) (-1492.923) * (-1490.504) [-1487.920] (-1494.028) (-1490.847) -- 0:00:22
Average standard deviation of split frequencies: 0.000000
860500 -- (-1485.498) [-1491.926] (-1491.906) (-1489.567) * [-1484.515] (-1485.341) (-1489.835) (-1491.771) -- 0:00:22
861000 -- (-1492.638) [-1488.709] (-1490.825) (-1495.610) * (-1486.786) [-1484.966] (-1487.742) (-1488.481) -- 0:00:22
861500 -- [-1487.280] (-1489.307) (-1487.116) (-1493.001) * (-1487.669) [-1487.628] (-1488.981) (-1485.454) -- 0:00:22
862000 -- (-1481.572) (-1491.884) (-1484.031) [-1486.670] * (-1491.056) (-1484.602) (-1490.645) [-1486.975] -- 0:00:22
862500 -- (-1483.439) (-1491.377) (-1488.024) [-1488.606] * (-1488.917) (-1487.368) (-1491.549) [-1483.515] -- 0:00:22
863000 -- (-1489.401) (-1484.005) (-1486.768) [-1487.061] * (-1489.157) [-1488.062] (-1493.963) (-1489.912) -- 0:00:22
863500 -- (-1484.670) (-1482.075) [-1486.379] (-1487.704) * (-1489.480) (-1485.529) (-1490.215) [-1483.927] -- 0:00:22
864000 -- (-1488.828) (-1482.583) [-1486.531] (-1488.115) * (-1488.143) (-1485.547) [-1487.899] (-1484.593) -- 0:00:22
864500 -- (-1491.592) [-1486.027] (-1495.324) (-1494.415) * [-1487.313] (-1490.425) (-1491.442) (-1484.727) -- 0:00:22
865000 -- [-1481.853] (-1486.530) (-1491.794) (-1499.174) * (-1484.107) [-1491.036] (-1487.975) (-1489.532) -- 0:00:22
Average standard deviation of split frequencies: 0.000000
865500 -- (-1485.531) (-1491.815) [-1490.426] (-1490.223) * [-1485.911] (-1488.246) (-1485.010) (-1489.286) -- 0:00:21
866000 -- (-1501.385) (-1493.698) (-1500.319) [-1487.783] * (-1487.581) (-1486.356) (-1494.801) [-1490.087] -- 0:00:21
866500 -- (-1491.950) (-1492.060) [-1490.679] (-1494.871) * (-1488.616) (-1487.684) [-1489.781] (-1489.171) -- 0:00:21
867000 -- [-1487.156] (-1501.863) (-1501.193) (-1493.268) * (-1485.559) (-1485.449) (-1490.718) [-1489.339] -- 0:00:21
867500 -- (-1491.919) (-1492.484) (-1494.726) [-1485.386] * [-1485.901] (-1491.005) (-1489.666) (-1491.942) -- 0:00:21
868000 -- [-1483.929] (-1488.248) (-1496.645) (-1482.812) * (-1485.993) (-1489.556) [-1487.326] (-1493.525) -- 0:00:21
868500 -- [-1486.398] (-1491.726) (-1495.870) (-1487.262) * (-1486.891) (-1486.789) [-1488.413] (-1492.734) -- 0:00:21
869000 -- (-1492.639) (-1494.181) (-1495.891) [-1483.491] * (-1485.798) [-1486.202] (-1483.974) (-1491.791) -- 0:00:21
869500 -- [-1487.468] (-1485.278) (-1488.308) (-1484.024) * (-1501.919) [-1487.588] (-1489.668) (-1487.171) -- 0:00:21
870000 -- [-1489.944] (-1485.377) (-1490.269) (-1489.823) * (-1494.751) [-1485.100] (-1493.659) (-1487.968) -- 0:00:21
Average standard deviation of split frequencies: 0.000000
870500 -- (-1491.413) (-1497.545) [-1486.089] (-1491.491) * (-1493.650) (-1488.823) (-1486.649) [-1488.635] -- 0:00:21
871000 -- (-1491.829) [-1487.686] (-1490.932) (-1493.815) * (-1489.498) (-1489.449) (-1491.186) [-1488.462] -- 0:00:21
871500 -- (-1486.921) (-1488.900) (-1492.961) [-1492.768] * (-1490.229) (-1490.979) (-1485.436) [-1487.496] -- 0:00:20
872000 -- (-1491.777) (-1486.224) (-1494.358) [-1487.703] * [-1490.207] (-1485.687) (-1490.833) (-1490.548) -- 0:00:20
872500 -- (-1488.713) [-1490.226] (-1490.454) (-1487.183) * (-1493.844) (-1485.806) (-1487.886) [-1489.145] -- 0:00:20
873000 -- (-1491.561) [-1487.925] (-1496.256) (-1488.787) * (-1488.523) [-1490.236] (-1487.024) (-1497.224) -- 0:00:20
873500 -- (-1488.987) (-1485.386) (-1489.893) [-1486.752] * (-1491.485) [-1482.273] (-1489.976) (-1488.016) -- 0:00:20
874000 -- (-1486.473) (-1491.771) (-1488.687) [-1489.595] * (-1487.070) [-1487.571] (-1487.140) (-1491.931) -- 0:00:20
874500 -- (-1490.885) (-1487.596) (-1491.250) [-1485.895] * (-1483.411) (-1487.999) (-1486.822) [-1490.521] -- 0:00:20
875000 -- [-1495.021] (-1484.273) (-1490.037) (-1488.355) * (-1491.102) [-1485.421] (-1487.634) (-1492.483) -- 0:00:20
Average standard deviation of split frequencies: 0.000000
875500 -- (-1487.392) [-1493.044] (-1490.116) (-1487.767) * (-1484.270) [-1489.250] (-1486.883) (-1483.915) -- 0:00:20
876000 -- [-1485.478] (-1492.904) (-1486.406) (-1494.513) * (-1491.262) (-1486.186) [-1484.838] (-1490.378) -- 0:00:20
876500 -- (-1490.411) [-1485.934] (-1484.138) (-1490.531) * (-1485.186) [-1488.134] (-1489.931) (-1488.969) -- 0:00:20
877000 -- (-1489.601) (-1483.380) [-1483.832] (-1502.276) * (-1488.139) (-1482.937) [-1485.877] (-1496.000) -- 0:00:20
877500 -- [-1487.713] (-1487.304) (-1489.915) (-1494.567) * [-1487.888] (-1485.548) (-1492.033) (-1492.891) -- 0:00:19
878000 -- (-1495.212) (-1491.617) (-1489.664) [-1488.357] * [-1488.845] (-1487.068) (-1492.268) (-1491.461) -- 0:00:20
878500 -- (-1493.909) [-1487.722] (-1492.299) (-1492.233) * (-1486.102) (-1486.030) [-1488.052] (-1493.824) -- 0:00:19
879000 -- (-1491.310) [-1488.012] (-1487.284) (-1488.333) * (-1491.564) (-1486.121) (-1490.807) [-1485.180] -- 0:00:19
879500 -- (-1493.923) (-1486.445) [-1485.460] (-1486.564) * (-1485.897) (-1484.144) (-1496.228) [-1486.984] -- 0:00:19
880000 -- (-1490.188) (-1488.081) (-1489.407) [-1487.694] * (-1481.009) (-1487.337) (-1487.567) [-1487.863] -- 0:00:19
Average standard deviation of split frequencies: 0.000000
880500 -- [-1483.435] (-1496.716) (-1489.811) (-1485.268) * (-1484.792) (-1488.034) [-1483.695] (-1486.247) -- 0:00:19
881000 -- (-1484.265) [-1486.228] (-1491.181) (-1487.459) * (-1485.343) [-1487.629] (-1494.997) (-1485.532) -- 0:00:19
881500 -- (-1487.108) [-1486.887] (-1491.696) (-1488.839) * (-1491.826) (-1491.436) (-1486.916) [-1486.824] -- 0:00:19
882000 -- (-1492.147) (-1487.270) [-1485.808] (-1487.135) * (-1488.790) [-1486.083] (-1489.181) (-1485.662) -- 0:00:19
882500 -- [-1491.812] (-1488.045) (-1486.070) (-1490.039) * (-1488.164) [-1489.654] (-1488.326) (-1497.726) -- 0:00:19
883000 -- (-1492.723) [-1486.860] (-1486.274) (-1490.302) * [-1488.427] (-1485.833) (-1489.032) (-1485.049) -- 0:00:19
883500 -- (-1489.618) (-1490.781) (-1482.745) [-1488.246] * [-1486.600] (-1490.596) (-1487.209) (-1488.073) -- 0:00:18
884000 -- (-1486.979) (-1485.773) [-1489.659] (-1488.721) * (-1485.568) (-1485.948) (-1488.714) [-1492.871] -- 0:00:19
884500 -- (-1491.242) (-1486.732) (-1488.414) [-1489.101] * (-1488.201) (-1493.697) (-1491.602) [-1488.383] -- 0:00:18
885000 -- [-1491.541] (-1491.021) (-1485.556) (-1483.793) * (-1485.445) [-1489.376] (-1497.620) (-1491.552) -- 0:00:18
Average standard deviation of split frequencies: 0.000000
885500 -- [-1485.900] (-1492.782) (-1487.657) (-1490.006) * [-1484.486] (-1490.572) (-1493.392) (-1488.375) -- 0:00:18
886000 -- (-1483.993) (-1485.976) (-1483.674) [-1486.794] * [-1485.723] (-1491.030) (-1488.668) (-1491.570) -- 0:00:18
886500 -- (-1485.984) (-1486.890) [-1489.007] (-1489.963) * [-1484.188] (-1486.874) (-1487.337) (-1493.121) -- 0:00:18
887000 -- (-1486.389) (-1499.539) (-1490.858) [-1487.317] * (-1486.709) [-1488.020] (-1487.275) (-1492.821) -- 0:00:18
887500 -- (-1492.495) (-1492.127) [-1496.864] (-1490.939) * [-1482.554] (-1485.028) (-1485.952) (-1490.884) -- 0:00:18
888000 -- (-1484.984) [-1490.068] (-1504.291) (-1485.804) * (-1484.225) (-1483.988) (-1492.305) [-1487.562] -- 0:00:18
888500 -- (-1489.072) (-1491.793) (-1492.555) [-1484.839] * [-1484.920] (-1483.363) (-1487.145) (-1486.399) -- 0:00:18
889000 -- (-1488.499) [-1486.473] (-1495.068) (-1486.011) * (-1486.755) (-1490.537) (-1485.390) [-1485.412] -- 0:00:18
889500 -- (-1494.024) (-1483.168) [-1489.331] (-1488.817) * (-1488.349) [-1487.339] (-1489.753) (-1485.499) -- 0:00:18
890000 -- (-1490.257) (-1488.163) (-1492.533) [-1483.847] * (-1486.571) [-1490.488] (-1493.409) (-1487.017) -- 0:00:18
Average standard deviation of split frequencies: 0.000000
890500 -- [-1486.923] (-1483.172) (-1499.100) (-1489.194) * [-1490.203] (-1488.820) (-1486.824) (-1484.692) -- 0:00:17
891000 -- [-1492.249] (-1488.113) (-1489.424) (-1489.730) * (-1486.754) [-1486.193] (-1491.469) (-1490.176) -- 0:00:17
891500 -- (-1483.984) (-1485.774) (-1489.423) [-1487.371] * [-1486.062] (-1491.017) (-1491.608) (-1484.678) -- 0:00:17
892000 -- [-1493.511] (-1491.198) (-1492.171) (-1486.972) * (-1490.190) (-1495.207) [-1484.752] (-1486.985) -- 0:00:17
892500 -- (-1486.840) (-1488.173) (-1493.845) [-1487.531] * [-1487.681] (-1489.439) (-1486.504) (-1487.663) -- 0:00:17
893000 -- (-1491.572) (-1487.761) (-1494.456) [-1486.974] * (-1489.049) (-1485.755) (-1492.864) [-1485.248] -- 0:00:17
893500 -- (-1487.608) [-1487.477] (-1502.279) (-1490.690) * (-1487.472) (-1493.543) (-1490.179) [-1485.056] -- 0:00:17
894000 -- (-1487.417) (-1496.925) (-1488.385) [-1490.023] * (-1490.363) (-1488.755) (-1489.202) [-1484.513] -- 0:00:17
894500 -- [-1487.252] (-1493.610) (-1487.247) (-1487.432) * (-1496.450) [-1485.685] (-1494.527) (-1483.796) -- 0:00:17
895000 -- [-1490.299] (-1494.056) (-1487.091) (-1489.856) * (-1486.652) (-1492.453) (-1495.922) [-1486.602] -- 0:00:17
Average standard deviation of split frequencies: 0.000000
895500 -- (-1489.008) (-1495.908) [-1488.664] (-1491.609) * (-1490.039) (-1484.333) (-1491.231) [-1485.841] -- 0:00:17
896000 -- [-1485.581] (-1493.589) (-1497.150) (-1490.126) * (-1489.732) (-1487.202) (-1489.498) [-1484.989] -- 0:00:17
896500 -- [-1488.415] (-1492.150) (-1487.430) (-1489.976) * (-1488.495) (-1490.370) [-1486.787] (-1488.400) -- 0:00:16
897000 -- (-1490.383) [-1487.627] (-1488.245) (-1497.983) * [-1488.116] (-1491.354) (-1488.755) (-1491.056) -- 0:00:16
897500 -- (-1487.591) [-1485.080] (-1485.541) (-1490.390) * [-1485.651] (-1487.969) (-1490.223) (-1490.709) -- 0:00:16
898000 -- (-1488.160) (-1491.924) (-1491.607) [-1486.968] * (-1491.058) (-1490.425) (-1488.031) [-1490.610] -- 0:00:16
898500 -- (-1484.494) [-1484.566] (-1486.870) (-1485.593) * [-1482.725] (-1492.503) (-1490.209) (-1491.050) -- 0:00:16
899000 -- [-1487.846] (-1489.066) (-1486.567) (-1487.778) * (-1490.069) [-1486.582] (-1488.544) (-1488.964) -- 0:00:16
899500 -- (-1487.658) [-1493.493] (-1484.348) (-1485.456) * (-1490.487) [-1488.927] (-1487.034) (-1495.047) -- 0:00:16
900000 -- (-1491.593) [-1484.883] (-1490.364) (-1489.461) * [-1488.431] (-1496.541) (-1489.280) (-1488.673) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
900500 -- (-1487.370) (-1486.680) (-1493.808) [-1488.282] * (-1485.404) (-1489.545) (-1488.907) [-1493.194] -- 0:00:16
901000 -- (-1493.880) (-1488.789) [-1488.753] (-1485.455) * (-1483.563) (-1489.079) (-1484.147) [-1489.320] -- 0:00:16
901500 -- [-1487.170] (-1489.418) (-1490.529) (-1489.400) * [-1485.845] (-1485.067) (-1491.057) (-1490.085) -- 0:00:16
902000 -- [-1490.912] (-1487.115) (-1485.886) (-1488.532) * [-1488.039] (-1483.954) (-1485.064) (-1496.485) -- 0:00:16
902500 -- (-1488.965) (-1486.209) (-1485.619) [-1487.944] * (-1488.238) (-1484.709) (-1488.616) [-1484.452] -- 0:00:15
903000 -- (-1491.730) [-1485.364] (-1486.446) (-1484.940) * [-1492.003] (-1488.476) (-1485.553) (-1486.450) -- 0:00:15
903500 -- [-1484.626] (-1486.826) (-1488.594) (-1490.441) * (-1496.002) (-1489.883) (-1489.131) [-1487.307] -- 0:00:15
904000 -- (-1484.370) [-1484.834] (-1488.168) (-1491.823) * (-1489.228) (-1486.603) (-1488.233) [-1487.843] -- 0:00:15
904500 -- [-1487.650] (-1492.020) (-1488.879) (-1491.262) * (-1486.690) (-1486.661) (-1485.582) [-1490.874] -- 0:00:15
905000 -- [-1487.176] (-1493.447) (-1492.536) (-1490.572) * (-1485.619) (-1488.500) [-1485.553] (-1489.435) -- 0:00:15
Average standard deviation of split frequencies: 0.000000
905500 -- [-1486.762] (-1489.645) (-1490.108) (-1488.192) * [-1487.015] (-1489.842) (-1486.248) (-1489.637) -- 0:00:15
906000 -- (-1483.616) [-1493.522] (-1487.771) (-1491.384) * (-1489.391) (-1488.963) [-1492.911] (-1488.320) -- 0:00:15
906500 -- (-1490.062) [-1486.400] (-1485.740) (-1495.189) * (-1490.015) (-1484.831) (-1488.928) [-1489.587] -- 0:00:15
907000 -- (-1487.015) (-1483.028) [-1484.921] (-1492.119) * (-1495.366) [-1488.796] (-1484.195) (-1493.414) -- 0:00:15
907500 -- (-1490.808) [-1482.467] (-1491.743) (-1487.660) * (-1485.741) [-1491.317] (-1491.098) (-1489.911) -- 0:00:15
908000 -- (-1492.359) (-1488.388) [-1490.605] (-1486.645) * (-1483.171) [-1499.077] (-1484.955) (-1485.163) -- 0:00:15
908500 -- (-1491.050) (-1487.981) [-1487.160] (-1488.599) * [-1484.850] (-1495.308) (-1487.889) (-1487.053) -- 0:00:15
909000 -- (-1489.580) [-1487.814] (-1484.609) (-1488.528) * (-1485.266) (-1487.115) [-1484.922] (-1485.777) -- 0:00:14
909500 -- [-1485.891] (-1491.504) (-1487.220) (-1487.231) * (-1487.615) [-1489.699] (-1489.696) (-1486.912) -- 0:00:14
910000 -- (-1485.287) [-1486.083] (-1489.278) (-1488.252) * (-1493.892) (-1490.945) (-1487.050) [-1488.828] -- 0:00:14
Average standard deviation of split frequencies: 0.000000
910500 -- [-1481.478] (-1489.483) (-1487.972) (-1492.975) * [-1496.232] (-1489.631) (-1485.017) (-1492.380) -- 0:00:14
911000 -- (-1486.937) (-1492.798) [-1490.167] (-1490.120) * (-1484.235) [-1485.976] (-1485.427) (-1484.528) -- 0:00:14
911500 -- (-1488.867) (-1491.581) [-1488.326] (-1491.934) * (-1496.165) (-1491.443) [-1489.009] (-1486.407) -- 0:00:14
912000 -- [-1483.043] (-1483.746) (-1485.574) (-1491.178) * [-1487.687] (-1486.134) (-1486.037) (-1493.458) -- 0:00:14
912500 -- [-1482.906] (-1493.501) (-1490.758) (-1493.538) * [-1491.504] (-1488.567) (-1488.400) (-1484.196) -- 0:00:14
913000 -- (-1485.921) [-1482.950] (-1492.474) (-1491.300) * (-1490.252) (-1494.808) [-1491.645] (-1494.725) -- 0:00:14
913500 -- (-1489.777) [-1486.025] (-1488.860) (-1496.697) * (-1488.331) (-1489.205) (-1489.895) [-1489.624] -- 0:00:14
914000 -- [-1485.624] (-1495.887) (-1491.667) (-1489.985) * (-1490.970) (-1487.039) [-1486.295] (-1489.560) -- 0:00:14
914500 -- (-1489.339) (-1488.530) (-1486.101) [-1488.634] * (-1501.669) [-1487.460] (-1488.893) (-1490.465) -- 0:00:14
915000 -- (-1483.796) (-1489.487) (-1490.030) [-1487.788] * (-1486.705) [-1483.502] (-1495.452) (-1490.734) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
915500 -- (-1486.016) (-1487.461) [-1485.798] (-1485.811) * (-1490.217) (-1481.205) [-1490.268] (-1495.228) -- 0:00:13
916000 -- (-1492.743) (-1489.150) [-1485.958] (-1482.458) * [-1488.209] (-1487.218) (-1492.572) (-1499.375) -- 0:00:13
916500 -- (-1492.563) (-1483.189) [-1486.835] (-1485.585) * (-1491.359) [-1489.790] (-1489.902) (-1489.782) -- 0:00:13
917000 -- (-1493.562) (-1486.676) (-1484.789) [-1481.168] * (-1489.437) (-1484.272) [-1490.638] (-1492.908) -- 0:00:13
917500 -- (-1492.755) (-1487.277) (-1492.061) [-1485.907] * (-1489.844) (-1491.597) (-1495.656) [-1486.823] -- 0:00:13
918000 -- [-1488.985] (-1491.156) (-1491.288) (-1486.047) * (-1484.286) (-1485.355) [-1486.815] (-1486.400) -- 0:00:13
918500 -- (-1490.250) (-1490.852) [-1485.935] (-1487.286) * [-1487.854] (-1484.275) (-1485.245) (-1493.432) -- 0:00:13
919000 -- (-1491.403) (-1488.762) (-1496.490) [-1486.186] * (-1486.926) (-1490.470) [-1482.220] (-1491.600) -- 0:00:13
919500 -- (-1488.708) (-1489.177) [-1487.422] (-1485.091) * [-1486.893] (-1489.315) (-1489.046) (-1486.304) -- 0:00:13
920000 -- [-1488.558] (-1488.090) (-1485.691) (-1491.617) * [-1483.908] (-1487.488) (-1493.166) (-1488.352) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
920500 -- (-1486.395) [-1488.158] (-1487.987) (-1485.603) * (-1491.100) (-1489.096) (-1490.387) [-1486.561] -- 0:00:13
921000 -- (-1491.590) [-1486.813] (-1493.783) (-1489.198) * (-1489.498) [-1484.681] (-1489.428) (-1493.624) -- 0:00:12
921500 -- (-1491.126) [-1485.786] (-1491.669) (-1484.788) * (-1489.557) (-1485.267) (-1485.979) [-1488.940] -- 0:00:12
922000 -- (-1485.636) (-1487.069) [-1486.622] (-1490.108) * (-1490.007) (-1482.367) [-1485.702] (-1492.931) -- 0:00:12
922500 -- [-1486.651] (-1490.133) (-1487.507) (-1491.695) * [-1485.261] (-1499.191) (-1485.768) (-1491.704) -- 0:00:12
923000 -- [-1489.256] (-1485.309) (-1485.821) (-1491.509) * [-1484.368] (-1483.194) (-1486.939) (-1487.817) -- 0:00:12
923500 -- (-1486.514) [-1481.949] (-1483.120) (-1502.301) * [-1488.180] (-1486.168) (-1484.554) (-1491.646) -- 0:00:12
924000 -- (-1486.253) [-1483.111] (-1494.992) (-1495.660) * (-1493.910) (-1490.179) [-1485.438] (-1493.735) -- 0:00:12
924500 -- (-1492.062) (-1492.902) [-1486.655] (-1487.876) * (-1485.473) (-1485.788) (-1485.892) [-1486.392] -- 0:00:12
925000 -- (-1487.701) (-1495.597) [-1488.022] (-1487.258) * (-1489.101) [-1486.812] (-1490.614) (-1486.295) -- 0:00:12
Average standard deviation of split frequencies: 0.000000
925500 -- (-1492.244) (-1486.188) (-1486.489) [-1481.617] * (-1491.045) [-1484.882] (-1488.770) (-1483.508) -- 0:00:12
926000 -- (-1490.795) [-1487.815] (-1487.573) (-1491.142) * (-1488.964) (-1488.941) (-1488.852) [-1484.733] -- 0:00:12
926500 -- (-1484.430) (-1485.760) [-1489.864] (-1492.493) * (-1488.550) (-1489.276) (-1492.067) [-1490.250] -- 0:00:12
927000 -- (-1493.685) (-1484.710) [-1486.822] (-1490.660) * (-1488.780) (-1485.386) (-1485.367) [-1488.831] -- 0:00:11
927500 -- (-1494.845) (-1488.807) (-1485.072) [-1491.737] * [-1492.517] (-1485.173) (-1488.614) (-1492.753) -- 0:00:11
928000 -- (-1495.390) (-1489.261) [-1487.963] (-1487.701) * (-1489.997) [-1489.090] (-1485.176) (-1489.531) -- 0:00:11
928500 -- (-1492.981) [-1488.280] (-1488.891) (-1487.561) * [-1485.741] (-1485.538) (-1486.942) (-1485.083) -- 0:00:11
929000 -- [-1487.516] (-1488.421) (-1490.897) (-1484.589) * (-1488.321) (-1491.361) [-1492.477] (-1486.586) -- 0:00:11
929500 -- (-1492.326) (-1486.809) [-1487.242] (-1483.417) * [-1484.242] (-1485.069) (-1485.813) (-1485.021) -- 0:00:11
930000 -- (-1489.117) [-1483.646] (-1488.859) (-1487.349) * [-1486.082] (-1486.350) (-1492.811) (-1486.614) -- 0:00:11
Average standard deviation of split frequencies: 0.000000
930500 -- [-1484.437] (-1482.045) (-1490.865) (-1495.770) * (-1492.209) [-1483.596] (-1491.314) (-1488.568) -- 0:00:11
931000 -- [-1486.923] (-1488.455) (-1487.017) (-1489.807) * (-1486.595) (-1489.323) (-1493.549) [-1488.707] -- 0:00:11
931500 -- (-1490.627) (-1485.937) [-1487.042] (-1492.716) * (-1485.272) (-1492.768) [-1490.379] (-1510.280) -- 0:00:11
932000 -- [-1489.252] (-1485.592) (-1488.692) (-1488.070) * [-1487.507] (-1488.725) (-1498.681) (-1495.182) -- 0:00:11
932500 -- (-1489.235) (-1484.006) [-1490.924] (-1485.076) * (-1489.235) (-1484.987) [-1494.628] (-1495.745) -- 0:00:11
933000 -- (-1489.840) (-1495.962) (-1485.229) [-1489.123] * (-1489.886) [-1485.724] (-1492.912) (-1492.440) -- 0:00:10
933500 -- (-1485.430) (-1485.554) (-1490.672) [-1485.849] * (-1493.291) (-1488.588) [-1489.150] (-1492.416) -- 0:00:10
934000 -- (-1485.484) [-1485.401] (-1486.206) (-1487.124) * (-1493.793) [-1492.899] (-1498.043) (-1497.159) -- 0:00:10
934500 -- [-1488.025] (-1492.162) (-1493.625) (-1493.404) * [-1491.115] (-1489.584) (-1490.480) (-1487.162) -- 0:00:10
935000 -- [-1486.018] (-1484.033) (-1485.787) (-1487.619) * (-1486.504) [-1489.857] (-1495.667) (-1490.128) -- 0:00:10
Average standard deviation of split frequencies: 0.000000
935500 -- (-1487.548) [-1488.943] (-1491.212) (-1482.838) * (-1491.403) (-1489.644) (-1484.744) [-1484.920] -- 0:00:10
936000 -- (-1487.345) (-1492.434) (-1490.228) [-1487.432] * (-1487.914) (-1484.865) [-1482.999] (-1489.060) -- 0:00:10
936500 -- (-1485.743) [-1488.641] (-1492.693) (-1492.884) * [-1486.597] (-1492.985) (-1489.628) (-1483.515) -- 0:00:10
937000 -- [-1486.105] (-1492.620) (-1484.677) (-1491.600) * [-1489.651] (-1487.545) (-1492.989) (-1483.541) -- 0:00:10
937500 -- [-1490.455] (-1491.648) (-1487.602) (-1492.508) * [-1485.489] (-1493.544) (-1484.376) (-1485.820) -- 0:00:10
938000 -- (-1488.126) (-1486.308) [-1483.641] (-1486.183) * (-1487.274) (-1496.151) [-1487.701] (-1488.419) -- 0:00:10
938500 -- (-1488.115) [-1485.525] (-1488.378) (-1494.805) * (-1493.868) (-1488.808) (-1493.378) [-1487.293] -- 0:00:10
939000 -- [-1485.984] (-1488.624) (-1488.028) (-1487.568) * (-1490.386) [-1491.536] (-1490.443) (-1488.684) -- 0:00:10
939500 -- (-1488.352) (-1485.853) (-1488.681) [-1488.219] * (-1490.049) [-1492.971] (-1487.567) (-1485.664) -- 0:00:09
940000 -- (-1485.508) [-1489.237] (-1488.972) (-1488.418) * (-1500.452) (-1487.044) [-1489.198] (-1488.871) -- 0:00:09
Average standard deviation of split frequencies: 0.000000
940500 -- (-1491.786) (-1488.346) (-1488.770) [-1492.181] * [-1490.514] (-1489.058) (-1488.642) (-1489.323) -- 0:00:09
941000 -- (-1489.930) [-1491.151] (-1490.396) (-1485.520) * [-1487.507] (-1493.991) (-1484.621) (-1494.097) -- 0:00:09
941500 -- (-1489.743) [-1487.270] (-1490.271) (-1482.763) * (-1494.383) (-1488.575) [-1486.199] (-1487.036) -- 0:00:09
942000 -- (-1490.129) (-1484.875) (-1486.720) [-1485.850] * (-1487.931) (-1489.138) [-1494.443] (-1497.993) -- 0:00:09
942500 -- (-1491.802) (-1489.653) (-1491.608) [-1486.343] * (-1487.712) (-1483.001) [-1488.736] (-1487.023) -- 0:00:09
943000 -- (-1488.627) [-1490.181] (-1494.383) (-1489.009) * [-1482.763] (-1488.639) (-1485.314) (-1491.893) -- 0:00:09
943500 -- (-1486.214) (-1487.920) (-1489.338) [-1487.473] * (-1488.936) (-1486.200) [-1483.365] (-1486.092) -- 0:00:09
944000 -- (-1489.549) (-1491.360) [-1485.230] (-1486.889) * [-1485.784] (-1486.703) (-1495.412) (-1493.254) -- 0:00:09
944500 -- [-1487.201] (-1486.234) (-1489.390) (-1484.756) * (-1483.600) [-1489.740] (-1494.597) (-1484.895) -- 0:00:09
945000 -- (-1492.162) (-1484.393) [-1489.805] (-1485.689) * (-1486.463) [-1484.800] (-1490.091) (-1484.292) -- 0:00:09
Average standard deviation of split frequencies: 0.000000
945500 -- (-1492.720) (-1486.106) [-1488.098] (-1483.850) * (-1485.920) [-1487.125] (-1486.217) (-1494.524) -- 0:00:08
946000 -- (-1482.754) (-1490.712) (-1490.168) [-1483.482] * [-1487.175] (-1484.007) (-1485.295) (-1492.755) -- 0:00:08
946500 -- [-1487.601] (-1492.342) (-1489.988) (-1488.928) * [-1488.063] (-1489.667) (-1484.648) (-1486.524) -- 0:00:08
947000 -- (-1494.438) (-1489.879) [-1487.524] (-1491.617) * [-1485.333] (-1490.437) (-1485.987) (-1486.025) -- 0:00:08
947500 -- (-1493.623) [-1486.180] (-1486.174) (-1496.590) * (-1485.689) (-1496.613) (-1483.114) [-1484.738] -- 0:00:08
948000 -- (-1482.933) [-1484.394] (-1489.226) (-1485.524) * (-1490.720) [-1492.573] (-1496.458) (-1494.662) -- 0:00:08
948500 -- (-1488.662) [-1483.464] (-1490.716) (-1491.226) * (-1494.386) (-1492.406) (-1491.527) [-1486.263] -- 0:00:08
949000 -- (-1497.993) [-1489.198] (-1490.425) (-1488.311) * (-1487.764) (-1494.333) [-1493.927] (-1490.333) -- 0:00:08
949500 -- (-1491.260) (-1492.289) (-1487.900) [-1485.279] * (-1486.592) (-1496.034) (-1487.150) [-1487.906] -- 0:00:08
950000 -- (-1489.800) [-1488.693] (-1485.098) (-1485.005) * [-1484.856] (-1488.472) (-1486.311) (-1485.836) -- 0:00:08
Average standard deviation of split frequencies: 0.000000
950500 -- (-1486.848) (-1487.960) [-1486.781] (-1485.754) * (-1489.689) (-1491.984) [-1486.546] (-1486.970) -- 0:00:08
951000 -- (-1486.819) [-1484.881] (-1486.506) (-1486.828) * (-1492.704) (-1488.164) (-1485.257) [-1483.962] -- 0:00:08
951500 -- (-1488.176) [-1483.666] (-1486.529) (-1495.133) * (-1490.034) [-1486.459] (-1493.752) (-1493.928) -- 0:00:07
952000 -- (-1488.104) [-1483.047] (-1487.118) (-1489.394) * (-1485.392) (-1490.334) [-1485.112] (-1491.576) -- 0:00:07
952500 -- (-1490.374) (-1486.793) (-1492.917) [-1485.115] * (-1487.472) (-1485.209) (-1486.986) [-1493.511] -- 0:00:07
953000 -- (-1493.637) (-1485.164) (-1495.609) [-1483.199] * (-1492.557) (-1494.111) [-1491.893] (-1489.546) -- 0:00:07
953500 -- (-1499.539) (-1486.294) [-1483.962] (-1490.237) * (-1485.664) (-1486.388) [-1488.547] (-1490.126) -- 0:00:07
954000 -- (-1501.438) (-1488.564) (-1489.292) [-1485.691] * (-1486.255) (-1488.474) [-1488.398] (-1499.101) -- 0:00:07
954500 -- (-1494.309) [-1489.506] (-1489.736) (-1497.132) * [-1484.741] (-1488.920) (-1482.296) (-1495.495) -- 0:00:07
955000 -- (-1494.693) (-1499.786) [-1483.844] (-1489.344) * [-1483.458] (-1488.781) (-1485.711) (-1488.967) -- 0:00:07
Average standard deviation of split frequencies: 0.000000
955500 -- (-1491.382) (-1495.727) (-1491.990) [-1488.713] * [-1489.378] (-1489.652) (-1485.755) (-1487.208) -- 0:00:07
956000 -- (-1490.854) [-1493.167] (-1485.358) (-1488.119) * (-1487.500) (-1486.343) (-1492.630) [-1488.713] -- 0:00:07
956500 -- (-1495.206) [-1486.648] (-1489.249) (-1493.078) * [-1488.978] (-1492.527) (-1488.960) (-1489.708) -- 0:00:07
957000 -- (-1499.052) (-1492.086) [-1491.174] (-1490.514) * (-1487.141) [-1493.409] (-1491.091) (-1487.269) -- 0:00:07
957500 -- (-1488.166) [-1487.768] (-1487.389) (-1487.832) * [-1487.664] (-1491.548) (-1488.852) (-1493.499) -- 0:00:06
958000 -- (-1490.715) [-1487.118] (-1487.718) (-1483.773) * (-1483.682) (-1495.734) [-1484.051] (-1491.658) -- 0:00:06
958500 -- (-1488.633) (-1488.650) [-1485.293] (-1489.378) * [-1484.687] (-1489.997) (-1485.874) (-1490.988) -- 0:00:06
959000 -- [-1488.056] (-1494.466) (-1487.838) (-1490.430) * [-1485.955] (-1487.395) (-1489.940) (-1491.979) -- 0:00:06
959500 -- [-1484.313] (-1496.284) (-1485.002) (-1492.711) * (-1486.883) (-1484.180) (-1488.960) [-1489.674] -- 0:00:06
960000 -- [-1488.087] (-1486.360) (-1482.929) (-1488.475) * (-1486.560) [-1487.092] (-1488.104) (-1486.935) -- 0:00:06
Average standard deviation of split frequencies: 0.000000
960500 -- (-1493.127) (-1493.620) [-1492.256] (-1494.788) * (-1489.563) (-1486.554) (-1490.273) [-1485.486] -- 0:00:06
961000 -- (-1489.168) (-1489.448) (-1483.850) [-1492.087] * (-1489.878) (-1487.468) [-1487.200] (-1487.490) -- 0:00:06
961500 -- [-1487.522] (-1488.566) (-1493.306) (-1488.410) * [-1486.767] (-1487.488) (-1488.809) (-1493.360) -- 0:00:06
962000 -- (-1497.722) [-1487.707] (-1489.833) (-1489.934) * (-1486.236) [-1487.179] (-1486.195) (-1491.736) -- 0:00:06
962500 -- (-1486.807) (-1488.450) [-1482.034] (-1491.207) * (-1486.990) [-1486.681] (-1489.905) (-1490.087) -- 0:00:06
963000 -- (-1489.385) (-1492.881) (-1486.588) [-1486.439] * (-1490.478) (-1492.648) [-1486.797] (-1490.257) -- 0:00:06
963500 -- (-1481.684) (-1488.452) (-1487.118) [-1489.532] * (-1491.301) (-1487.149) [-1484.486] (-1487.881) -- 0:00:05
964000 -- (-1490.240) (-1481.978) (-1489.685) [-1486.900] * (-1490.080) [-1487.752] (-1484.202) (-1487.825) -- 0:00:05
964500 -- [-1484.623] (-1486.435) (-1484.636) (-1489.067) * [-1483.297] (-1489.536) (-1485.977) (-1489.001) -- 0:00:05
965000 -- (-1488.173) [-1483.136] (-1484.336) (-1482.658) * [-1486.161] (-1491.976) (-1486.965) (-1486.724) -- 0:00:05
Average standard deviation of split frequencies: 0.000000
965500 -- (-1488.119) (-1484.068) [-1482.639] (-1486.264) * (-1485.642) (-1491.219) (-1489.223) [-1483.684] -- 0:00:05
966000 -- (-1487.835) (-1486.193) [-1487.993] (-1487.191) * [-1486.013] (-1489.593) (-1486.112) (-1488.922) -- 0:00:05
966500 -- [-1485.975] (-1488.663) (-1491.149) (-1485.810) * (-1487.931) (-1488.527) (-1492.386) [-1489.539] -- 0:00:05
967000 -- (-1486.618) (-1493.500) (-1490.687) [-1486.036] * (-1489.850) [-1485.828] (-1483.646) (-1492.019) -- 0:00:05
967500 -- (-1491.195) (-1486.536) [-1491.313] (-1491.295) * (-1488.836) (-1484.245) (-1487.809) [-1490.105] -- 0:00:05
968000 -- [-1485.159] (-1492.436) (-1490.695) (-1499.111) * (-1490.845) (-1488.105) (-1485.440) [-1489.225] -- 0:00:05
968500 -- (-1483.428) (-1491.982) [-1488.339] (-1487.412) * (-1495.778) (-1487.437) (-1484.525) [-1486.749] -- 0:00:05
969000 -- [-1484.805] (-1489.053) (-1484.975) (-1487.033) * (-1494.314) (-1490.885) (-1488.896) [-1487.337] -- 0:00:05
969500 -- (-1485.721) (-1485.259) [-1484.876] (-1488.850) * (-1484.900) (-1492.538) (-1489.878) [-1489.228] -- 0:00:05
970000 -- [-1484.272] (-1483.093) (-1485.668) (-1490.059) * [-1489.068] (-1483.979) (-1490.218) (-1487.427) -- 0:00:04
Average standard deviation of split frequencies: 0.000000
970500 -- [-1487.618] (-1491.494) (-1488.442) (-1488.990) * (-1486.259) [-1488.644] (-1485.122) (-1490.498) -- 0:00:04
971000 -- [-1486.449] (-1493.970) (-1488.401) (-1490.131) * (-1485.698) [-1488.103] (-1493.933) (-1492.407) -- 0:00:04
971500 -- (-1489.101) [-1484.763] (-1488.610) (-1491.038) * (-1488.049) [-1491.744] (-1488.134) (-1489.799) -- 0:00:04
972000 -- (-1490.692) [-1488.846] (-1483.356) (-1486.819) * [-1483.667] (-1490.300) (-1485.256) (-1490.348) -- 0:00:04
972500 -- (-1488.994) (-1485.256) [-1486.931] (-1489.980) * [-1490.049] (-1484.330) (-1490.253) (-1486.541) -- 0:00:04
973000 -- (-1490.994) [-1493.257] (-1491.026) (-1487.230) * (-1494.431) [-1493.092] (-1487.634) (-1488.019) -- 0:00:04
973500 -- [-1491.823] (-1489.390) (-1489.730) (-1488.643) * [-1488.513] (-1488.929) (-1488.156) (-1486.013) -- 0:00:04
974000 -- (-1486.292) [-1494.935] (-1490.161) (-1487.441) * (-1486.057) (-1486.681) [-1485.481] (-1491.340) -- 0:00:04
974500 -- [-1487.316] (-1486.973) (-1489.279) (-1488.548) * [-1494.201] (-1489.358) (-1490.182) (-1483.196) -- 0:00:04
975000 -- (-1485.406) [-1489.197] (-1501.103) (-1491.858) * (-1488.903) [-1490.377] (-1490.941) (-1483.371) -- 0:00:04
Average standard deviation of split frequencies: 0.000000
975500 -- [-1484.174] (-1483.760) (-1493.878) (-1496.624) * (-1487.232) [-1489.357] (-1495.966) (-1485.431) -- 0:00:04
976000 -- (-1490.070) (-1490.724) [-1484.566] (-1487.899) * [-1486.207] (-1486.128) (-1490.070) (-1498.543) -- 0:00:03
976500 -- (-1492.858) (-1489.664) [-1486.944] (-1485.784) * (-1490.793) (-1487.593) [-1490.484] (-1487.977) -- 0:00:03
977000 -- (-1487.107) (-1494.504) [-1484.124] (-1488.956) * (-1495.603) (-1485.575) (-1488.365) [-1489.319] -- 0:00:03
977500 -- [-1492.565] (-1492.587) (-1491.607) (-1488.026) * (-1485.116) [-1486.471] (-1486.259) (-1488.914) -- 0:00:03
978000 -- [-1492.310] (-1502.557) (-1488.448) (-1487.429) * (-1486.376) (-1484.547) (-1489.241) [-1489.280] -- 0:00:03
978500 -- (-1485.075) (-1490.304) (-1489.386) [-1491.414] * (-1492.696) [-1491.019] (-1484.743) (-1491.731) -- 0:00:03
979000 -- (-1491.770) (-1491.928) (-1494.446) [-1483.896] * [-1484.848] (-1494.155) (-1485.589) (-1490.105) -- 0:00:03
979500 -- (-1492.386) (-1487.879) (-1484.675) [-1488.785] * (-1488.442) (-1485.317) (-1486.248) [-1488.830] -- 0:00:03
980000 -- (-1495.157) (-1491.180) (-1485.485) [-1486.451] * (-1496.454) (-1486.815) (-1485.311) [-1490.184] -- 0:00:03
Average standard deviation of split frequencies: 0.000000
980500 -- [-1497.671] (-1485.806) (-1488.154) (-1489.072) * [-1495.456] (-1486.999) (-1486.481) (-1484.320) -- 0:00:03
981000 -- (-1490.519) (-1487.322) (-1488.271) [-1487.723] * (-1494.225) (-1489.993) (-1485.206) [-1485.068] -- 0:00:03
981500 -- (-1491.805) [-1487.278] (-1489.293) (-1492.225) * (-1495.304) (-1493.220) (-1489.961) [-1488.820] -- 0:00:03
982000 -- (-1485.355) (-1493.354) [-1486.465] (-1486.228) * [-1488.766] (-1489.666) (-1493.087) (-1485.274) -- 0:00:02
982500 -- [-1482.600] (-1488.711) (-1483.370) (-1492.118) * (-1484.979) [-1485.736] (-1505.087) (-1486.411) -- 0:00:02
983000 -- (-1486.243) (-1486.706) (-1485.394) [-1490.488] * (-1492.600) (-1494.037) (-1488.030) [-1484.503] -- 0:00:02
983500 -- [-1486.669] (-1493.211) (-1488.961) (-1489.263) * (-1493.393) (-1485.866) (-1488.600) [-1483.211] -- 0:00:02
984000 -- (-1488.937) (-1486.096) [-1485.088] (-1489.520) * (-1492.122) (-1488.144) [-1489.936] (-1483.781) -- 0:00:02
984500 -- (-1486.259) [-1489.478] (-1488.020) (-1487.285) * (-1492.364) (-1495.897) [-1486.980] (-1486.358) -- 0:00:02
985000 -- (-1488.405) [-1489.634] (-1496.051) (-1488.143) * (-1488.538) [-1492.382] (-1484.029) (-1485.062) -- 0:00:02
Average standard deviation of split frequencies: 0.000000
985500 -- (-1495.072) (-1486.070) [-1492.512] (-1488.649) * [-1485.616] (-1489.222) (-1490.094) (-1491.449) -- 0:00:02
986000 -- (-1490.804) [-1490.915] (-1488.747) (-1486.928) * (-1484.680) (-1490.303) (-1487.213) [-1487.335] -- 0:00:02
986500 -- (-1488.239) (-1498.326) [-1486.324] (-1489.855) * (-1490.571) [-1490.313] (-1491.548) (-1492.809) -- 0:00:02
987000 -- (-1485.058) (-1486.306) (-1486.938) [-1486.741] * (-1494.974) (-1485.407) [-1494.014] (-1485.680) -- 0:00:02
987500 -- (-1485.587) (-1494.562) (-1488.491) [-1490.392] * (-1492.271) (-1487.357) (-1492.038) [-1487.972] -- 0:00:02
988000 -- (-1485.664) [-1486.590] (-1493.980) (-1486.813) * (-1484.454) [-1489.727] (-1483.128) (-1489.734) -- 0:00:01
988500 -- (-1490.066) (-1487.288) (-1486.879) [-1490.009] * [-1490.947] (-1487.713) (-1485.111) (-1486.731) -- 0:00:01
989000 -- [-1490.557] (-1486.683) (-1489.081) (-1487.278) * (-1486.168) (-1487.769) (-1485.403) [-1488.858] -- 0:00:01
989500 -- (-1486.638) [-1490.286] (-1492.218) (-1489.629) * (-1497.210) (-1485.974) [-1485.449] (-1486.782) -- 0:00:01
990000 -- (-1488.052) (-1484.283) [-1493.882] (-1496.488) * (-1489.161) [-1485.962] (-1487.119) (-1493.026) -- 0:00:01
Average standard deviation of split frequencies: 0.000000
990500 -- (-1490.279) (-1496.764) [-1494.544] (-1494.339) * [-1487.304] (-1491.591) (-1487.911) (-1484.092) -- 0:00:01
991000 -- [-1486.028] (-1485.929) (-1492.977) (-1490.718) * (-1485.106) [-1495.459] (-1489.929) (-1487.716) -- 0:00:01
991500 -- [-1482.355] (-1489.913) (-1490.314) (-1496.356) * [-1491.519] (-1492.144) (-1489.801) (-1486.711) -- 0:00:01
992000 -- (-1485.802) (-1489.341) [-1489.296] (-1491.364) * (-1485.248) (-1499.016) (-1490.733) [-1491.105] -- 0:00:01
992500 -- (-1484.942) [-1490.780] (-1488.041) (-1486.782) * (-1485.772) (-1491.185) [-1489.056] (-1492.499) -- 0:00:01
993000 -- (-1492.648) (-1487.694) (-1488.751) [-1484.469] * (-1484.643) (-1491.724) [-1484.202] (-1493.219) -- 0:00:01
993500 -- [-1488.265] (-1484.855) (-1498.839) (-1489.422) * (-1482.416) [-1490.918] (-1489.163) (-1485.232) -- 0:00:01
994000 -- (-1486.241) (-1486.615) [-1486.882] (-1488.131) * (-1489.123) (-1487.554) [-1485.328] (-1490.249) -- 0:00:00
994500 -- (-1495.840) (-1490.336) [-1488.337] (-1489.280) * [-1485.847] (-1493.286) (-1491.184) (-1484.132) -- 0:00:00
995000 -- (-1484.499) (-1495.246) (-1490.861) [-1485.988] * [-1488.365] (-1486.613) (-1489.608) (-1488.945) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
995500 -- (-1491.203) [-1486.997] (-1494.512) (-1486.829) * (-1484.409) (-1484.196) [-1488.868] (-1492.624) -- 0:00:00
996000 -- [-1485.722] (-1495.317) (-1485.450) (-1485.690) * [-1489.252] (-1490.565) (-1492.139) (-1488.230) -- 0:00:00
996500 -- [-1486.268] (-1489.184) (-1488.911) (-1489.451) * (-1488.767) (-1482.337) (-1493.590) [-1487.402] -- 0:00:00
997000 -- (-1492.378) (-1492.803) [-1488.342] (-1484.070) * [-1488.062] (-1490.983) (-1493.226) (-1486.021) -- 0:00:00
997500 -- (-1486.369) (-1487.770) (-1495.777) [-1485.324] * (-1488.259) (-1495.247) [-1490.661] (-1485.520) -- 0:00:00
998000 -- (-1484.411) (-1491.359) [-1490.434] (-1487.689) * (-1487.167) (-1490.318) (-1488.092) [-1487.135] -- 0:00:00
998500 -- (-1494.920) (-1486.464) (-1483.964) [-1488.515] * [-1485.285] (-1489.280) (-1485.954) (-1494.106) -- 0:00:00
999000 -- [-1485.328] (-1495.288) (-1486.967) (-1492.330) * (-1483.270) (-1488.641) (-1486.702) [-1484.016] -- 0:00:00
999500 -- (-1488.039) [-1486.414] (-1489.232) (-1495.426) * [-1488.262] (-1490.763) (-1485.831) (-1487.170) -- 0:00:00
1000000 -- [-1485.901] (-1485.409) (-1492.176) (-1494.591) * (-1489.876) (-1488.275) [-1485.994] (-1490.084) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1485.901001 -- 14.947924
Chain 1 -- -1485.901001 -- 14.947924
Chain 2 -- -1485.408500 -- 13.224109
Chain 2 -- -1485.408500 -- 13.224109
Chain 3 -- -1492.175640 -- 16.546504
Chain 3 -- -1492.175640 -- 16.546504
Chain 4 -- -1494.591374 -- 16.915566
Chain 4 -- -1494.591374 -- 16.915566
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1489.876379 -- 17.158244
Chain 1 -- -1489.876377 -- 17.158244
Chain 2 -- -1488.275223 -- 15.149799
Chain 2 -- -1488.275224 -- 15.149799
Chain 3 -- -1485.994180 -- 15.302213
Chain 3 -- -1485.994179 -- 15.302213
Chain 4 -- -1490.084474 -- 15.333822
Chain 4 -- -1490.084474 -- 15.333822
Analysis completed in 2 mins 44 seconds
Analysis used 164.51 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1479.86
Likelihood of best state for "cold" chain of run 2 was -1479.91
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
56.8 % ( 48 %) Dirichlet(Revmat{all})
71.1 % ( 60 %) Slider(Revmat{all})
27.0 % ( 28 %) Dirichlet(Pi{all})
29.1 % ( 23 %) Slider(Pi{all})
67.5 % ( 46 %) Multiplier(Alpha{1,2})
53.9 % ( 36 %) Multiplier(Alpha{3})
80.2 % ( 61 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.1 % ( 27 %) Multiplier(V{all})
26.7 % ( 23 %) Nodeslider(V{all})
25.6 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
56.7 % ( 41 %) Dirichlet(Revmat{all})
70.8 % ( 57 %) Slider(Revmat{all})
27.4 % ( 25 %) Dirichlet(Pi{all})
29.0 % ( 24 %) Slider(Pi{all})
67.2 % ( 35 %) Multiplier(Alpha{1,2})
53.9 % ( 19 %) Multiplier(Alpha{3})
79.4 % ( 56 %) Slider(Pinvar{all})
0.0 % ( 0 %) ExtSPR(Tau{all},V{all})
0.0 % ( 0 %) ExtTBR(Tau{all},V{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
26.2 % ( 28 %) Multiplier(V{all})
26.8 % ( 26 %) Nodeslider(V{all})
25.4 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.56
2 | 167210 0.85 0.71
3 | 166012 166565 0.86
4 | 166814 166075 167324
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.56
2 | 166831 0.85 0.71
3 | 166669 166396 0.86
4 | 166581 166698 166825
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1486.07
| 1 |
| 2 |
| 2 |
| 1 1 1 1 |
| 2 2 1 2 1 111 1 1 1 1 |
|* 122 11 2 11 2*2 2 2222 2 2 11 |
| 1 11 1 12 2 1 21 1 2 |
| 12 21 1 1 21 2 21 2 |
| 2 2 2 *2 11 22 2 1 2 2 1 1 2 |
| * 2 12 2 2 1 * * 1 2 1 2 1|
| 1 1 2 2 2 1 2 12|
| 1 2 1 |
| 2 1 1 2 |
| 1 2 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1489.15
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1484.94 -1494.53
2 -1484.95 -1493.99
--------------------------------------
TOTAL -1484.95 -1494.29
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.231392 0.001117 0.169930 0.293619 0.228649 1218.57 1219.97 1.000
r(A<->C){all} 0.084643 0.000871 0.034808 0.147252 0.081325 816.41 1005.45 1.000
r(A<->G){all} 0.201219 0.001870 0.119448 0.283015 0.198436 665.35 732.17 1.001
r(A<->T){all} 0.156534 0.002253 0.068148 0.248888 0.153326 804.07 863.29 1.000
r(C<->G){all} 0.121737 0.000879 0.069276 0.182365 0.119716 827.36 852.23 1.000
r(C<->T){all} 0.345141 0.003412 0.234909 0.458154 0.342609 531.66 598.45 1.000
r(G<->T){all} 0.090725 0.001065 0.033651 0.156954 0.087223 1015.22 1015.60 1.000
pi(A){all} 0.208111 0.000226 0.180470 0.239449 0.207801 1102.61 1108.55 1.000
pi(C){all} 0.297055 0.000285 0.263879 0.329969 0.296898 888.63 1030.16 1.000
pi(G){all} 0.314855 0.000305 0.280120 0.348069 0.314520 934.91 1117.15 1.000
pi(T){all} 0.179979 0.000202 0.152208 0.208811 0.179672 1162.88 1222.54 1.000
alpha{1,2} 0.245096 0.067406 0.000190 0.707010 0.172594 1165.36 1212.08 1.000
alpha{3} 1.366100 0.415777 0.310552 2.630068 1.251412 1235.16 1314.08 1.001
pinvar{all} 0.150071 0.012539 0.000012 0.365107 0.126820 1218.20 1293.60 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 3002 1.000000 0.000000 1.000000 1.000000 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.030974 0.000088 0.014923 0.050571 0.030051 1.000 2
length{all}[2] 0.015536 0.000032 0.005233 0.025912 0.014875 1.000 2
length{all}[3] 0.006851 0.000015 0.000863 0.014672 0.006230 1.001 2
length{all}[4] 0.051168 0.000163 0.027585 0.075998 0.049605 1.000 2
length{all}[5] 0.027845 0.000077 0.011402 0.044595 0.026995 1.000 2
length{all}[6] 0.068154 0.000290 0.039359 0.102561 0.066267 1.000 2
length{all}[7] 0.030864 0.000093 0.013978 0.050433 0.029832 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000000
Maximum standard deviation of split frequencies = 0.000000
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C2 (2)
|----------------100----------------+
+ \------------------------------------ C3 (3)
|
| /------------------------------------ C4 (4)
\----------------100----------------+
\------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/------------------- C1 (1)
|
| /--------- C2 (2)
|------------------+
+ \--- C3 (3)
|
| /------------------------------- C4 (4)
\----------------------------------------+
\----------------- C5 (5)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1 tree sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 648
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
112 patterns at 216 / 216 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
109312 bytes for conP
15232 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), (4, 5)); MP score: 102
163968 bytes for conP, adjusted
0.082890 0.070194 0.037552 0.015008 0.144345 0.119390 0.068009 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1505.852966
Iterating by ming2
Initial: fx= 1505.852966
x= 0.08289 0.07019 0.03755 0.01501 0.14435 0.11939 0.06801 0.30000 1.30000
1 h-m-p 0.0000 0.0040 137.3599 ++++CYYCCC 1477.360320 5 0.0032 27 | 0/9
2 h-m-p 0.0000 0.0001 4625.0691 YYCCC 1471.536159 4 0.0000 45 | 0/9
3 h-m-p 0.0002 0.0031 1204.0854 +CCYCC 1456.205310 4 0.0004 65 | 0/9
4 h-m-p 0.0003 0.0017 184.7522 YCCCCC 1450.819276 5 0.0006 86 | 0/9
5 h-m-p 0.0016 0.0102 74.4685 +CYCCC 1441.310403 4 0.0071 106 | 0/9
6 h-m-p 0.0000 0.0002 2276.7843 +YYYYCCCC 1423.719562 7 0.0001 129 | 0/9
7 h-m-p 0.0003 0.0015 52.1041 YCCC 1423.537333 3 0.0002 146 | 0/9
8 h-m-p 0.0019 0.0158 5.7724 YCC 1423.496944 2 0.0014 161 | 0/9
9 h-m-p 0.0044 0.1742 1.8521 +YC 1422.775860 1 0.0371 175 | 0/9
10 h-m-p 0.0119 0.0593 4.4506 YCYCCC 1415.939270 5 0.0305 195 | 0/9
11 h-m-p 0.0701 0.3503 0.6452 YCYCCCC 1406.606342 6 0.1625 217 | 0/9
12 h-m-p 0.3492 1.7462 0.1358 YCCCC 1401.626432 4 0.6199 245 | 0/9
13 h-m-p 0.4889 2.4446 0.1248 CCCCC 1397.899588 4 0.6811 274 | 0/9
14 h-m-p 0.7659 3.8297 0.0483 CYCCC 1395.633689 4 1.2935 302 | 0/9
15 h-m-p 0.6541 3.2703 0.0580 YCCC 1393.682785 3 1.1627 328 | 0/9
16 h-m-p 0.9884 8.0000 0.0682 CC 1393.281292 1 0.9884 351 | 0/9
17 h-m-p 0.5229 8.0000 0.1290 YCCC 1392.764750 3 1.1089 377 | 0/9
18 h-m-p 1.6000 8.0000 0.0737 CCC 1392.421200 2 2.0528 402 | 0/9
19 h-m-p 1.6000 8.0000 0.0462 CYC 1392.280012 2 1.7445 426 | 0/9
20 h-m-p 1.6000 8.0000 0.0440 +YC 1392.039193 1 4.6367 449 | 0/9
21 h-m-p 1.6000 8.0000 0.0245 CCC 1391.975466 2 1.6660 474 | 0/9
22 h-m-p 1.6000 8.0000 0.0021 YC 1391.947454 1 3.4003 496 | 0/9
23 h-m-p 1.6000 8.0000 0.0017 C 1391.937376 0 1.6000 517 | 0/9
24 h-m-p 1.4912 8.0000 0.0018 YC 1391.937255 1 1.0993 539 | 0/9
25 h-m-p 1.6000 8.0000 0.0001 Y 1391.937253 0 1.1576 560 | 0/9
26 h-m-p 1.6000 8.0000 0.0000 Y 1391.937253 0 1.1660 581 | 0/9
27 h-m-p 1.6000 8.0000 0.0000 C 1391.937253 0 1.6000 602 | 0/9
28 h-m-p 1.6000 8.0000 0.0000 ----C 1391.937253 0 0.0016 627
Out..
lnL = -1391.937253
628 lfun, 628 eigenQcodon, 4396 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), (4, 5)); MP score: 102
0.082890 0.070194 0.037552 0.015008 0.144345 0.119390 0.068009 2.356640 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.815049
np = 10
lnL0 = -1426.642777
Iterating by ming2
Initial: fx= 1426.642777
x= 0.08289 0.07019 0.03755 0.01501 0.14435 0.11939 0.06801 2.35664 0.57321 0.49224
1 h-m-p 0.0000 0.0056 52.6000 +++++ 1416.658750 m 0.0056 18 | 0/10
2 h-m-p 0.0000 0.0000 23115.1692
h-m-p: 1.17238569e-21 5.86192846e-21 2.31151692e+04 1416.658750
.. | 0/10
3 h-m-p 0.0000 0.0014 1060.4909 YYYCCC 1414.097200 5 0.0000 48 | 0/10
4 h-m-p 0.0001 0.0010 148.5170 +CCCYC 1404.537244 4 0.0007 70 | 0/10
5 h-m-p 0.0002 0.0011 204.9520 YCYCCC 1396.925710 5 0.0006 91 | 0/10
6 h-m-p 0.0001 0.0004 353.5286 +YCYCCC 1391.918614 5 0.0002 113 | 0/10
7 h-m-p 0.0011 0.0054 24.8409 CCC 1391.814190 2 0.0004 130 | 0/10
8 h-m-p 0.0006 0.0115 14.0614 YCC 1391.699697 2 0.0014 146 | 0/10
9 h-m-p 0.0015 0.0105 13.0642 CCC 1391.630347 2 0.0013 163 | 0/10
10 h-m-p 0.0035 0.0407 4.9219 CC 1391.612167 1 0.0013 178 | 0/10
11 h-m-p 0.0058 0.1341 1.1424 YCCC 1391.551994 3 0.0097 196 | 0/10
12 h-m-p 0.0028 0.9990 3.8900 ++CCCC 1389.317670 3 0.0444 217 | 0/10
13 h-m-p 0.2686 3.9439 0.6429 CCCC 1389.126429 3 0.3981 236 | 0/10
14 h-m-p 1.3678 6.8390 0.1676 YCC 1389.040193 2 0.5639 262 | 0/10
15 h-m-p 1.6000 8.0000 0.0109 YC 1389.022150 1 0.7358 286 | 0/10
16 h-m-p 1.6000 8.0000 0.0026 C 1389.017854 0 1.6604 309 | 0/10
17 h-m-p 1.6000 8.0000 0.0015 C 1389.017349 0 1.8144 332 | 0/10
18 h-m-p 1.6000 8.0000 0.0009 YC 1389.016912 1 3.0204 356 | 0/10
19 h-m-p 1.6000 8.0000 0.0012 C 1389.016804 0 2.0157 379 | 0/10
20 h-m-p 1.6000 8.0000 0.0010 Y 1389.016799 0 1.1705 402 | 0/10
21 h-m-p 1.6000 8.0000 0.0000 Y 1389.016799 0 1.2747 425 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1389.016799 0 0.9624 448 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 +Y 1389.016799 0 4.1684 472 | 0/10
24 h-m-p 1.2809 8.0000 0.0000 -C 1389.016799 0 0.0801 496 | 0/10
25 h-m-p 0.1658 8.0000 0.0000 ---Y 1389.016799 0 0.0004 522
Out..
lnL = -1389.016799
523 lfun, 1569 eigenQcodon, 7322 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), (4, 5)); MP score: 102
initial w for M2:NSpselection reset.
0.082890 0.070194 0.037552 0.015008 0.144345 0.119390 0.068009 2.369040 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.694128
np = 12
lnL0 = -1436.360661
Iterating by ming2
Initial: fx= 1436.360661
x= 0.08289 0.07019 0.03755 0.01501 0.14435 0.11939 0.06801 2.36904 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0129 67.4813 +++CCYC 1435.059134 3 0.0007 25 | 0/12
2 h-m-p 0.0001 0.0007 129.7960 +YCYCCC 1433.403486 5 0.0004 49 | 0/12
3 h-m-p 0.0003 0.0016 210.1800 +YYCCCCC 1426.268908 6 0.0011 75 | 0/12
4 h-m-p 0.0000 0.0001 1681.5321 ++ 1416.834002 m 0.0001 90 | 1/12
5 h-m-p 0.0038 0.0188 21.8942 CCCCC 1415.430778 4 0.0044 113 | 1/12
6 h-m-p 0.0013 0.0635 73.3480 +YCCC 1407.405395 3 0.0092 134 | 0/12
7 h-m-p 0.0007 0.0056 1013.2746 CCCCC 1401.677014 4 0.0006 157 | 0/12
8 h-m-p 0.0015 0.0075 74.7444 CYC 1400.782719 2 0.0014 175 | 0/12
9 h-m-p 0.0042 0.0209 18.9408 YC 1400.590456 1 0.0019 191 | 0/12
10 h-m-p 0.0114 0.0873 3.0836 CCC 1400.323385 2 0.0098 210 | 0/12
11 h-m-p 0.0039 0.0548 7.7778 +CYCCCC 1396.121239 5 0.0228 235 | 0/12
12 h-m-p 0.0699 0.5131 2.5435 +CCCC 1393.616357 3 0.3340 257 | 0/12
13 h-m-p 0.0899 0.4495 0.9412 ++ 1391.926368 m 0.4495 272 | 1/12
14 h-m-p 0.4196 8.0000 0.3947 YCCC 1390.616545 3 0.8778 304 | 1/12
15 h-m-p 0.4543 4.0159 0.7626 CCCC 1390.060866 3 0.6369 336 | 1/12
16 h-m-p 0.9390 6.6220 0.5172 CCC 1389.356800 2 1.0489 366 | 1/12
17 h-m-p 1.5876 8.0000 0.3417 CCC 1389.184341 2 0.5209 396 | 1/12
18 h-m-p 1.0583 8.0000 0.1682 CCC 1389.057224 2 1.2412 426 | 1/12
19 h-m-p 1.6000 8.0000 0.1231 YCC 1389.032442 2 1.0091 455 | 1/12
20 h-m-p 1.1917 8.0000 0.1043 C 1389.022194 0 1.1950 481 | 1/12
21 h-m-p 1.6000 8.0000 0.0400 CC 1389.018363 1 1.8036 509 | 1/12
22 h-m-p 1.6000 8.0000 0.0104 YC 1389.017069 1 1.0860 536 | 1/12
23 h-m-p 1.2103 8.0000 0.0093 YC 1389.016801 1 0.9648 563 | 1/12
24 h-m-p 1.6000 8.0000 0.0004 Y 1389.016799 0 1.0740 589 | 1/12
25 h-m-p 1.6000 8.0000 0.0001 Y 1389.016799 0 1.0298 615 | 1/12
26 h-m-p 1.6000 8.0000 0.0000 Y 1389.016799 0 1.0234 641 | 1/12
27 h-m-p 1.6000 8.0000 0.0000 Y 1389.016799 0 0.4000 667 | 1/12
28 h-m-p 0.6925 8.0000 0.0000 Y 1389.016799 0 0.6925 693 | 1/12
29 h-m-p 1.6000 8.0000 0.0000 ---C 1389.016799 0 0.0063 722
Out..
lnL = -1389.016799
723 lfun, 2892 eigenQcodon, 15183 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1398.719310 S = -1313.963032 -76.677214
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 112 patterns 0:10
did 20 / 112 patterns 0:10
did 30 / 112 patterns 0:10
did 40 / 112 patterns 0:10
did 50 / 112 patterns 0:10
did 60 / 112 patterns 0:10
did 70 / 112 patterns 0:10
did 80 / 112 patterns 0:10
did 90 / 112 patterns 0:10
did 100 / 112 patterns 0:10
did 110 / 112 patterns 0:10
did 112 / 112 patterns 0:10
Time used: 0:10
Model 3: discrete
TREE # 1
(1, (2, 3), (4, 5)); MP score: 102
0.082890 0.070194 0.037552 0.015008 0.144345 0.119390 0.068009 2.369040 0.331355 0.382499 0.064293 0.160502 0.268742
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 11.555373
np = 13
lnL0 = -1391.620653
Iterating by ming2
Initial: fx= 1391.620653
x= 0.08289 0.07019 0.03755 0.01501 0.14435 0.11939 0.06801 2.36904 0.33136 0.38250 0.06429 0.16050 0.26874
1 h-m-p 0.0000 0.0011 54.7071 +++YCCC 1390.874219 3 0.0005 26 | 0/13
2 h-m-p 0.0001 0.0006 158.5837 CYC 1390.421073 2 0.0001 45 | 0/13
3 h-m-p 0.0001 0.0007 73.7165 ++ 1389.330408 m 0.0007 61 | 1/13
4 h-m-p 0.0016 0.0125 18.3135 YC 1389.245163 1 0.0008 78 | 1/13
5 h-m-p 0.0012 0.0161 12.2111 +CYCCC 1388.852683 4 0.0072 102 | 1/13
6 h-m-p 0.0003 0.0013 88.8878 YCCC 1388.636002 3 0.0006 123 | 1/13
7 h-m-p 0.0036 0.0288 14.7084 YC 1388.559422 1 0.0018 140 | 1/13
8 h-m-p 0.0019 0.0205 13.9186 YC 1388.519825 1 0.0011 157 | 1/13
9 h-m-p 0.0098 0.1483 1.5767 YCC 1388.498893 2 0.0057 176 | 0/13
10 h-m-p 0.0010 0.1390 9.0882 +YCCC 1388.402534 3 0.0026 198 | 0/13
11 h-m-p 0.0025 0.0235 9.1342 +CYC 1388.192320 2 0.0094 218 | 0/13
12 h-m-p 0.0625 0.4513 1.3697 +YCC 1387.777410 2 0.3150 238 | 0/13
13 h-m-p 0.0692 0.3459 1.0058 +YC 1387.687004 1 0.1835 256 | 0/13
14 h-m-p 0.1916 0.9579 0.1891 ++ 1387.623058 m 0.9579 272 | 1/13
15 h-m-p 0.0555 0.2775 0.6006 +YC 1387.615764 1 0.1393 303 | 1/13
16 h-m-p 0.0616 0.3079 0.1495 ++ 1387.593847 m 0.3079 331 | 2/13
17 h-m-p 0.1758 7.9313 0.2607 YC 1387.576814 1 0.4108 360 | 2/13
18 h-m-p 1.0675 8.0000 0.1003 CC 1387.560636 1 0.4060 389 | 2/13
19 h-m-p 0.7468 8.0000 0.0545 YC 1387.558321 1 0.5689 417 | 2/13
20 h-m-p 1.6000 8.0000 0.0091 YC 1387.557806 1 0.9134 445 | 2/13
21 h-m-p 1.6000 8.0000 0.0027 Y 1387.557754 0 1.1949 472 | 2/13
22 h-m-p 1.6000 8.0000 0.0003 Y 1387.557753 0 1.0636 499 | 2/13
23 h-m-p 1.6000 8.0000 0.0000 Y 1387.557753 0 1.0355 526 | 2/13
24 h-m-p 1.6000 8.0000 0.0000 C 1387.557753 0 1.6000 553 | 2/13
25 h-m-p 1.6000 8.0000 0.0000 C 1387.557753 0 0.4000 580 | 2/13
26 h-m-p 0.6552 8.0000 0.0000 -Y 1387.557753 0 0.0410 608 | 2/13
27 h-m-p 0.0442 8.0000 0.0000 -Y 1387.557753 0 0.0028 636
Out..
lnL = -1387.557753
637 lfun, 2548 eigenQcodon, 13377 P(t)
Time used: 0:15
Model 7: beta
TREE # 1
(1, (2, 3), (4, 5)); MP score: 102
0.082890 0.070194 0.037552 0.015008 0.144345 0.119390 0.068009 2.353506 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.481150
np = 10
lnL0 = -1397.205770
Iterating by ming2
Initial: fx= 1397.205770
x= 0.08289 0.07019 0.03755 0.01501 0.14435 0.11939 0.06801 2.35351 0.66567 1.54913
1 h-m-p 0.0000 0.0073 54.8117 +++CYC 1396.240108 2 0.0007 21 | 0/10
2 h-m-p 0.0006 0.0030 52.2298 CYCCC 1395.375713 4 0.0009 41 | 0/10
3 h-m-p 0.0004 0.0060 112.4870 +YYC 1393.355713 2 0.0014 57 | 0/10
4 h-m-p 0.0001 0.0007 366.9367 +YCYCCC 1391.100337 5 0.0004 79 | 0/10
5 h-m-p 0.0004 0.0020 181.3402 CCCCC 1389.862143 4 0.0005 100 | 0/10
6 h-m-p 0.0046 0.0229 9.7899 YC 1389.826978 1 0.0008 114 | 0/10
7 h-m-p 0.0015 0.0400 5.4121 CC 1389.809580 1 0.0013 129 | 0/10
8 h-m-p 0.0007 0.1256 9.7680 +CCC 1389.732015 2 0.0037 147 | 0/10
9 h-m-p 0.0012 0.1106 29.2136 ++CCCC 1388.458480 3 0.0211 168 | 0/10
10 h-m-p 0.4303 2.1513 0.1850 CCCC 1388.195948 3 0.6661 187 | 0/10
11 h-m-p 0.3884 8.0000 0.3172 CC 1388.142434 1 0.4784 212 | 0/10
12 h-m-p 0.6608 7.9364 0.2297 CYC 1388.096168 2 0.6442 238 | 0/10
13 h-m-p 1.1749 8.0000 0.1259 +YYC 1388.013890 2 3.9560 264 | 0/10
14 h-m-p 1.2987 6.4934 0.2463 YYCC 1387.965999 3 0.8609 291 | 0/10
15 h-m-p 1.6000 8.0000 0.0380 YC 1387.948761 1 0.8884 315 | 0/10
16 h-m-p 1.6000 8.0000 0.0182 YC 1387.947888 1 0.8861 339 | 0/10
17 h-m-p 1.6000 8.0000 0.0033 YC 1387.947845 1 0.9214 363 | 0/10
18 h-m-p 1.6000 8.0000 0.0018 Y 1387.947843 0 0.7812 386 | 0/10
19 h-m-p 1.6000 8.0000 0.0005 Y 1387.947843 0 0.7562 409 | 0/10
20 h-m-p 1.6000 8.0000 0.0000 Y 1387.947843 0 0.9652 432 | 0/10
21 h-m-p 1.6000 8.0000 0.0000 Y 1387.947843 0 1.2543 455 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1387.947843 0 0.6855 478 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/10
24 h-m-p 0.0160 8.0000 0.0000 ------------- | 0/10
25 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -1387.947843
584 lfun, 6424 eigenQcodon, 40880 P(t)
Time used: 0:28
Model 8: beta&w>1
TREE # 1
(1, (2, 3), (4, 5)); MP score: 102
initial w for M8:NSbetaw>1 reset.
0.082890 0.070194 0.037552 0.015008 0.144345 0.119390 0.068009 2.354849 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.134414
np = 12
lnL0 = -1400.620322
Iterating by ming2
Initial: fx= 1400.620322
x= 0.08289 0.07019 0.03755 0.01501 0.14435 0.11939 0.06801 2.35485 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0010 131.2099 ++++ 1393.521369 m 0.0010 31 | 1/12
2 h-m-p 0.0002 0.0009 70.6190 +YCYCCC 1392.579355 5 0.0005 67 | 1/12
3 h-m-p 0.0007 0.0046 50.3753 YCCCC 1391.536315 4 0.0013 100 | 1/12
4 h-m-p 0.0011 0.0056 61.2450 YYCC 1390.915065 3 0.0008 130 | 1/12
5 h-m-p 0.0030 0.0207 16.9147 YCC 1390.776591 2 0.0013 159 | 0/12
6 h-m-p 0.0008 0.0249 27.7555 CYC 1390.613915 2 0.0006 188 | 0/12
7 h-m-p 0.0032 0.0840 4.9537 YC 1390.587938 1 0.0022 216 | 0/12
8 h-m-p 0.0028 0.1203 3.9752 +CC 1390.509502 1 0.0110 246 | 0/12
9 h-m-p 0.0012 0.0133 37.4866 ++ 1388.994766 m 0.0133 273 | 0/12
10 h-m-p 0.0000 0.0000 59.6005
h-m-p: 0.00000000e+00 0.00000000e+00 5.96005067e+01 1388.994766
.. | 0/12
11 h-m-p 0.0000 0.0005 59.9600 ++CCCCC 1388.594538 4 0.0002 334 | 0/12
12 h-m-p 0.0000 0.0001 83.6059 ++ 1388.236855 m 0.0001 361 | 1/12
13 h-m-p 0.0004 0.0059 30.3004 CYC 1388.107293 2 0.0004 391 | 1/12
14 h-m-p 0.0010 0.0203 11.6829 CCC 1388.058522 2 0.0009 421 | 1/12
15 h-m-p 0.0042 0.0975 2.4179 CC 1388.055212 1 0.0011 449 | 1/12
16 h-m-p 0.0030 0.1437 0.9145 YC 1388.054556 1 0.0013 476 | 1/12
17 h-m-p 0.0012 0.3060 0.9720 +CC 1388.051081 1 0.0071 505 | 1/12
18 h-m-p 0.0041 0.1806 1.6901 YC 1388.049167 1 0.0027 532 | 1/12
19 h-m-p 0.0013 0.1802 3.4864 +CC 1388.041665 1 0.0055 561 | 1/12
20 h-m-p 0.0064 0.9006 3.0057 +YC 1387.991454 1 0.0453 589 | 1/12
21 h-m-p 0.5532 7.3287 0.2463 CC 1387.950745 1 0.5815 617 | 1/12
22 h-m-p 1.6000 8.0000 0.0613 YC 1387.948047 1 1.1008 644 | 1/12
23 h-m-p 1.6000 8.0000 0.0005 Y 1387.948033 0 1.0746 670 | 1/12
24 h-m-p 0.9253 8.0000 0.0005 C 1387.948032 0 1.1533 696 | 1/12
25 h-m-p 1.6000 8.0000 0.0004 Y 1387.948032 0 3.8276 722 | 1/12
26 h-m-p 0.8532 8.0000 0.0017 ++ 1387.948027 m 8.0000 748 | 1/12
27 h-m-p 0.0364 1.3125 0.3732 +++ 1387.947932 m 1.3125 775 | 2/12
28 h-m-p 0.9430 8.0000 0.0064 C 1387.947885 0 0.9986 801 | 2/12
29 h-m-p 1.6000 8.0000 0.0001 Y 1387.947885 0 0.9767 826 | 2/12
30 h-m-p 1.6000 8.0000 0.0000 C 1387.947885 0 1.4594 851 | 2/12
31 h-m-p 1.6000 8.0000 0.0000 -C 1387.947885 0 0.1000 877 | 2/12
32 h-m-p 0.1336 8.0000 0.0000 --------------Y 1387.947885 0 0.0000 916
Out..
lnL = -1387.947885
917 lfun, 11004 eigenQcodon, 70609 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1396.865191 S = -1314.564262 -74.958899
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 112 patterns 0:51
did 20 / 112 patterns 0:52
did 30 / 112 patterns 0:52
did 40 / 112 patterns 0:52
did 50 / 112 patterns 0:52
did 60 / 112 patterns 0:52
did 70 / 112 patterns 0:52
did 80 / 112 patterns 0:53
did 90 / 112 patterns 0:53
did 100 / 112 patterns 0:53
did 110 / 112 patterns 0:53
did 112 / 112 patterns 0:53
Time used: 0:53
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=216
D_melanogaster_AANATL2-PA MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAE
D_sechellia_AANATL2-PA MSAITIRAMTVGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
D_simulans_AANATL2-PA MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE
D_yakuba_AANATL2-PA MSAISIRAMRMEDFDEVEAFLAEHFFKQEPLMLIPQEDPKQSEVIPAEAE
D_erecta_AANATL2-PA MSAITIRAMRMEDYEEVEAFLAVHFFKQEPLMLIPQEDPRQSEVIPAEAE
****:**** : *::******* ****************:**** .**:*
D_melanogaster_AANATL2-PA LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCLL
D_sechellia_AANATL2-PA LHRALIPQDLSLVAVDGQRIVGLVLAGELVPEDLEREYQEAEQKEITCLL
D_simulans_AANATL2-PA LHRALIPQDLSLVAVDGQRIVGVVLAGELVPEDLEREYQEAEQKEITCLL
D_yakuba_AANATL2-PA LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEHKEAVCLL
D_erecta_AANATL2-PA LHRSLIPQDLSLVAVDGQRIVGVALAGEQVPEDLEREYQEAEHKEVACLL
***:*************:****:.**** *************:** .***
D_melanogaster_AANATL2-PA DKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEAT
D_sechellia_AANATL2-PA DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
D_simulans_AANATL2-PA DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT
D_yakuba_AANATL2-PA DKIHKFLAGIERQANIFEHYGVKRALYLYMLGVDTSVRRQRVGTRLVEAT
D_erecta_AANATL2-PA DKIHKFLAGIERQANIFEHYGVERALYLYMLGVDTSVRRQRVGTRLVEAT
*********** *****:****.***********.*:*************
D_melanogaster_AANATL2-PA IELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVL
D_sechellia_AANATL2-PA IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
D_simulans_AANATL2-PA IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL
D_yakuba_AANATL2-PA IELGRQRGYPLVTSTCTNMNSRRLMTALHMECVLTKDYADYKDEHGEIVL
D_erecta_AANATL2-PA IELGRQRGYSVVTSTCTNMNSRRLMTALHMECVLSKDYADYKDEHGQIVL
********:.:*****:* **:******:***:*:***********:***
D_melanogaster_AANATL2-PA RASEPHTSASVVAIRL
D_sechellia_AANATL2-PA RASEPHTSASVVAIRL
D_simulans_AANATL2-PA RASEPHTSASVVAIRL
D_yakuba_AANATL2-PA QASEPHTSASVVAIRL
D_erecta_AANATL2-PA RASEPHTSASVLAIRL
:**********:****
>D_melanogaster_AANATL2-PA ATGTCAGCGATCACCATACGCGCCATGACAATCGGGGATTACGAGGAGGT CGAGGCCTTTCTCGCAGTGCACTTCTTCAAGCAGGAGCCGCTAATGCTGA TCCCCCAGGAGGATCCCAAGCAGAGCGAGGTGTCTTCCGCGGAGGCTGAG CTACACCGCTCGCTCATACCCCAGGATCTCTCCCTGGTGGCCGTCGACGG GGAGCGCATTGTGGGCGTGGTTCTGGCCGGTGAATTGGTACCCGAGGATC TGGAGAGGGAGTACCAGGAGGCTGAGCAGAAGGAGATCACGTGCCTGCTG GACAAGATACACAAGTTTCTGGCCGGGATCGAGCGGCAGGCCAATATCTT CAAGCACTACGGAGTGGAGCGGGCGCTTTACCTGTACATGCTCGGTGTGG ACGTGTCCATTCGACGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC ATTGAGCTGGGTCGCCAGCGTGGATTTCCCGTCGTCACATCTACCTGCAG CAACCAGAACTCCAAACGCCTTATGACCGCCCTAAACATGGAGTGCATAC TCACAAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGACTG >D_sechellia_AANATL2-PA ATGTCAGCGATCACCATACGCGCCATGACAGTTGGGGATTACGAGGAGGT CGAGGCCTTTCTCGCAGTGCATTTCTTCAAGCAGGAGCCGCTGATGCTGA TCCCCCAGGAGGATCCCAAGCAGAGCGAAGTGTCTCCTGCGGAGACTGAG CTCCATCGTGCGCTCATACCCCAGGATCTTTCTCTGGTGGCCGTCGACGG GCAGCGCATTGTCGGCCTGGTTCTGGCCGGTGAACTGGTGCCCGAGGATC TGGAGAGGGAGTACCAGGAGGCGGAGCAGAAGGAGATCACGTGCCTGCTG GACAAGATACACAAGTTTCTGGCCGGGATCGAGCTGCAGGCTAACATATT CAAGCACTACGGAGTGGATCGGGCGCTGTACCTCTACATGCTCGGTGTGG ACACCTCCATTCGGCGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACA ATTGAGCTGGGTCGCCAGCGGGGATTCCCCGTCGTCACATCTACCTGCAG CAACCTGAACTCCAAACGCCTTATGACCGCCCTGAACATGGAGTGCATAC TCACGAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGGCTG >D_simulans_AANATL2-PA ATGTCAGCGATCACCATACGCGCCATGACAATTGGGGATTACGAGGAGGT CGAGGCCTTTCTCGCAGTGCATTTCTTCAAGCAGGAGCCGCTGATGCTGA TCCCCCAGGAGGATCCCAAGCAGAGCGAAGTGTCTCCTGCGGAGACTGAG CTCCATCGTGCGCTCATACCCCAGGATCTCTCCCTGGTGGCCGTCGACGG GCAGCGCATTGTGGGCGTGGTTCTGGCCGGTGAACTGGTGCCCGAGGATC TGGAGAGGGAGTACCAGGAGGCGGAGCAGAAGGAGATCACGTGCCTGCTG GACAAGATACACAAGTTTCTGGCCGGGATCGAGCTGCAAGCCAACATATT CAAGCACTACGGAGTGGATCGGGCGCTGTACCTCTACATGCTCGGTGTGG ACACGTCCATTCGGCGGCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC ATTGAGCTGGGTCGCCAGCGGGGATTCCCCGTCGTCACATCTACCTGCAG CAACCTGAACTCCAAACGCCTTATGACCGCCCTGAACATGGAGTGCATAC TCACGAAGGATTACGCGGACTACAAGGATGAGCACGGGGAGATCGTCCTG CGGGCATCCGAGCCACACACCTCCGCCAGTGTCGTGGCCATACGGCTG >D_yakuba_AANATL2-PA ATGTCAGCGATCAGCATACGCGCCATGAGAATGGAGGACTTCGACGAGGT CGAGGCCTTTCTCGCGGAGCACTTCTTCAAGCAGGAGCCGCTGATGCTGA TCCCGCAGGAGGACCCCAAGCAGAGCGAGGTGATTCCCGCCGAGGCAGAG CTGCACCGCTCGCTCATACCCCAGGATCTCTCACTGGTGGCCGTCGACGG GGAGCGCATTGTGGGCGTCGTTCTGGCCGGTGAACTGGTGCCCGAGGATC TGGAGCGGGAGTACCAGGAGGCTGAGCACAAGGAGGCGGTGTGCCTGCTG GACAAGATACACAAGTTTCTGGCCGGCATCGAGCGGCAGGCCAACATCTT CGAGCACTACGGTGTGAAGCGGGCCCTCTACCTCTACATGCTCGGTGTGG ACACTTCCGTGCGGCGCCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC ATTGAGCTGGGTCGCCAGCGGGGCTACCCCCTTGTGACGTCTACCTGCAC CAACATGAACTCCCGGCGCCTCATGACCGCCCTGCACATGGAGTGCGTCC TCACGAAGGATTACGCGGACTACAAGGACGAGCACGGGGAGATCGTCCTG CAGGCATCCGAACCCCACACCTCCGCCAGTGTCGTGGCCATACGACTG >D_erecta_AANATL2-PA ATGTCAGCGATCACCATACGCGCCATGAGAATGGAGGATTACGAGGAGGT CGAGGCCTTTCTCGCGGTGCACTTCTTCAAGCAGGAGCCGCTGATGCTGA TCCCCCAGGAGGATCCCAGGCAGAGCGAGGTGATTCCCGCCGAGGCTGAG CTGCACCGCTCGCTCATTCCCCAGGATCTCTCCCTGGTGGCCGTCGACGG GCAGCGCATTGTGGGCGTGGCTCTGGCTGGGGAACAGGTGCCCGAGGACC TGGAGAGGGAGTACCAGGAGGCTGAGCACAAGGAGGTCGCGTGCCTGCTG GACAAGATACACAAGTTTCTGGCCGGGATCGAGCGGCAGGCCAACATCTT CGAGCACTACGGAGTGGAGCGGGCCCTCTACCTCTACATGCTCGGTGTGG ACACCTCCGTGCGGCGTCAGAGAGTGGGCACCCGCCTGGTGGAGGCCACC ATTGAGCTGGGTCGCCAGCGGGGATACTCCGTTGTGACATCCACCTGCAC CAACATGAACTCCAGGCGCCTCATGACCGCCCTGCACATGGAGTGCGTCC TCTCGAAGGACTACGCGGACTACAAGGACGAGCACGGGCAGATCGTCCTG CGGGCATCCGAACCCCACACCTCCGCCAGTGTCTTGGCCATACGACTG
>D_melanogaster_AANATL2-PA MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAE LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEQKEITCLL DKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEAT IELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVL RASEPHTSASVVAIRL >D_sechellia_AANATL2-PA MSAITIRAMTVGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE LHRALIPQDLSLVAVDGQRIVGLVLAGELVPEDLEREYQEAEQKEITCLL DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL RASEPHTSASVVAIRL >D_simulans_AANATL2-PA MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSPAETE LHRALIPQDLSLVAVDGQRIVGVVLAGELVPEDLEREYQEAEQKEITCLL DKIHKFLAGIELQANIFKHYGVDRALYLYMLGVDTSIRRQRVGTRLVEAT IELGRQRGFPVVTSTCSNLNSKRLMTALNMECILTKDYADYKDEHGEIVL RASEPHTSASVVAIRL >D_yakuba_AANATL2-PA MSAISIRAMRMEDFDEVEAFLAEHFFKQEPLMLIPQEDPKQSEVIPAEAE LHRSLIPQDLSLVAVDGERIVGVVLAGELVPEDLEREYQEAEHKEAVCLL DKIHKFLAGIERQANIFEHYGVKRALYLYMLGVDTSVRRQRVGTRLVEAT IELGRQRGYPLVTSTCTNMNSRRLMTALHMECVLTKDYADYKDEHGEIVL QASEPHTSASVVAIRL >D_erecta_AANATL2-PA MSAITIRAMRMEDYEEVEAFLAVHFFKQEPLMLIPQEDPRQSEVIPAEAE LHRSLIPQDLSLVAVDGQRIVGVALAGEQVPEDLEREYQEAEHKEVACLL DKIHKFLAGIERQANIFEHYGVERALYLYMLGVDTSVRRQRVGTRLVEAT IELGRQRGYSVVTSTCTNMNSRRLMTALHMECVLSKDYADYKDEHGQIVL RASEPHTSASVLAIRL
#NEXUS
[ID: 2482720199]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_AANATL2-PA
D_sechellia_AANATL2-PA
D_simulans_AANATL2-PA
D_yakuba_AANATL2-PA
D_erecta_AANATL2-PA
;
end;
begin trees;
translate
1 D_melanogaster_AANATL2-PA,
2 D_sechellia_AANATL2-PA,
3 D_simulans_AANATL2-PA,
4 D_yakuba_AANATL2-PA,
5 D_erecta_AANATL2-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03005137,(2:0.014875,3:0.006230362)1.000:0.02983241,(4:0.04960482,5:0.02699478)1.000:0.06626716);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03005137,(2:0.014875,3:0.006230362):0.02983241,(4:0.04960482,5:0.02699478):0.06626716);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1484.94 -1494.53
2 -1484.95 -1493.99
--------------------------------------
TOTAL -1484.95 -1494.29
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/2/AANATL2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.231392 0.001117 0.169930 0.293619 0.228649 1218.57 1219.97 1.000
r(A<->C){all} 0.084643 0.000871 0.034808 0.147252 0.081325 816.41 1005.45 1.000
r(A<->G){all} 0.201219 0.001870 0.119448 0.283015 0.198436 665.35 732.17 1.001
r(A<->T){all} 0.156534 0.002253 0.068148 0.248888 0.153326 804.07 863.29 1.000
r(C<->G){all} 0.121737 0.000879 0.069276 0.182365 0.119716 827.36 852.23 1.000
r(C<->T){all} 0.345141 0.003412 0.234909 0.458154 0.342609 531.66 598.45 1.000
r(G<->T){all} 0.090725 0.001065 0.033651 0.156954 0.087223 1015.22 1015.60 1.000
pi(A){all} 0.208111 0.000226 0.180470 0.239449 0.207801 1102.61 1108.55 1.000
pi(C){all} 0.297055 0.000285 0.263879 0.329969 0.296898 888.63 1030.16 1.000
pi(G){all} 0.314855 0.000305 0.280120 0.348069 0.314520 934.91 1117.15 1.000
pi(T){all} 0.179979 0.000202 0.152208 0.208811 0.179672 1162.88 1222.54 1.000
alpha{1,2} 0.245096 0.067406 0.000190 0.707010 0.172594 1165.36 1212.08 1.000
alpha{3} 1.366100 0.415777 0.310552 2.630068 1.251412 1235.16 1314.08 1.001
pinvar{all} 0.150071 0.012539 0.000012 0.365107 0.126820 1218.20 1293.60 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/2/AANATL2-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 216
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 3 2 2 2 2 | Ser TCT 2 3 2 1 0 | Tyr TAT 0 0 0 0 0 | Cys TGT 0 0 0 0 0
TTC 3 4 4 4 3 | TCC 6 4 5 4 7 | TAC 7 7 7 7 8 | TGC 3 3 3 3 3
Leu TTA 0 0 0 0 0 | TCA 1 1 1 2 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 0 0 0 1 | TCG 1 0 0 1 2 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 1 1 0 | Pro CCT 0 1 1 0 0 | His CAT 0 2 2 0 0 | Arg CGT 1 1 1 0 1
CTC 5 6 7 8 8 | CCC 5 5 5 6 6 | CAC 6 4 4 8 8 | CGC 7 6 5 7 6
CTA 3 0 0 0 0 | CCA 1 1 1 0 0 | Gln CAA 0 0 1 0 0 | CGA 2 0 0 1 1
CTG 12 18 17 15 14 | CCG 1 1 1 2 1 | CAG 10 10 9 9 11 | CGG 3 5 6 6 5
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 4 3 4 | Thr ACT 0 1 1 1 0 | Asn AAT 1 0 0 0 0 | Ser AGT 1 1 1 1 1
ATC 7 5 5 5 5 | ACC 6 6 6 6 8 | AAC 3 4 4 3 3 | AGC 2 2 2 2 1
ATA 5 6 6 4 3 | ACA 3 3 2 0 1 | Lys AAA 1 1 1 0 0 | Arg AGA 1 1 1 2 2
Met ATG 6 6 6 8 8 | ACG 1 2 3 2 0 | AAG 8 8 8 8 6 | AGG 1 1 1 0 3
----------------------------------------------------------------------------------------------------------------------
Val GTT 1 2 1 1 1 | Ala GCT 2 1 0 1 4 | Asp GAT 5 6 7 3 3 | Gly GGT 3 3 3 4 2
GTC 6 7 6 6 6 | GCC 10 9 10 12 11 | GAC 5 5 4 8 7 | GGC 2 2 2 4 2
GTA 1 0 0 0 0 | GCA 2 2 2 2 1 | Glu GAA 1 2 2 2 2 | GGA 2 2 2 0 2
GTG 11 9 11 12 12 | GCG 4 6 6 4 4 | GAG 23 20 20 23 22 | GGG 4 4 4 2 4
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_AANATL2-PA
position 1: T:0.12500 C:0.26852 A:0.22685 G:0.37963
position 2: T:0.31944 C:0.20833 A:0.32407 G:0.14815
position 3: T:0.11111 C:0.38426 A:0.10648 G:0.39815
Average T:0.18519 C:0.28704 A:0.21914 G:0.30864
#2: D_sechellia_AANATL2-PA
position 1: T:0.11111 C:0.28704 A:0.23148 G:0.37037
position 2: T:0.32407 C:0.21296 A:0.31944 G:0.14352
position 3: T:0.12963 C:0.36574 A:0.08796 G:0.41667
Average T:0.18827 C:0.28858 A:0.21296 G:0.31019
#3: D_simulans_AANATL2-PA
position 1: T:0.11111 C:0.28241 A:0.23611 G:0.37037
position 2: T:0.32407 C:0.21296 A:0.31944 G:0.14352
position 3: T:0.12037 C:0.36574 A:0.08796 G:0.42593
Average T:0.18519 C:0.28704 A:0.21451 G:0.31327
#4: D_yakuba_AANATL2-PA
position 1: T:0.11111 C:0.29167 A:0.20833 G:0.38889
position 2: T:0.31944 C:0.20370 A:0.32870 G:0.14815
position 3: T:0.08333 C:0.43056 A:0.06019 G:0.42593
Average T:0.17130 C:0.30864 A:0.19907 G:0.32099
#5: D_erecta_AANATL2-PA
position 1: T:0.12500 C:0.28241 A:0.20833 G:0.38426
position 2: T:0.31019 C:0.21296 A:0.32407 G:0.15278
position 3: T:0.08333 C:0.42593 A:0.06019 G:0.43056
Average T:0.17284 C:0.30710 A:0.19753 G:0.32253
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 11 | Ser S TCT 8 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 26 | TAC 36 | TGC 15
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 2 | TCG 4 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 2 | His H CAT 4 | Arg R CGT 4
CTC 34 | CCC 27 | CAC 30 | CGC 31
CTA 3 | CCA 3 | Gln Q CAA 1 | CGA 4
CTG 76 | CCG 6 | CAG 49 | CGG 25
------------------------------------------------------------------------------
Ile I ATT 17 | Thr T ACT 3 | Asn N AAT 1 | Ser S AGT 5
ATC 27 | ACC 32 | AAC 17 | AGC 9
ATA 24 | ACA 9 | Lys K AAA 3 | Arg R AGA 7
Met M ATG 34 | ACG 8 | AAG 38 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 8 | Asp D GAT 24 | Gly G GGT 15
GTC 31 | GCC 52 | GAC 29 | GGC 12
GTA 1 | GCA 9 | Glu E GAA 9 | GGA 8
GTG 55 | GCG 24 | GAG 108 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11667 C:0.28241 A:0.22222 G:0.37870
position 2: T:0.31944 C:0.21019 A:0.32315 G:0.14722
position 3: T:0.10556 C:0.39444 A:0.08056 G:0.41944
Average T:0.18056 C:0.29568 A:0.20864 G:0.31512
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_AANATL2-PA
D_sechellia_AANATL2-PA 0.1255 (0.0234 0.1863)
D_simulans_AANATL2-PA 0.1141 (0.0188 0.1645) 0.0724 (0.0041 0.0572)
D_yakuba_AANATL2-PA 0.2512 (0.0654 0.2605) 0.2510 (0.0708 0.2823) 0.2504 (0.0674 0.2692)
D_erecta_AANATL2-PA 0.2837 (0.0614 0.2163) 0.2626 (0.0622 0.2370) 0.2719 (0.0589 0.2165) 0.2495 (0.0357 0.1433)
Model 0: one-ratio
TREE # 1: (1, (2, 3), (4, 5)); MP score: 102
lnL(ntime: 7 np: 9): -1391.937253 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.083546 0.078988 0.041469 0.012730 0.171620 0.130087 0.077333 2.356640 0.128586
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.59577
(1: 0.083546, (2: 0.041469, 3: 0.012730): 0.078988, (4: 0.130087, 5: 0.077333): 0.171620);
(D_melanogaster_AANATL2-PA: 0.083546, (D_sechellia_AANATL2-PA: 0.041469, D_simulans_AANATL2-PA: 0.012730): 0.078988, (D_yakuba_AANATL2-PA: 0.130087, D_erecta_AANATL2-PA: 0.077333): 0.171620);
Detailed output identifying parameters
kappa (ts/tv) = 2.35664
omega (dN/dS) = 0.12859
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.084 522.2 125.8 0.1286 0.0120 0.0935 6.3 11.8
6..7 0.079 522.2 125.8 0.1286 0.0114 0.0884 5.9 11.1
7..2 0.041 522.2 125.8 0.1286 0.0060 0.0464 3.1 5.8
7..3 0.013 522.2 125.8 0.1286 0.0018 0.0143 1.0 1.8
6..8 0.172 522.2 125.8 0.1286 0.0247 0.1922 12.9 24.2
8..4 0.130 522.2 125.8 0.1286 0.0187 0.1457 9.8 18.3
8..5 0.077 522.2 125.8 0.1286 0.0111 0.0866 5.8 10.9
tree length for dN: 0.0858
tree length for dS: 0.6671
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 102
lnL(ntime: 7 np: 10): -1389.016799 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.086698 0.082732 0.042801 0.013493 0.181766 0.134640 0.080180 2.369040 0.896451 0.067381
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.62231
(1: 0.086698, (2: 0.042801, 3: 0.013493): 0.082732, (4: 0.134640, 5: 0.080180): 0.181766);
(D_melanogaster_AANATL2-PA: 0.086698, (D_sechellia_AANATL2-PA: 0.042801, D_simulans_AANATL2-PA: 0.013493): 0.082732, (D_yakuba_AANATL2-PA: 0.134640, D_erecta_AANATL2-PA: 0.080180): 0.181766);
Detailed output identifying parameters
kappa (ts/tv) = 2.36904
dN/dS (w) for site classes (K=2)
p: 0.89645 0.10355
w: 0.06738 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.087 522.2 125.8 0.1640 0.0145 0.0886 7.6 11.1
6..7 0.083 522.2 125.8 0.1640 0.0139 0.0845 7.2 10.6
7..2 0.043 522.2 125.8 0.1640 0.0072 0.0437 3.7 5.5
7..3 0.013 522.2 125.8 0.1640 0.0023 0.0138 1.2 1.7
6..8 0.182 522.2 125.8 0.1640 0.0304 0.1857 15.9 23.4
8..4 0.135 522.2 125.8 0.1640 0.0226 0.1376 11.8 17.3
8..5 0.080 522.2 125.8 0.1640 0.0134 0.0819 7.0 10.3
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 102
lnL(ntime: 7 np: 12): -1389.016799 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.086698 0.082732 0.042801 0.013493 0.181766 0.134640 0.080180 2.369040 0.896451 0.018517 0.067381 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.62231
(1: 0.086698, (2: 0.042801, 3: 0.013493): 0.082732, (4: 0.134640, 5: 0.080180): 0.181766);
(D_melanogaster_AANATL2-PA: 0.086698, (D_sechellia_AANATL2-PA: 0.042801, D_simulans_AANATL2-PA: 0.013493): 0.082732, (D_yakuba_AANATL2-PA: 0.134640, D_erecta_AANATL2-PA: 0.080180): 0.181766);
Detailed output identifying parameters
kappa (ts/tv) = 2.36904
dN/dS (w) for site classes (K=3)
p: 0.89645 0.01852 0.08503
w: 0.06738 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.087 522.2 125.8 0.1640 0.0145 0.0886 7.6 11.1
6..7 0.083 522.2 125.8 0.1640 0.0139 0.0845 7.2 10.6
7..2 0.043 522.2 125.8 0.1640 0.0072 0.0437 3.7 5.5
7..3 0.013 522.2 125.8 0.1640 0.0023 0.0138 1.2 1.7
6..8 0.182 522.2 125.8 0.1640 0.0304 0.1857 15.9 23.4
8..4 0.135 522.2 125.8 0.1640 0.0226 0.1376 11.8 17.3
8..5 0.080 522.2 125.8 0.1640 0.0134 0.0819 7.0 10.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_AANATL2-PA)
Pr(w>1) post mean +- SE for w
45 S 0.517 1.494 +- 1.069
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.969 0.031 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.795 0.115 0.036 0.018 0.011 0.008 0.006 0.005 0.004 0.003
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005 0.473
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.023 0.304 0.192
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 102
lnL(ntime: 7 np: 13): -1387.557753 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.085915 0.081288 0.042305 0.013117 0.179569 0.134888 0.078550 2.353506 0.442059 0.201922 0.000001 0.000001 0.400447
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.61563
(1: 0.085915, (2: 0.042305, 3: 0.013117): 0.081288, (4: 0.134888, 5: 0.078550): 0.179569);
(D_melanogaster_AANATL2-PA: 0.085915, (D_sechellia_AANATL2-PA: 0.042305, D_simulans_AANATL2-PA: 0.013117): 0.081288, (D_yakuba_AANATL2-PA: 0.134888, D_erecta_AANATL2-PA: 0.078550): 0.179569);
Detailed output identifying parameters
kappa (ts/tv) = 2.35351
dN/dS (w) for site classes (K=3)
p: 0.44206 0.20192 0.35602
w: 0.00000 0.00000 0.40045
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.086 522.3 125.7 0.1426 0.0132 0.0927 6.9 11.7
6..7 0.081 522.3 125.7 0.1426 0.0125 0.0877 6.5 11.0
7..2 0.042 522.3 125.7 0.1426 0.0065 0.0456 3.4 5.7
7..3 0.013 522.3 125.7 0.1426 0.0020 0.0142 1.1 1.8
6..8 0.180 522.3 125.7 0.1426 0.0276 0.1937 14.4 24.4
8..4 0.135 522.3 125.7 0.1426 0.0207 0.1455 10.8 18.3
8..5 0.079 522.3 125.7 0.1426 0.0121 0.0847 6.3 10.7
Naive Empirical Bayes (NEB) analysis
Time used: 0:15
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 102
check convergence..
lnL(ntime: 7 np: 10): -1387.947843 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.085945 0.081561 0.042392 0.013166 0.179776 0.134524 0.078931 2.354849 0.240105 1.389537
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.61630
(1: 0.085945, (2: 0.042392, 3: 0.013166): 0.081561, (4: 0.134524, 5: 0.078931): 0.179776);
(D_melanogaster_AANATL2-PA: 0.085945, (D_sechellia_AANATL2-PA: 0.042392, D_simulans_AANATL2-PA: 0.013166): 0.081561, (D_yakuba_AANATL2-PA: 0.134524, D_erecta_AANATL2-PA: 0.078931): 0.179776);
Detailed output identifying parameters
kappa (ts/tv) = 2.35485
Parameters in M7 (beta):
p = 0.24010 q = 1.38954
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00024 0.00200 0.00812 0.02325 0.05416 0.11062 0.20740 0.37038 0.66494
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.086 522.3 125.7 0.1441 0.0133 0.0924 7.0 11.6
6..7 0.082 522.3 125.7 0.1441 0.0126 0.0876 6.6 11.0
7..2 0.042 522.3 125.7 0.1441 0.0066 0.0456 3.4 5.7
7..3 0.013 522.3 125.7 0.1441 0.0020 0.0141 1.1 1.8
6..8 0.180 522.3 125.7 0.1441 0.0278 0.1932 14.5 24.3
8..4 0.135 522.3 125.7 0.1441 0.0208 0.1446 10.9 18.2
8..5 0.079 522.3 125.7 0.1441 0.0122 0.0848 6.4 10.7
Time used: 0:28
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), (4, 5)); MP score: 102
lnL(ntime: 7 np: 12): -1387.947885 +0.000000
6..1 6..7 7..2 7..3 6..8 8..4 8..5
0.085945 0.081561 0.042392 0.013166 0.179776 0.134525 0.078932 2.354850 0.999990 0.240109 1.389632 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.61630
(1: 0.085945, (2: 0.042392, 3: 0.013166): 0.081561, (4: 0.134525, 5: 0.078932): 0.179776);
(D_melanogaster_AANATL2-PA: 0.085945, (D_sechellia_AANATL2-PA: 0.042392, D_simulans_AANATL2-PA: 0.013166): 0.081561, (D_yakuba_AANATL2-PA: 0.134525, D_erecta_AANATL2-PA: 0.078932): 0.179776);
Detailed output identifying parameters
kappa (ts/tv) = 2.35485
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.24011 q = 1.38963
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00024 0.00200 0.00812 0.02325 0.05416 0.11061 0.20739 0.37037 0.66491 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.086 522.3 125.7 0.1441 0.0133 0.0924 7.0 11.6
6..7 0.082 522.3 125.7 0.1441 0.0126 0.0876 6.6 11.0
7..2 0.042 522.3 125.7 0.1441 0.0066 0.0456 3.4 5.7
7..3 0.013 522.3 125.7 0.1441 0.0020 0.0141 1.1 1.8
6..8 0.180 522.3 125.7 0.1441 0.0278 0.1932 14.5 24.3
8..4 0.135 522.3 125.7 0.1441 0.0208 0.1446 10.9 18.2
8..5 0.079 522.3 125.7 0.1441 0.0122 0.0848 6.4 10.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_AANATL2-PA)
Pr(w>1) post mean +- SE for w
45 S 0.706 1.360 +- 0.741
135 V 0.537 1.120 +- 0.692
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.998
p : 0.950 0.050 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.005 0.049 0.117 0.162 0.175 0.170 0.162 0.160
ws: 0.883 0.091 0.016 0.005 0.002 0.001 0.001 0.001 0.000 0.000
Time used: 0:53
Model 1: NearlyNeutral -1389.016799 Model 2: PositiveSelection -1389.016799 Model 0: one-ratio -1391.937253 Model 3: discrete -1387.557753 Model 7: beta -1387.947843 Model 8: beta&w>1 -1387.947885 Model 0 vs 1 5.840908000000127 Model 2 vs 1 0.0 Model 8 vs 7 8.400000024266774E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
