Back

Lmpt-PE - ClustalW2

Download 
--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Mon Nov 21 14:18:48 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/295/Lmpt-PE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1995.72         -2013.26
2      -1995.78         -2016.93
--------------------------------------
TOTAL    -1995.75         -2016.26
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.834238    0.012002    0.627644    1.051122    0.825141   1419.53   1460.27    1.000
r(A<->C){all}   0.080960    0.000492    0.040268    0.124935    0.079031    985.86   1102.20    1.000
r(A<->G){all}   0.220212    0.002522    0.128312    0.320676    0.217389    539.12    646.88    1.000
r(A<->T){all}   0.010102    0.000094    0.000005    0.029522    0.007173    761.61    928.49    1.000
r(C<->G){all}   0.097730    0.000470    0.057155    0.140022    0.095920    773.93    880.28    1.000
r(C<->T){all}   0.562495    0.003140    0.458799    0.674044    0.562662    660.73    706.22    1.000
r(G<->T){all}   0.028500    0.000275    0.000097    0.060267    0.026316    950.92   1043.47    1.000
pi(A){all}      0.225826    0.000218    0.196206    0.253302    0.225463   1225.58   1339.66    1.000
pi(C){all}      0.311483    0.000271    0.278221    0.341525    0.311604   1254.54   1261.33    1.000
pi(G){all}      0.275871    0.000265    0.245869    0.308100    0.275597   1196.40   1260.28    1.000
pi(T){all}      0.186820    0.000176    0.162500    0.214740    0.186298   1094.16   1181.14    1.000
alpha{1,2}      0.085992    0.000275    0.057500    0.119788    0.085828    877.60   1024.87    1.000
alpha{3}        2.224142    0.488473    1.061426    3.648855    2.111553   1329.23   1376.04    1.000
pinvar{all}     0.600376    0.001409    0.527285    0.669611    0.602321   1256.34   1372.71    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1818.876561
Model 2: PositiveSelection	-1818.874206
Model 0: one-ratio	-1818.988065
Model 3: discrete	-1818.874206
Model 7: beta	-1818.873078
Model 8: beta&w>1	-1818.875434


Model 0 vs 1	0.22300799999993615

Model 2 vs 1	0.004710000000159198

Model 8 vs 7	0.004711999999926775
Download 
>C1
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C2
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C3
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C4
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C5
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C6
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C7
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C8
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C9
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C10
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C11
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C12
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=245 

C1              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C2              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C3              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C4              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C5              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C6              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C7              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C8              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C9              MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C10             MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C11             MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
C12             MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
                **************************************************

C1              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C2              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C3              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C4              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C5              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C6              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C7              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C8              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C9              EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C10             EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C11             EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
C12             EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
                **************************************************

C1              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C2              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C3              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C4              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C5              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C6              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C7              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C8              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C9              GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C10             GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C11             GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
C12             GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
                **************************************************

C1              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C2              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C3              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C4              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C5              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C6              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C7              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C8              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C9              TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C10             TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C11             TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
C12             TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
                **************************************************

C1              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C2              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C3              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C4              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C5              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C6              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C7              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C8              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C9              ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C10             ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C11             ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
C12             ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
                *********************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 12 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8  Length  245 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9  Length  245 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [32340]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [32340]--->[32340]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/295/Lmpt-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.674 Mb, Max= 31.565 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C2
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C3
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C4
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C5
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C6
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C7
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C8
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C9
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C10
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C11
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C12
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM

FORMAT of file /tmp/tmp1561457692238888108aln Not Supported[FATAL:T-COFFEE]
>C1
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C2
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C3
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C4
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C5
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C6
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C7
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C8
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C9
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C10
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C11
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C12
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:245 S:100 BS:245
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00  C1	  C2	 100.00
TOP	    1    0	 100.00  C2	  C1	 100.00
BOT	    0    2	 100.00  C1	  C3	 100.00
TOP	    2    0	 100.00  C3	  C1	 100.00
BOT	    0    3	 100.00  C1	  C4	 100.00
TOP	    3    0	 100.00  C4	  C1	 100.00
BOT	    0    4	 100.00  C1	  C5	 100.00
TOP	    4    0	 100.00  C5	  C1	 100.00
BOT	    0    5	 100.00  C1	  C6	 100.00
TOP	    5    0	 100.00  C6	  C1	 100.00
BOT	    0    6	 100.00  C1	  C7	 100.00
TOP	    6    0	 100.00  C7	  C1	 100.00
BOT	    0    7	 100.00  C1	  C8	 100.00
TOP	    7    0	 100.00  C8	  C1	 100.00
BOT	    0    8	 100.00  C1	  C9	 100.00
TOP	    8    0	 100.00  C9	  C1	 100.00
BOT	    0    9	 100.00  C1	 C10	 100.00
TOP	    9    0	 100.00 C10	  C1	 100.00
BOT	    0   10	 100.00  C1	 C11	 100.00
TOP	   10    0	 100.00 C11	  C1	 100.00
BOT	    0   11	 100.00  C1	 C12	 100.00
TOP	   11    0	 100.00 C12	  C1	 100.00
BOT	    1    2	 100.00  C2	  C3	 100.00
TOP	    2    1	 100.00  C3	  C2	 100.00
BOT	    1    3	 100.00  C2	  C4	 100.00
TOP	    3    1	 100.00  C4	  C2	 100.00
BOT	    1    4	 100.00  C2	  C5	 100.00
TOP	    4    1	 100.00  C5	  C2	 100.00
BOT	    1    5	 100.00  C2	  C6	 100.00
TOP	    5    1	 100.00  C6	  C2	 100.00
BOT	    1    6	 100.00  C2	  C7	 100.00
TOP	    6    1	 100.00  C7	  C2	 100.00
BOT	    1    7	 100.00  C2	  C8	 100.00
TOP	    7    1	 100.00  C8	  C2	 100.00
BOT	    1    8	 100.00  C2	  C9	 100.00
TOP	    8    1	 100.00  C9	  C2	 100.00
BOT	    1    9	 100.00  C2	 C10	 100.00
TOP	    9    1	 100.00 C10	  C2	 100.00
BOT	    1   10	 100.00  C2	 C11	 100.00
TOP	   10    1	 100.00 C11	  C2	 100.00
BOT	    1   11	 100.00  C2	 C12	 100.00
TOP	   11    1	 100.00 C12	  C2	 100.00
BOT	    2    3	 100.00  C3	  C4	 100.00
TOP	    3    2	 100.00  C4	  C3	 100.00
BOT	    2    4	 100.00  C3	  C5	 100.00
TOP	    4    2	 100.00  C5	  C3	 100.00
BOT	    2    5	 100.00  C3	  C6	 100.00
TOP	    5    2	 100.00  C6	  C3	 100.00
BOT	    2    6	 100.00  C3	  C7	 100.00
TOP	    6    2	 100.00  C7	  C3	 100.00
BOT	    2    7	 100.00  C3	  C8	 100.00
TOP	    7    2	 100.00  C8	  C3	 100.00
BOT	    2    8	 100.00  C3	  C9	 100.00
TOP	    8    2	 100.00  C9	  C3	 100.00
BOT	    2    9	 100.00  C3	 C10	 100.00
TOP	    9    2	 100.00 C10	  C3	 100.00
BOT	    2   10	 100.00  C3	 C11	 100.00
TOP	   10    2	 100.00 C11	  C3	 100.00
BOT	    2   11	 100.00  C3	 C12	 100.00
TOP	   11    2	 100.00 C12	  C3	 100.00
BOT	    3    4	 100.00  C4	  C5	 100.00
TOP	    4    3	 100.00  C5	  C4	 100.00
BOT	    3    5	 100.00  C4	  C6	 100.00
TOP	    5    3	 100.00  C6	  C4	 100.00
BOT	    3    6	 100.00  C4	  C7	 100.00
TOP	    6    3	 100.00  C7	  C4	 100.00
BOT	    3    7	 100.00  C4	  C8	 100.00
TOP	    7    3	 100.00  C8	  C4	 100.00
BOT	    3    8	 100.00  C4	  C9	 100.00
TOP	    8    3	 100.00  C9	  C4	 100.00
BOT	    3    9	 100.00  C4	 C10	 100.00
TOP	    9    3	 100.00 C10	  C4	 100.00
BOT	    3   10	 100.00  C4	 C11	 100.00
TOP	   10    3	 100.00 C11	  C4	 100.00
BOT	    3   11	 100.00  C4	 C12	 100.00
TOP	   11    3	 100.00 C12	  C4	 100.00
BOT	    4    5	 100.00  C5	  C6	 100.00
TOP	    5    4	 100.00  C6	  C5	 100.00
BOT	    4    6	 100.00  C5	  C7	 100.00
TOP	    6    4	 100.00  C7	  C5	 100.00
BOT	    4    7	 100.00  C5	  C8	 100.00
TOP	    7    4	 100.00  C8	  C5	 100.00
BOT	    4    8	 100.00  C5	  C9	 100.00
TOP	    8    4	 100.00  C9	  C5	 100.00
BOT	    4    9	 100.00  C5	 C10	 100.00
TOP	    9    4	 100.00 C10	  C5	 100.00
BOT	    4   10	 100.00  C5	 C11	 100.00
TOP	   10    4	 100.00 C11	  C5	 100.00
BOT	    4   11	 100.00  C5	 C12	 100.00
TOP	   11    4	 100.00 C12	  C5	 100.00
BOT	    5    6	 100.00  C6	  C7	 100.00
TOP	    6    5	 100.00  C7	  C6	 100.00
BOT	    5    7	 100.00  C6	  C8	 100.00
TOP	    7    5	 100.00  C8	  C6	 100.00
BOT	    5    8	 100.00  C6	  C9	 100.00
TOP	    8    5	 100.00  C9	  C6	 100.00
BOT	    5    9	 100.00  C6	 C10	 100.00
TOP	    9    5	 100.00 C10	  C6	 100.00
BOT	    5   10	 100.00  C6	 C11	 100.00
TOP	   10    5	 100.00 C11	  C6	 100.00
BOT	    5   11	 100.00  C6	 C12	 100.00
TOP	   11    5	 100.00 C12	  C6	 100.00
BOT	    6    7	 100.00  C7	  C8	 100.00
TOP	    7    6	 100.00  C8	  C7	 100.00
BOT	    6    8	 100.00  C7	  C9	 100.00
TOP	    8    6	 100.00  C9	  C7	 100.00
BOT	    6    9	 100.00  C7	 C10	 100.00
TOP	    9    6	 100.00 C10	  C7	 100.00
BOT	    6   10	 100.00  C7	 C11	 100.00
TOP	   10    6	 100.00 C11	  C7	 100.00
BOT	    6   11	 100.00  C7	 C12	 100.00
TOP	   11    6	 100.00 C12	  C7	 100.00
BOT	    7    8	 100.00  C8	  C9	 100.00
TOP	    8    7	 100.00  C9	  C8	 100.00
BOT	    7    9	 100.00  C8	 C10	 100.00
TOP	    9    7	 100.00 C10	  C8	 100.00
BOT	    7   10	 100.00  C8	 C11	 100.00
TOP	   10    7	 100.00 C11	  C8	 100.00
BOT	    7   11	 100.00  C8	 C12	 100.00
TOP	   11    7	 100.00 C12	  C8	 100.00
BOT	    8    9	 100.00  C9	 C10	 100.00
TOP	    9    8	 100.00 C10	  C9	 100.00
BOT	    8   10	 100.00  C9	 C11	 100.00
TOP	   10    8	 100.00 C11	  C9	 100.00
BOT	    8   11	 100.00  C9	 C12	 100.00
TOP	   11    8	 100.00 C12	  C9	 100.00
BOT	    9   10	 100.00 C10	 C11	 100.00
TOP	   10    9	 100.00 C11	 C10	 100.00
BOT	    9   11	 100.00 C10	 C12	 100.00
TOP	   11    9	 100.00 C12	 C10	 100.00
BOT	   10   11	 100.00 C11	 C12	 100.00
TOP	   11   10	 100.00 C12	 C11	 100.00
AVG	 0	  C1	   *	 100.00
AVG	 1	  C2	   *	 100.00
AVG	 2	  C3	   *	 100.00
AVG	 3	  C4	   *	 100.00
AVG	 4	  C5	   *	 100.00
AVG	 5	  C6	   *	 100.00
AVG	 6	  C7	   *	 100.00
AVG	 7	  C8	   *	 100.00
AVG	 8	  C9	   *	 100.00
AVG	 9	 C10	   *	 100.00
AVG	 10	 C11	   *	 100.00
AVG	 11	 C12	   *	 100.00
TOT	 TOT	   *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACCGACGTGGATGTACTTAGTTCGAGAATGAAGTCTCGACTTCACCT
C2              ATGACCGACGTGGATGTACTCAGTTCGAGAATGAAGTCTCGGCTTCACCT
C3              ATGACCGACGTGGATGTACTCAGTTCGAGAATGAAGTCTCGGCTTCACCT
C4              ATGACCGACGTGGATGTACTGAGTTCGAGAATGAAGTCTCGGCTTCACCT
C5              ATGACCGACGTGGATGTACTTAGTTCGAGAATGAAGTCTCGGCTCCACCT
C6              ATGACCGACGTGGATGTGCTAAGCTCGAGAATGAAGTCTCGACTCCACCT
C7              ATGACCGATGTGGATGTGCTCAGCTCGAGGATGAAGTCGCGGCTCCATCT
C8              ATGACCGATGTGGATGTGCTCAGTTCGAGGATGAAGTCGCGGCTTCATCT
C9              ATGACCGACGTGGATGTGCTTAGTTCGAGAATGAAGTCTCGGCTTCACCT
C10             ATGACCGATGTGGATGTCCTCAGTTCGAGAATGAAGTCTCGTCTTCACCT
C11             ATGACCGACGTCGATGTGCTAAGTTCGCGGATGAAGTCGCGACTTCATCT
C12             ATGACCGATGTGGATGTGCTGAGTTCGCGAATGAAGTCTCGCCTTCATCT
                ******** ** ***** ** ** ***.*.******** ** ** ** **

C1              GCAAACCAAGACCATTGGCGCGGAGCGGATCAAGAAGGCCAAGGATAATA
C2              GCAAACTAAAACGATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
C3              GCAAACCAAAACGATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
C4              GCAAACCAAGACCATTGGTGCCGAGCGCATCAAGAAGGCGAAGGATAACA
C5              GCAAACCAAGACCATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
C6              GCAAACCAAGACCATTGGCGCGGAGCGAATCAAGAAGGCCAAGGATAACA
C7              GCAGACCAAAACCATTGGGGCGGAGCGGATCAAGAAGGCCAAGGATAACA
C8              GCAGACCAAAACCATTGGAGCGGAGCGAATCAAGAAGGCCAAGGATAACA
C9              GCAAACCAAGACCATTGGAGCCGAGAGAATCAAGAAGGCGAAGGATAACA
C10             GCAAACCAAAACTATTGGTGCTGAGAGAATTAAGAAGGCCAAGGATAACA
C11             GCAAACCAAAACCATTGGGGCCGAGCGAATCAAAAAGGCCAAGGATAACA
C12             GCAAACCAAGACTATTGGCGCCGAGCGAATCAAGAAGGCCAAGGACAACA
                ***.** **.** ***** ** ***.* ** **.***** ***** ** *

C1              ACGAGGATATCGCCGTGCTGAGCATGTTTCTGCCCAACGCCTCCGCCGTG
C2              ACGAGGACATCGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
C3              ACGAGGACATCGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
C4              ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCCAACGCCTCCGCCGTG
C5              ACGAGGACATTGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
C6              ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
C7              ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
C8              ATGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
C9              ATGAGGACATTGCCGTGCTCAGCATGTTCCTACCCAATGCCTCTGCGGTG
C10             ATGAGGATATTGCTGTGCTCAGCATGTTCCTACCAAACGCCTCCGCAGTG
C11             ATGAGGACATCGCCGTGCTTAGCATGTTCCTGCCGAATGCATCCGCCGTG
C12             ATGAGGACATTGCCGTGCTCAGCATGTTCCTGCCCAACGCCTCCGCCGTG
                * ***** ** ** ***** ******** **.** ** **.** ** ***

C1              GAGGAGAACCGGAACTTCTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
C2              GAGGAGAACCGGAACTTTTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
C3              GAGGAGAACCGGAACTTTTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
C4              GAGGAGAACAGGAACTTTTATTGCCAGCTGGGCGACTATTGTCGCCTCGG
C5              GAGGAGAACCGCAACTTTTATTGCCAGCTGGGCGATTATTGTCGCCTCGG
C6              GAGGAAAACCGCAACTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
C7              GAGGAGAACCGCAATTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
C8              GAGGAGAACCGGAACTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
C9              GAGGAGAACAGGAACTTCTATTGCCAGCTGGGCGACTATTGTCGCCTCGG
C10             GAGGAGAATCGCAATTTTTATTGCCAACTGGGCGATTATTGTCGTCTCGG
C11             GAGGAGAACCGCAACTTCTATTGCCAACTGGGCGACTACTGTCGCCTCGG
C12             GAGGAGAACCGCAACTTTTATTGCCAACTGGGCGATTACTGTCGCCTCGG
                *****.** .* ** ** ********. ******* ** ***** *****

C1              CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAAATGGAGTATAAAACCA
C2              CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
C3              CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
C4              CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTATAAAACCA
C5              CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
C6              CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
C7              CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
C8              TGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
C9              CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
C10             CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
C11             CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
C12             CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
                 *********************** ********.******** ******.

C1              GGCAGTGGCACGAGAATTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATT
C2              GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTGTGCAAGACGGCCATC
C3              GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C4              GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C5              GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C6              GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C7              GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTGTGCAAGACGGCCATC
C8              GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C9              GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C10             GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C11             GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
C12             GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
                ****.*********** ***************** ************** 

C1              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTATTGCGCCGGCTG
C2              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C3              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C4              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C5              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C6              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C7              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C8              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C9              GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATTTACTGCGCCGGCTG
C10             GGGACCAAGTCGTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C11             GGCACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
C12             GGCACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
                ** ******** *********************** ** ***********

C1              CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
C2              CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
C3              CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
C4              CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAACAAGGTCATCA
C5              CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
C6              CTACGAGGAGAAGTTTGCCACGCGCTGCATTAAGTGCAACAAGGTCATCA
C7              CTACGAGGAGAAGTTCGCCACGCGCTGCATTAAGTGCAATAAGGTCATCA
C8              CTACGAGGAGAAGTTCGCCACGCGCTGCATTAAGTGCAATAAGGTCATCA
C9              CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
C10             CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTAATCA
C11             CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
C12             CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
                *************** ************** ******** *****.****

C1              CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
C2              CCTCGGGAGGTGTTACCTACAAGAATGAGCCGTGGCATCGCGAGTGCTTC
C3              CCTCGGGAGGTGTTACCTACAAGAATGAGCCGTGGCATCGCGAGTGCTTC
C4              CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
C5              CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
C6              CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
C7              CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
C8              CCTCGGGCGGTGTTACCTACAAGAACGAGCCGTGGCATCGTGAGTGCTTC
C9              CCTCTGGCGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTT
C10             CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCACCGCGAGTGCTTC
C11             CCTCAGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGTGAGTGCTTC
C12             CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
                **** **.***** *********** *********** ** ******** 

C1              ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C2              ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C3              ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C4              ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C5              ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C6              ACGTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C7              ACGTGCACCCATTGCAACATCACGCTCGCTGGCCAGCGCTTCACCAGCCG
C8              ACGTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGGTTCACCAGCCG
C9              ACGTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C10             ACGTGCACCCACTGCAACATCACGCTCGCTGGCCAGCGGTTCACCAGCCG
C11             ACCTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
C12             ACGTGCACCCACTGCAACATCACGCTAGCTGGCCAGAGATTCACCAGCCG
                ** ******** **************.*********.* ***********

C1              CGACGAGAAGCCCTATTGTGCGGAGTGCTTTGGCGAGCTCTTTGCCAAAA
C2              CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
C3              CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAGC
C4              CGACGAGAAGCCCTACTGTGCCGAGTGCTTCGGCGAGCTGTTTGCCAAAC
C5              CGACGAGAAGCCCTATTGTGCCGAGTGCTTCGGCGAGCTGTTTGCCAAAC
C6              CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
C7              CGACGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
C8              CGATGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
C9              CGATGAGAAGCCCTATTGCGCCGAGTGCTTTGGCGAGTTGTTTGCCAAAC
C10             CGATGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAGC
C11             CGATGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
C12             CGATGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
                *** *********** ** ** ******** ****** * ********..

C1              GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
C2              GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGTTTC
C3              GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
C4              GCTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
C5              GCTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
C6              GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
C7              GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
C8              GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
C9              GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTT
C10             GCTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGTGGCACACGGTTC
C11             GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
C12             GTTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
                * *****************************.***** ******** ** 

C1              ATATCGTTTGAGGATCGCCACTGGCATCACGACTGCTTTGTGTGTGCCAG
C2              ATCTCGTTTGAGGATCGCCACTGGCATCACGACTGCTTCGTGTGCGCCAG
C3              ATCTCGTTTGAGGATCGCCACTGGCATCACGACTGCTTCGTGTGTGCCAG
C4              ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
C5              ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
C6              ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
C7              ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
C8              ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
C9              ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
C10             ATCTCGTTCGAGGATCGCCATTGGCACCACGACTGCTTCGTGTGCGCCAG
C11             ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
C12             ATCTCGTTTGAGGATCGTCACTGGCACCACGACTGCTTCGTTTGTGCCAG
                **.***** ******** ** ***** *********** ** ** *****

C1              CTGCAAGGCTAGTCTGGTTGGTCGTGGCTTCATCACCGACGGACCCGATA
C2              CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
C3              CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
C4              CTGCAAGGCTAGTCTGGTGGGTCGCGGCTTCATCACCGACGGACCCGATA
C5              CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
C6              CTGCAAGGCCAGTTTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
C7              CTGCAAGGCTAGTCTGGTGGGCCGTGGCTTCATCACCGACGGACCCGACA
C8              CTGCAAGGCCAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
C9              CTGCAAGGCTAGTCTCGTGGGCCGCGGCTTCATCACCGACGGACCCGACA
C10             CTGCAAGGCCAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
C11             CTGCAAGGCCAGTCTAGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
C12             CTGCAAGGCTAGTCTAGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
                ********* *** * ** ** ** *********************** *

C1              TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C2              TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C3              TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C4              TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C5              TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C6              TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C7              TCCTGTGCCCCGATTGTGCCAAGCAGAAGTTGATG
C8              TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C9              TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C10             TCCTCTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C11             TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
C12             TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
                * ** ************************ *****



>C1
ATGACCGACGTGGATGTACTTAGTTCGAGAATGAAGTCTCGACTTCACCT
GCAAACCAAGACCATTGGCGCGGAGCGGATCAAGAAGGCCAAGGATAATA
ACGAGGATATCGCCGTGCTGAGCATGTTTCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTCTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAAATGGAGTATAAAACCA
GGCAGTGGCACGAGAATTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATT
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTATTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCGGAGTGCTTTGGCGAGCTCTTTGCCAAAA
GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATATCGTTTGAGGATCGCCACTGGCATCACGACTGCTTTGTGTGTGCCAG
CTGCAAGGCTAGTCTGGTTGGTCGTGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C2
ATGACCGACGTGGATGTACTCAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACTAAAACGATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATCGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTTTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTGTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAATGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGTTTC
ATCTCGTTTGAGGATCGCCACTGGCATCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C3
ATGACCGACGTGGATGTACTCAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACCAAAACGATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATCGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTTTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAATGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAGC
GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCATCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C4
ATGACCGACGTGGATGTACTGAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACCAAGACCATTGGTGCCGAGCGCATCAAGAAGGCGAAGGATAACA
ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACAGGAACTTTTATTGCCAGCTGGGCGACTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTATAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAACAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTACTGTGCCGAGTGCTTCGGCGAGCTGTTTGCCAAAC
GCTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGCGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C5
ATGACCGACGTGGATGTACTTAGTTCGAGAATGAAGTCTCGGCTCCACCT
GCAAACCAAGACCATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATTGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGCAACTTTTATTGCCAGCTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTCGGCGAGCTGTTTGCCAAAC
GCTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C6
ATGACCGACGTGGATGTGCTAAGCTCGAGAATGAAGTCTCGACTCCACCT
GCAAACCAAGACCATTGGCGCGGAGCGAATCAAGAAGGCCAAGGATAACA
ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
GAGGAAAACCGCAACTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATTAAGTGCAACAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACGTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCCAGTTTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C7
ATGACCGATGTGGATGTGCTCAGCTCGAGGATGAAGTCGCGGCTCCATCT
GCAGACCAAAACCATTGGGGCGGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
GAGGAGAACCGCAATTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTGTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATTAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACGTGCACCCATTGCAACATCACGCTCGCTGGCCAGCGCTTCACCAGCCG
CGACGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCTAGTCTGGTGGGCCGTGGCTTCATCACCGACGGACCCGACA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGTTGATG
>C8
ATGACCGATGTGGATGTGCTCAGTTCGAGGATGAAGTCGCGGCTTCATCT
GCAGACCAAAACCATTGGAGCGGAGCGAATCAAGAAGGCCAAGGATAACA
ATGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
TGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATTAAGTGCAATAAGGTCATCA
CCTCGGGCGGTGTTACCTACAAGAACGAGCCGTGGCATCGTGAGTGCTTC
ACGTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGGTTCACCAGCCG
CGATGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCCAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C9
ATGACCGACGTGGATGTGCTTAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACCAAGACCATTGGAGCCGAGAGAATCAAGAAGGCGAAGGATAACA
ATGAGGACATTGCCGTGCTCAGCATGTTCCTACCCAATGCCTCTGCGGTG
GAGGAGAACAGGAACTTCTATTGCCAGCTGGGCGACTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATTTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCTGGCGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTT
ACGTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGATGAGAAGCCCTATTGCGCCGAGTGCTTTGGCGAGTTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTT
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCTAGTCTCGTGGGCCGCGGCTTCATCACCGACGGACCCGACA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C10
ATGACCGATGTGGATGTCCTCAGTTCGAGAATGAAGTCTCGTCTTCACCT
GCAAACCAAAACTATTGGTGCTGAGAGAATTAAGAAGGCCAAGGATAACA
ATGAGGATATTGCTGTGCTCAGCATGTTCCTACCAAACGCCTCCGCAGTG
GAGGAGAATCGCAATTTTTATTGCCAACTGGGCGATTATTGTCGTCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCGTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTAATCA
CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCACCGCGAGTGCTTC
ACGTGCACCCACTGCAACATCACGCTCGCTGGCCAGCGGTTCACCAGCCG
CGATGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAGC
GCTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGTGGCACACGGTTC
ATCTCGTTCGAGGATCGCCATTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCCAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TCCTCTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C11
ATGACCGACGTCGATGTGCTAAGTTCGCGGATGAAGTCGCGACTTCATCT
GCAAACCAAAACCATTGGGGCCGAGCGAATCAAAAAGGCCAAGGATAACA
ATGAGGACATCGCCGTGCTTAGCATGTTCCTGCCGAATGCATCCGCCGTG
GAGGAGAACCGCAACTTCTATTGCCAACTGGGCGACTACTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGCACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCAGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGTGAGTGCTTC
ACCTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGATGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCCAGTCTAGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C12
ATGACCGATGTGGATGTGCTGAGTTCGCGAATGAAGTCTCGCCTTCATCT
GCAAACCAAGACTATTGGCGCCGAGCGAATCAAGAAGGCCAAGGACAACA
ATGAGGACATTGCCGTGCTCAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGCAACTTTTATTGCCAACTGGGCGATTACTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGCACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACGTGCACCCACTGCAACATCACGCTAGCTGGCCAGAGATTCACCAGCCG
CGATGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGTCACTGGCACCACGACTGCTTCGTTTGTGCCAG
CTGCAAGGCTAGTCTAGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>C1
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C2
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C3
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C4
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C5
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C6
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C7
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C8
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C9
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C10
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C11
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>C12
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 12 taxa and 735 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479736900
      Setting output file names to "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 586121683
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9803365672
      Seed = 1451970730
      Swapseed = 1479736900
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 14 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 87 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3207.456810 -- -24.979900
         Chain 2 -- -3251.142743 -- -24.979900
         Chain 3 -- -3220.658716 -- -24.979900
         Chain 4 -- -3229.021562 -- -24.979900

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3244.127386 -- -24.979900
         Chain 2 -- -3281.806883 -- -24.979900
         Chain 3 -- -3262.511266 -- -24.979900
         Chain 4 -- -3237.716447 -- -24.979900


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3207.457] (-3251.143) (-3220.659) (-3229.022) * [-3244.127] (-3281.807) (-3262.511) (-3237.716) 
        500 -- [-2169.225] (-2232.984) (-2222.198) (-2237.527) * [-2144.651] (-2226.647) (-2222.107) (-2218.441) -- 0:00:00
       1000 -- [-2128.558] (-2157.421) (-2142.981) (-2181.426) * [-2082.047] (-2156.948) (-2182.858) (-2191.940) -- 0:00:00
       1500 -- [-2098.298] (-2110.602) (-2105.306) (-2122.096) * [-2062.393] (-2091.509) (-2131.971) (-2112.690) -- 0:00:00
       2000 -- (-2057.406) (-2090.516) [-2055.953] (-2075.106) * (-2051.303) [-2029.022] (-2075.111) (-2083.372) -- 0:08:19
       2500 -- [-2031.029] (-2028.884) (-2044.641) (-2045.669) * [-2011.810] (-2021.864) (-2040.828) (-2064.677) -- 0:06:39
       3000 -- (-2011.979) [-2019.999] (-2026.637) (-2022.158) * (-2005.109) (-2011.281) [-2019.776] (-2059.363) -- 0:05:32
       3500 -- (-2008.732) (-2016.868) (-2019.878) [-2008.134] * [-2000.564] (-2030.796) (-1996.492) (-2038.810) -- 0:04:44
       4000 -- (-2009.454) (-2020.539) [-2021.527] (-2010.973) * [-2011.282] (-2007.142) (-2000.892) (-2040.056) -- 0:04:09
       4500 -- [-2004.704] (-2020.956) (-2007.765) (-2014.666) * (-1999.319) [-2010.066] (-2000.361) (-2034.976) -- 0:07:22
       5000 -- [-2002.782] (-2012.985) (-2011.178) (-2025.847) * [-2009.321] (-2013.500) (-2004.196) (-2024.838) -- 0:06:38

      Average standard deviation of split frequencies: 0.089791

       5500 -- (-2021.862) (-2007.512) [-1998.549] (-2009.688) * (-2004.797) [-2005.320] (-2011.242) (-2024.897) -- 0:06:01
       6000 -- [-2010.609] (-2001.325) (-2021.494) (-2010.388) * [-2004.558] (-2008.160) (-1998.953) (-2018.062) -- 0:05:31
       6500 -- (-2005.684) [-2005.657] (-2012.799) (-1999.607) * [-2009.829] (-2004.070) (-2004.233) (-2017.678) -- 0:07:38
       7000 -- [-2009.067] (-1998.416) (-2022.974) (-2007.474) * (-2006.185) (-2014.371) [-1999.530] (-2020.684) -- 0:07:05
       7500 -- (-2004.889) [-1999.944] (-2006.584) (-2012.500) * (-2012.032) (-2011.597) [-2000.896] (-2021.635) -- 0:06:37
       8000 -- [-2000.044] (-1995.514) (-2000.441) (-1998.606) * (-2010.009) [-2009.076] (-2000.108) (-2020.775) -- 0:06:12
       8500 -- (-2007.326) (-2018.174) [-1997.394] (-2004.879) * [-2001.540] (-2004.195) (-2006.970) (-2020.811) -- 0:05:49
       9000 -- (-2017.507) (-1999.439) (-2003.237) [-2009.011] * (-2006.053) (-2002.696) [-2002.016] (-2003.261) -- 0:07:20
       9500 -- (-2002.144) (-2001.992) [-2008.945] (-1999.252) * (-2003.136) (-2001.060) [-1999.882] (-1999.147) -- 0:06:57
      10000 -- (-2015.455) (-2011.471) [-2001.221] (-2014.793) * (-1996.022) (-2010.501) [-1999.554] (-2015.703) -- 0:06:36

      Average standard deviation of split frequencies: 0.099917

      10500 -- [-2009.393] (-2003.301) (-2020.214) (-2000.876) * (-2024.282) (-2011.861) [-2001.371] (-2006.058) -- 0:06:16
      11000 -- (-2001.886) (-2002.886) (-2018.057) [-2005.400] * (-2009.873) (-2015.978) (-1995.645) [-2000.631] -- 0:05:59
      11500 -- (-1997.030) (-2006.596) (-2016.010) [-1996.551] * (-2004.208) [-2003.457] (-2009.414) (-2005.054) -- 0:07:09
      12000 -- (-2005.767) (-1999.276) (-2016.298) [-1999.656] * (-2009.476) (-1999.089) [-2005.009] (-2016.072) -- 0:06:51
      12500 -- (-2002.096) [-1995.251] (-2005.227) (-2004.413) * (-2007.854) (-2005.822) (-2003.922) [-2001.686] -- 0:06:35
      13000 -- (-2004.953) (-2013.093) (-2002.627) [-1997.290] * (-2024.543) [-1999.282] (-2008.554) (-2001.146) -- 0:06:19
      13500 -- [-1999.996] (-2008.093) (-2017.160) (-2013.730) * (-1996.483) (-2003.845) [-2002.146] (-2010.284) -- 0:07:18
      14000 -- (-2000.415) (-2000.872) [-2010.543] (-2021.682) * (-2000.366) (-2001.687) (-2008.287) [-2006.568] -- 0:07:02
      14500 -- (-1999.127) (-2005.220) (-2012.481) [-2004.620] * (-2005.520) (-2004.444) [-1996.317] (-2010.816) -- 0:06:47
      15000 -- (-2005.844) (-2005.897) [-2005.011] (-2011.461) * [-2010.561] (-2007.064) (-2007.375) (-2009.570) -- 0:06:34

      Average standard deviation of split frequencies: 0.121869

      15500 -- (-2007.028) [-1992.153] (-2010.767) (-2014.488) * (-1998.366) [-2005.918] (-2022.009) (-2012.372) -- 0:06:21
      16000 -- (-2002.384) [-2007.377] (-2002.395) (-2006.877) * (-2003.281) [-2016.792] (-2011.625) (-2002.100) -- 0:07:10
      16500 -- (-2007.999) (-2008.683) [-2016.924] (-2006.543) * (-2002.033) (-2013.617) [-1997.353] (-2011.095) -- 0:06:57
      17000 -- (-2002.943) (-2022.027) [-1998.333] (-1996.303) * [-2001.139] (-2009.652) (-2003.738) (-2003.914) -- 0:06:44
      17500 -- [-1995.769] (-2006.657) (-2014.284) (-2002.671) * (-1999.115) (-2001.728) [-2000.291] (-2006.335) -- 0:06:33
      18000 -- (-2002.985) (-2003.014) [-2001.666] (-2010.271) * (-2006.890) (-2001.678) (-2003.589) [-1999.841] -- 0:06:21
      18500 -- [-2001.846] (-2005.219) (-2016.787) (-2004.824) * (-2022.281) [-2001.781] (-2004.219) (-2001.156) -- 0:07:04
      19000 -- [-2003.610] (-2007.208) (-2024.704) (-2004.887) * (-2019.603) [-1994.230] (-2014.101) (-2007.952) -- 0:06:53
      19500 -- (-2006.211) (-2003.482) [-2004.270] (-2014.570) * (-2013.144) (-1996.663) [-2007.645] (-2007.588) -- 0:06:42
      20000 -- [-2002.409] (-2002.833) (-2013.790) (-2016.466) * (-2007.009) (-2003.678) (-2000.962) [-1999.083] -- 0:06:32

      Average standard deviation of split frequencies: 0.075558

      20500 -- [-2001.015] (-2002.300) (-2024.284) (-2004.005) * (-2004.899) [-2000.321] (-2001.292) (-2007.166) -- 0:06:22
      21000 -- [-2002.641] (-2001.810) (-2007.689) (-2008.232) * [-2007.484] (-1995.967) (-2011.737) (-2006.299) -- 0:06:59
      21500 -- [-1996.640] (-2009.400) (-2015.570) (-2008.132) * (-2016.677) (-1999.333) [-2004.529] (-2003.213) -- 0:06:49
      22000 -- (-2014.312) (-2000.458) (-2007.428) [-2002.404] * [-1997.698] (-2001.948) (-2004.005) (-2012.060) -- 0:06:40
      22500 -- (-1999.749) (-2007.137) [-1995.813] (-2007.739) * (-2005.264) (-2007.116) (-2006.990) [-2004.198] -- 0:06:31
      23000 -- (-2005.567) (-2008.595) (-2006.473) [-2007.101] * (-2007.967) [-2008.374] (-2010.255) (-2006.463) -- 0:06:22
      23500 -- [-2000.502] (-2006.459) (-2008.814) (-2009.336) * (-1999.011) [-2002.961] (-2017.674) (-2007.418) -- 0:06:55
      24000 -- (-2004.099) [-2011.572] (-2009.340) (-2015.727) * [-2001.336] (-2022.916) (-2001.132) (-2007.663) -- 0:06:46
      24500 -- (-2006.108) (-2011.207) (-2013.950) [-2009.738] * [-1998.796] (-2015.388) (-2003.635) (-2010.535) -- 0:06:38
      25000 -- (-2014.831) [-2007.427] (-2007.303) (-2008.537) * (-1994.499) (-2012.944) (-2014.854) [-2002.507] -- 0:06:30

      Average standard deviation of split frequencies: 0.057112

      25500 -- (-2011.146) (-2023.688) [-1998.975] (-2000.265) * (-2002.614) (-2025.239) [-2009.164] (-1998.008) -- 0:06:22
      26000 -- [-2018.884] (-2009.570) (-2022.555) (-2006.054) * (-2018.313) (-2017.005) [-2000.868] (-2016.274) -- 0:06:52
      26500 -- (-2005.858) (-2007.902) (-2002.902) [-2000.790] * (-2016.569) (-2011.493) (-2002.050) [-2009.788] -- 0:06:44
      27000 -- (-2008.110) [-1995.790] (-2001.881) (-2003.959) * (-2006.607) (-2023.134) [-1999.452] (-2016.908) -- 0:06:36
      27500 -- [-2013.845] (-2006.455) (-2001.634) (-2004.785) * [-2005.373] (-2021.326) (-2002.566) (-2011.062) -- 0:06:29
      28000 -- (-2010.083) (-2003.845) (-2004.926) [-2007.618] * (-2017.164) (-2018.219) (-2002.297) [-1999.043] -- 0:06:21
      28500 -- (-1997.951) [-2002.838] (-2002.495) (-2017.704) * (-2004.582) (-2010.868) [-2003.297] (-2005.696) -- 0:06:49
      29000 -- (-2006.724) (-2004.397) (-2014.265) [-1998.270] * (-2017.009) (-2016.449) [-1999.521] (-2015.303) -- 0:06:41
      29500 -- (-2005.272) (-2017.347) (-1997.361) [-1998.008] * (-2002.597) (-2009.355) (-2012.677) [-1997.111] -- 0:06:34
      30000 -- (-2003.884) (-2008.308) (-2001.583) [-2006.008] * (-2003.255) (-2010.171) (-2016.597) [-2000.495] -- 0:06:28

      Average standard deviation of split frequencies: 0.041595

      30500 -- (-2011.028) (-2007.470) [-2007.326] (-1998.855) * (-2010.767) [-2002.246] (-2004.636) (-2005.884) -- 0:06:21
      31000 -- (-2007.777) (-1994.080) (-2010.158) [-2007.213] * [-2000.455] (-2017.573) (-1998.047) (-2002.125) -- 0:06:46
      31500 -- (-2015.125) [-2012.295] (-2016.123) (-2003.784) * (-2008.821) (-2008.379) [-1998.649] (-2014.599) -- 0:06:39
      32000 -- (-2002.799) (-2000.906) (-2004.218) [-2006.311] * (-2008.642) (-2013.545) (-2003.946) [-1999.083] -- 0:06:33
      32500 -- (-2000.720) [-2005.492] (-2010.962) (-2009.111) * (-2005.612) (-2006.669) (-2012.732) [-2007.140] -- 0:06:27
      33000 -- [-2002.622] (-2005.271) (-2007.527) (-2006.692) * [-2004.164] (-2006.987) (-2007.752) (-2013.317) -- 0:06:20
      33500 -- (-2007.321) (-2014.330) [-1997.506] (-2008.657) * (-2005.833) (-2006.053) [-1999.316] (-2002.934) -- 0:06:43
      34000 -- (-2001.920) (-2006.012) (-1999.818) [-1996.951] * (-2006.828) [-2006.616] (-2002.805) (-2013.934) -- 0:06:37
      34500 -- [-2005.715] (-2003.690) (-2006.145) (-2009.745) * (-2007.099) [-2002.312] (-2007.464) (-2004.878) -- 0:06:31
      35000 -- [-2004.100] (-2002.823) (-1997.586) (-2009.867) * (-2014.586) (-1999.111) (-2009.390) [-1999.997] -- 0:06:26

      Average standard deviation of split frequencies: 0.043135

      35500 -- (-2005.137) [-2001.390] (-2003.709) (-2001.726) * (-2011.440) [-2000.886] (-2010.668) (-2006.953) -- 0:06:20
      36000 -- (-2008.274) (-2007.160) (-2002.924) [-1998.189] * (-2001.874) [-1999.793] (-2009.411) (-2010.571) -- 0:06:41
      36500 -- (-2012.258) [-2002.600] (-2012.253) (-2004.046) * (-2004.420) [-2004.876] (-2005.256) (-2003.422) -- 0:06:35
      37000 -- (-2009.139) (-2007.586) (-2014.453) [-2000.894] * (-2002.953) [-2006.003] (-2001.549) (-1999.133) -- 0:06:30
      37500 -- [-2003.748] (-2007.901) (-2005.937) (-2009.543) * (-2000.814) [-1998.527] (-2002.281) (-2006.446) -- 0:06:25
      38000 -- (-2011.899) [-2010.116] (-2006.222) (-2004.928) * (-2003.511) (-2001.885) (-2005.248) [-2007.585] -- 0:06:19
      38500 -- (-2004.714) [-2002.972] (-2017.668) (-2008.488) * (-2002.228) (-2011.350) (-2011.644) [-2008.843] -- 0:06:39
      39000 -- (-2002.830) (-2010.992) [-2003.944] (-2008.126) * [-2005.905] (-2006.613) (-2003.852) (-1998.243) -- 0:06:34
      39500 -- (-1994.431) (-2001.812) (-2008.207) [-2009.411] * [-1999.396] (-2014.367) (-2016.159) (-2000.397) -- 0:06:29
      40000 -- [-1996.223] (-2005.511) (-1999.784) (-2003.759) * (-2006.078) [-1999.122] (-2012.522) (-2011.435) -- 0:06:24

      Average standard deviation of split frequencies: 0.033488

      40500 -- (-2005.806) [-1999.640] (-2002.916) (-2028.067) * (-2000.536) (-1997.297) [-2000.314] (-2012.683) -- 0:06:19
      41000 -- (-2005.676) (-2004.469) (-2003.978) [-1998.381] * [-2006.946] (-1999.698) (-2008.315) (-2008.388) -- 0:06:37
      41500 -- (-2007.023) (-1995.410) [-2006.374] (-1996.417) * (-2007.440) (-1999.264) [-1999.610] (-2008.325) -- 0:06:32
      42000 -- [-2000.895] (-2009.116) (-2005.392) (-2001.440) * (-2002.335) (-1998.083) (-2004.868) [-2001.653] -- 0:06:27
      42500 -- (-2007.380) (-2016.425) [-2002.957] (-2000.076) * (-2002.017) (-2005.933) (-2010.000) [-2004.810] -- 0:06:23
      43000 -- (-2005.159) (-2015.172) (-2009.719) [-2004.281] * (-1998.831) (-1997.445) (-2006.369) [-1994.308] -- 0:06:18
      43500 -- [-1999.440] (-2007.211) (-2011.181) (-2006.985) * (-2012.965) (-2007.920) [-2001.412] (-2002.676) -- 0:06:35
      44000 -- (-1999.719) (-2004.653) [-1994.309] (-2011.869) * (-2014.696) [-1999.443] (-2000.576) (-2007.419) -- 0:06:31
      44500 -- (-2001.480) [-2005.449] (-2010.370) (-2000.479) * [-2004.051] (-2015.120) (-2013.995) (-2008.769) -- 0:06:26
      45000 -- (-2003.699) (-2013.364) (-2005.510) [-2007.846] * (-2009.033) (-2016.539) (-2005.623) [-1998.808] -- 0:06:22

      Average standard deviation of split frequencies: 0.029036

      45500 -- (-1996.014) [-2012.568] (-2002.972) (-1993.947) * (-2014.204) (-2007.903) (-2016.428) [-1998.244] -- 0:06:17
      46000 -- (-2004.609) (-2018.746) [-2005.838] (-2006.398) * (-2002.916) (-1999.840) (-2015.969) [-2003.893] -- 0:06:34
      46500 -- (-2007.251) (-2013.560) (-2015.594) [-2005.574] * [-1998.254] (-2006.088) (-2001.651) (-2011.433) -- 0:06:29
      47000 -- [-2005.462] (-2007.771) (-2013.767) (-2013.981) * [-1999.669] (-2001.770) (-1998.979) (-1999.612) -- 0:06:25
      47500 -- (-2004.262) [-2001.624] (-2010.623) (-2007.361) * (-2012.642) (-2004.875) (-2015.294) [-2007.985] -- 0:06:21
      48000 -- [-1998.923] (-2000.867) (-2004.134) (-1999.497) * (-1997.731) (-2009.319) [-2005.972] (-2005.880) -- 0:06:16
      48500 -- [-2003.032] (-2007.234) (-2003.495) (-1993.902) * [-1994.283] (-2011.931) (-2002.332) (-2003.979) -- 0:06:32
      49000 -- (-2011.444) (-2017.215) (-2006.882) [-2000.238] * (-2004.259) (-2009.454) [-2002.029] (-2011.132) -- 0:06:28
      49500 -- (-2010.455) (-2006.876) [-2003.750] (-2014.107) * [-2003.291] (-2008.423) (-2003.423) (-2004.110) -- 0:06:24
      50000 -- (-2004.895) (-2000.108) [-2006.118] (-2012.698) * (-2005.694) (-2010.008) (-1997.571) [-1998.714] -- 0:06:20

      Average standard deviation of split frequencies: 0.028459

      50500 -- [-2006.794] (-2001.534) (-2011.529) (-2001.603) * (-2000.844) [-2005.861] (-2000.245) (-2010.435) -- 0:06:16
      51000 -- [-1998.088] (-2000.375) (-2018.121) (-2020.286) * (-2003.957) (-2002.244) [-2001.961] (-2009.349) -- 0:06:30
      51500 -- [-1998.013] (-1995.733) (-2019.378) (-2005.878) * (-2004.685) (-2001.283) [-2003.944] (-2021.655) -- 0:06:26
      52000 -- (-2003.112) [-2003.393] (-2006.832) (-2005.382) * [-1998.562] (-2001.432) (-2010.128) (-2012.755) -- 0:06:22
      52500 -- [-2000.407] (-2003.945) (-2006.939) (-2009.553) * (-2014.289) [-2001.416] (-2005.348) (-2013.990) -- 0:06:19
      53000 -- (-2017.863) (-2013.727) [-1995.632] (-2013.094) * (-2020.581) [-2000.928] (-2000.989) (-2012.866) -- 0:06:15
      53500 -- [-1998.465] (-2011.460) (-2006.592) (-2005.210) * [-2007.411] (-2011.735) (-2012.208) (-2000.159) -- 0:06:29
      54000 -- (-2005.349) (-2012.038) (-1997.020) [-2010.208] * (-2004.253) (-2010.976) [-1997.998] (-2021.753) -- 0:06:25
      54500 -- (-2007.914) (-2012.689) [-2000.111] (-1997.407) * (-1996.118) (-2006.017) [-2006.809] (-1999.354) -- 0:06:21
      55000 -- [-1995.323] (-2004.345) (-2003.803) (-2000.615) * (-2002.669) (-2004.138) [-1999.878] (-2002.815) -- 0:06:18

      Average standard deviation of split frequencies: 0.029463

      55500 -- (-1996.747) (-2007.405) [-2000.649] (-2006.265) * [-2010.213] (-1998.110) (-2010.700) (-2008.942) -- 0:06:14
      56000 -- (-2005.105) (-2007.832) (-2014.013) [-2002.430] * [-2007.152] (-2009.013) (-2003.519) (-2010.613) -- 0:06:27
      56500 -- (-2008.755) [-2011.665] (-2006.664) (-2010.020) * (-2006.669) (-2011.216) (-2012.243) [-1999.708] -- 0:06:24
      57000 -- (-1994.356) (-1997.672) [-2001.978] (-2002.428) * (-2009.129) (-2000.454) [-2012.156] (-2024.993) -- 0:06:20
      57500 -- (-2001.316) [-1995.643] (-1997.468) (-1999.195) * (-2016.371) [-1999.236] (-2004.991) (-2002.127) -- 0:06:17
      58000 -- [-2002.771] (-2007.952) (-2001.570) (-2007.591) * (-2008.185) [-2015.461] (-2014.002) (-2000.736) -- 0:06:13
      58500 -- [-1996.974] (-2000.932) (-1998.936) (-2016.008) * (-2012.907) [-1999.890] (-2003.643) (-2012.505) -- 0:06:26
      59000 -- (-1997.350) (-1995.565) [-1997.237] (-2008.312) * (-2003.699) (-2005.552) [-2007.410] (-2013.419) -- 0:06:22
      59500 -- (-2004.250) (-2016.065) (-2000.378) [-1995.831] * (-2021.229) (-2005.946) [-2004.265] (-2003.037) -- 0:06:19
      60000 -- (-2007.965) (-2010.681) (-2013.954) [-1997.254] * (-2004.553) [-2001.427] (-2000.475) (-2003.201) -- 0:06:16

      Average standard deviation of split frequencies: 0.026711

      60500 -- (-2011.941) (-2000.728) (-2001.478) [-1998.399] * (-2003.132) [-1999.009] (-2000.025) (-2000.307) -- 0:06:12
      61000 -- (-2014.574) (-2005.342) [-2000.016] (-1997.534) * (-2004.329) [-2005.806] (-2011.610) (-2002.739) -- 0:06:24
      61500 -- [-2005.553] (-2001.661) (-2009.996) (-2010.450) * (-1993.335) (-2006.939) [-2005.603] (-2004.123) -- 0:06:21
      62000 -- (-2001.566) (-2002.272) [-2002.507] (-2006.239) * (-2015.378) [-2014.412] (-2004.277) (-2009.194) -- 0:06:18
      62500 -- [-1997.672] (-2001.390) (-2012.101) (-2015.075) * [-2003.780] (-1997.695) (-2008.696) (-2005.126) -- 0:06:15
      63000 -- (-2005.397) [-2005.392] (-2009.976) (-2005.663) * (-2006.606) (-2011.372) [-2000.643] (-2001.182) -- 0:06:11
      63500 -- (-2018.714) [-1998.187] (-2007.987) (-1998.053) * (-2002.402) (-2017.788) (-2004.181) [-2003.608] -- 0:06:23
      64000 -- [-2000.981] (-2007.924) (-2009.915) (-2003.196) * (-2007.086) (-2019.704) (-2000.830) [-1997.733] -- 0:06:20
      64500 -- (-2004.859) [-2009.329] (-2007.455) (-2009.522) * [-2001.414] (-2007.145) (-2009.785) (-1997.579) -- 0:06:17
      65000 -- (-2003.583) [-1997.191] (-2005.343) (-2011.119) * [-1998.162] (-2009.624) (-2001.191) (-2008.082) -- 0:06:14

      Average standard deviation of split frequencies: 0.027231

      65500 -- (-2001.067) (-2010.301) (-2016.853) [-2007.315] * (-1997.053) (-2009.789) [-2003.545] (-2008.523) -- 0:06:10
      66000 -- (-2006.950) (-2020.848) (-2005.789) [-1999.428] * (-1999.725) (-2016.693) (-2011.999) [-2008.060] -- 0:06:22
      66500 -- (-2011.460) [-2007.584] (-2003.970) (-2003.413) * (-2007.141) (-2006.780) [-1998.640] (-2002.932) -- 0:06:19
      67000 -- (-1999.761) [-2005.203] (-2012.847) (-2010.855) * (-2004.015) (-2009.786) (-2003.736) [-2002.583] -- 0:06:15
      67500 -- (-2005.997) (-2005.004) [-1998.470] (-2019.235) * (-2004.950) [-2012.736] (-2001.844) (-1999.276) -- 0:06:13
      68000 -- [-1997.758] (-2009.520) (-2003.959) (-2002.346) * (-2015.672) (-1997.002) [-2001.409] (-2000.091) -- 0:06:10
      68500 -- [-2007.262] (-2017.365) (-2006.490) (-2006.712) * (-2012.496) [-2001.767] (-2006.077) (-2000.236) -- 0:06:20
      69000 -- [-1999.104] (-2014.593) (-2016.685) (-2020.400) * (-2006.665) [-2000.201] (-2004.413) (-2002.594) -- 0:06:17
      69500 -- (-2011.991) (-2014.334) [-2009.070] (-2014.463) * (-2008.533) [-1998.624] (-2009.797) (-2001.193) -- 0:06:14
      70000 -- (-2002.246) (-2008.808) [-2013.431] (-2005.414) * (-2011.239) [-2002.035] (-2006.591) (-1998.114) -- 0:06:12

      Average standard deviation of split frequencies: 0.028351

      70500 -- (-2003.211) (-2003.286) (-2008.995) [-1999.708] * (-2018.756) (-1999.369) (-2003.438) [-2008.778] -- 0:06:22
      71000 -- (-2005.305) (-2008.108) (-2019.201) [-1992.740] * (-2004.284) [-1994.983] (-1996.383) (-2007.166) -- 0:06:19
      71500 -- [-2002.719] (-1999.744) (-2013.308) (-2004.602) * (-2001.929) (-2006.066) [-2004.230] (-2004.755) -- 0:06:16
      72000 -- (-1999.828) [-2001.326] (-2009.882) (-2000.554) * (-2017.150) (-2009.308) (-2005.862) [-2008.466] -- 0:06:13
      72500 -- (-2012.832) [-2000.155] (-2012.858) (-2004.411) * [-2001.614] (-2005.273) (-2008.215) (-2000.169) -- 0:06:11
      73000 -- (-2007.535) (-2004.974) (-1998.347) [-1996.498] * (-2007.484) (-2000.368) [-2003.765] (-1996.662) -- 0:06:20
      73500 -- (-2000.001) (-2004.921) (-2003.209) [-1999.630] * (-2007.228) [-1998.297] (-2000.948) (-2006.097) -- 0:06:18
      74000 -- (-2003.967) [-2000.673] (-2014.435) (-2012.681) * (-2005.366) (-1997.868) [-2003.024] (-2008.768) -- 0:06:15
      74500 -- [-2000.613] (-2007.104) (-2002.568) (-2002.264) * (-2020.897) (-2004.984) (-2004.849) [-2000.579] -- 0:06:12
      75000 -- (-2003.551) [-2001.999] (-2007.448) (-2000.504) * (-2003.183) (-2004.806) [-2009.500] (-2000.327) -- 0:06:10

      Average standard deviation of split frequencies: 0.027524

      75500 -- (-2008.135) (-2002.019) [-1993.216] (-2014.227) * (-2009.932) (-2012.820) (-2007.518) [-1996.025] -- 0:06:19
      76000 -- (-2004.602) (-2004.862) (-1996.286) [-2007.794] * (-2018.595) (-2004.213) (-2007.115) [-2005.656] -- 0:06:16
      76500 -- (-2014.685) (-2012.166) (-2008.800) [-2004.374] * (-2024.826) (-2002.753) (-2012.340) [-1999.247] -- 0:06:14
      77000 -- (-2010.848) [-2001.024] (-2003.992) (-2000.053) * (-2019.747) [-1996.586] (-2011.927) (-2013.922) -- 0:06:11
      77500 -- (-2001.353) (-2011.927) (-2006.391) [-1995.392] * (-2022.797) (-1996.172) [-1999.094] (-2010.779) -- 0:06:09
      78000 -- (-2016.448) [-1997.490] (-2007.300) (-2005.248) * (-2009.658) [-1996.882] (-2017.091) (-2012.451) -- 0:06:18
      78500 -- (-2008.547) (-2001.612) [-1997.146] (-2000.510) * (-2015.379) [-2000.596] (-2004.441) (-2015.078) -- 0:06:15
      79000 -- (-2001.585) (-1994.501) (-2006.632) [-2005.828] * (-2009.310) (-1996.613) (-2008.120) [-2006.474] -- 0:06:13
      79500 -- (-2000.196) [-2004.826] (-2005.429) (-1999.749) * (-2004.017) [-1999.572] (-2006.346) (-2000.607) -- 0:06:10
      80000 -- [-2002.940] (-1994.597) (-2007.701) (-2003.789) * (-2003.377) [-2001.994] (-2006.057) (-2004.768) -- 0:06:08

      Average standard deviation of split frequencies: 0.029950

      80500 -- [-1995.568] (-2007.770) (-2006.768) (-2002.296) * (-2005.012) (-2001.264) [-1994.823] (-2007.123) -- 0:06:16
      81000 -- (-2000.958) (-2014.616) [-2004.436] (-1997.727) * (-2006.331) (-2002.534) (-1993.509) [-1999.806] -- 0:06:14
      81500 -- (-1994.374) (-2010.449) (-1996.744) [-1999.085] * (-2013.268) [-2006.879] (-2001.585) (-2005.780) -- 0:06:11
      82000 -- [-1994.875] (-2008.619) (-2007.232) (-2017.763) * (-2002.636) (-2014.202) [-2001.927] (-2011.071) -- 0:06:09
      82500 -- [-2000.589] (-2007.872) (-2003.886) (-2007.438) * [-1998.419] (-2005.104) (-2003.728) (-2007.677) -- 0:06:07
      83000 -- [-2005.020] (-2009.951) (-2005.260) (-2013.911) * (-2008.449) [-2001.563] (-2002.248) (-2006.557) -- 0:06:15
      83500 -- (-2004.267) (-2018.265) (-2016.096) [-2009.928] * (-2003.132) [-1997.703] (-2006.560) (-2012.125) -- 0:06:13
      84000 -- [-1999.180] (-2006.706) (-2003.715) (-1997.947) * [-1999.737] (-1999.664) (-2013.399) (-2009.039) -- 0:06:10
      84500 -- (-1998.344) [-1993.335] (-2008.794) (-2013.187) * (-2012.987) (-2000.269) (-2012.803) [-1998.127] -- 0:06:08
      85000 -- (-2016.260) [-1999.090] (-2014.928) (-2005.617) * (-2004.884) [-2004.297] (-2006.622) (-2007.757) -- 0:06:06

      Average standard deviation of split frequencies: 0.031861

      85500 -- [-1998.607] (-2010.443) (-2009.946) (-2017.958) * (-2000.136) [-2004.109] (-2016.007) (-2004.127) -- 0:06:14
      86000 -- [-2001.115] (-2008.584) (-2007.690) (-2007.733) * (-2013.527) (-2002.463) [-2000.725] (-1995.411) -- 0:06:11
      86500 -- [-1999.072] (-1998.941) (-2006.092) (-2012.358) * (-2001.728) (-2008.889) (-1999.586) [-1996.081] -- 0:06:09
      87000 -- (-2002.667) (-2007.994) [-2001.115] (-2013.289) * (-2004.780) (-2005.366) (-1999.313) [-1998.385] -- 0:06:07
      87500 -- [-1996.712] (-2004.373) (-2004.824) (-2014.143) * (-2005.001) (-2018.448) (-2005.450) [-2002.794] -- 0:06:05
      88000 -- (-2018.476) (-2006.133) [-1998.616] (-2000.882) * (-1998.753) (-2018.777) (-2001.016) [-2018.949] -- 0:06:13
      88500 -- (-2006.057) (-1999.586) [-2004.076] (-2007.689) * (-2008.544) (-2012.363) [-2003.036] (-2015.327) -- 0:06:10
      89000 -- [-2000.644] (-2006.146) (-2004.978) (-2004.857) * (-2000.012) (-2015.327) [-2008.018] (-2002.713) -- 0:06:08
      89500 -- [-1998.982] (-2002.211) (-2009.060) (-2005.628) * (-2004.996) (-2000.547) (-2007.878) [-2010.619] -- 0:06:06
      90000 -- (-2008.081) (-2019.378) [-2006.527] (-2001.165) * [-1997.217] (-2002.060) (-2016.973) (-2012.748) -- 0:06:04

      Average standard deviation of split frequencies: 0.026302

      90500 -- (-2007.129) (-2002.808) (-2001.147) [-1996.550] * (-2002.496) (-2012.586) (-1997.349) [-2016.885] -- 0:06:11
      91000 -- (-1998.476) (-2008.324) [-1998.216] (-2002.624) * (-2013.706) (-2007.570) [-2006.560] (-2011.065) -- 0:06:09
      91500 -- (-2008.040) (-2001.810) [-1996.241] (-1995.219) * (-2002.202) (-2001.049) (-2003.121) [-2007.603] -- 0:06:07
      92000 -- (-2005.942) (-2007.858) (-2008.530) [-2004.444] * (-2007.076) (-2013.476) [-1997.854] (-2000.739) -- 0:06:05
      92500 -- (-1996.920) (-2003.148) (-2008.835) [-1998.933] * [-2000.276] (-2010.715) (-1999.906) (-2003.391) -- 0:06:03
      93000 -- (-2001.336) (-2013.295) [-2000.858] (-2000.313) * (-2006.527) (-2013.163) (-2003.202) [-1998.596] -- 0:06:10
      93500 -- [-1999.574] (-2003.877) (-2000.765) (-1998.408) * (-1997.459) (-1995.680) [-2005.485] (-2004.931) -- 0:06:08
      94000 -- (-2010.329) (-2007.184) [-2001.784] (-2009.579) * [-1997.894] (-2004.765) (-2009.770) (-2001.925) -- 0:06:06
      94500 -- [-2006.646] (-2008.015) (-2004.170) (-2005.103) * (-2012.706) [-2009.531] (-2013.132) (-2009.935) -- 0:06:04
      95000 -- [-2002.165] (-1995.307) (-2021.175) (-2012.867) * (-2007.786) [-1998.354] (-2005.724) (-2004.465) -- 0:06:02

      Average standard deviation of split frequencies: 0.030040

      95500 -- (-2009.399) (-2000.358) [-2002.580] (-2001.323) * (-1997.929) (-2003.119) (-2006.322) [-2007.060] -- 0:06:09
      96000 -- (-2022.351) [-2006.316] (-1998.660) (-2003.145) * (-2005.571) [-2004.240] (-2016.293) (-2006.723) -- 0:06:07
      96500 -- (-1998.940) (-2018.612) [-1998.022] (-1999.157) * (-2008.487) (-2003.688) (-2000.779) [-1995.081] -- 0:06:05
      97000 -- (-2006.078) [-2002.070] (-2006.788) (-2004.756) * (-2009.036) (-2001.815) (-2010.903) [-1998.890] -- 0:06:03
      97500 -- (-1999.248) (-2006.518) [-2001.434] (-1998.187) * (-2001.515) (-2005.040) (-2020.076) [-2003.147] -- 0:06:01
      98000 -- (-2000.483) (-2008.668) [-1996.658] (-2001.236) * (-1996.938) (-2007.101) [-2008.875] (-1996.823) -- 0:05:58
      98500 -- (-2006.853) (-2008.112) [-2002.459] (-2004.124) * (-2002.030) (-2007.705) (-2001.636) [-1999.496] -- 0:06:06
      99000 -- (-2009.017) (-1999.842) [-1997.292] (-2006.120) * (-2014.191) (-2002.202) [-1998.571] (-2001.745) -- 0:06:04
      99500 -- (-2004.531) [-1999.641] (-2006.865) (-1998.043) * [-1997.179] (-2004.306) (-1999.511) (-2008.030) -- 0:06:02
      100000 -- (-2003.419) (-2008.555) (-2002.966) [-1995.669] * (-2006.884) (-2003.321) [-2002.544] (-1996.111) -- 0:06:00

      Average standard deviation of split frequencies: 0.033055

      100500 -- (-2001.244) (-2005.921) (-2002.602) [-1997.716] * (-2000.462) (-1998.628) [-1994.056] (-2004.472) -- 0:05:58
      101000 -- (-2002.255) [-1997.487] (-2003.742) (-1999.258) * (-2011.407) (-2002.000) (-1993.023) [-2009.562] -- 0:06:04
      101500 -- (-1992.851) [-2000.383] (-2008.866) (-2005.592) * (-2012.649) [-1999.320] (-1996.516) (-2008.236) -- 0:06:02
      102000 -- (-2007.367) (-2017.625) (-2006.674) [-2003.443] * [-2012.264] (-2005.709) (-2004.300) (-2014.741) -- 0:06:00
      102500 -- [-2003.581] (-2006.928) (-2010.386) (-2003.948) * [-1999.658] (-1995.445) (-2007.528) (-2019.994) -- 0:05:59
      103000 -- [-1999.106] (-2005.250) (-2007.596) (-2007.688) * (-1998.579) (-2016.897) [-1999.430] (-2015.284) -- 0:05:57
      103500 -- (-2000.685) (-2002.284) (-2000.776) [-2006.164] * (-2016.603) (-2000.353) [-2015.178] (-2006.758) -- 0:06:03
      104000 -- (-2001.776) (-2004.981) [-2009.479] (-2009.860) * [-1996.906] (-2018.941) (-2018.160) (-2005.419) -- 0:06:01
      104500 -- [-2005.371] (-2016.180) (-1999.802) (-2013.434) * (-2000.784) (-2015.343) (-2004.995) [-1996.061] -- 0:05:59
      105000 -- [-1999.410] (-2014.134) (-2012.876) (-2016.776) * (-2007.882) (-2008.823) [-2005.249] (-1999.586) -- 0:05:58

      Average standard deviation of split frequencies: 0.034531

      105500 -- (-2000.139) [-2005.614] (-2012.872) (-2009.469) * (-1998.382) (-2008.219) [-2001.082] (-1996.787) -- 0:05:56
      106000 -- [-1996.466] (-2008.109) (-2006.138) (-2008.451) * (-1998.696) (-2007.655) [-2005.103] (-2020.806) -- 0:06:02
      106500 -- (-2000.691) (-2018.851) [-2001.503] (-2013.435) * (-2009.449) (-2008.029) [-1996.704] (-2014.325) -- 0:06:00
      107000 -- (-1998.806) (-2002.617) (-2013.941) [-2005.298] * (-2007.350) [-2000.767] (-2012.399) (-2001.598) -- 0:05:58
      107500 -- (-2008.562) [-1998.316] (-2011.287) (-2004.852) * (-2009.569) (-2004.132) (-2008.515) [-2004.472] -- 0:05:57
      108000 -- [-2008.403] (-2010.086) (-2005.051) (-2001.845) * (-1999.514) (-2000.406) (-2006.708) [-2003.724] -- 0:05:55
      108500 -- (-2014.705) (-2003.596) [-1995.334] (-2003.545) * (-2010.873) (-2007.265) [-2002.053] (-2006.735) -- 0:06:01
      109000 -- (-2008.142) (-2013.525) (-1998.649) [-2004.624] * [-1998.603] (-2002.395) (-1995.354) (-1998.197) -- 0:05:59
      109500 -- (-2013.008) [-2001.026] (-2005.134) (-2004.593) * [-2008.323] (-2007.039) (-2007.091) (-2001.059) -- 0:05:57
      110000 -- (-2015.699) [-2009.893] (-2004.187) (-2006.364) * (-2000.234) [-2004.748] (-2008.797) (-1998.025) -- 0:05:56

      Average standard deviation of split frequencies: 0.030350

      110500 -- (-2005.708) [-2002.243] (-2006.840) (-2002.861) * (-2004.181) [-2001.945] (-2013.506) (-2007.822) -- 0:05:54
      111000 -- (-2007.975) (-2010.994) (-2004.130) [-1999.014] * [-2004.455] (-1997.252) (-2028.820) (-2003.723) -- 0:06:00
      111500 -- (-2005.989) (-2001.100) [-1998.703] (-2001.145) * (-2019.943) (-2004.028) (-2011.429) [-2004.761] -- 0:05:58
      112000 -- (-2005.521) (-1996.534) (-2008.274) [-2005.618] * (-2013.464) [-2003.695] (-2006.622) (-2005.481) -- 0:05:56
      112500 -- (-2008.140) [-2000.698] (-2005.654) (-2018.630) * (-2007.854) (-2010.664) [-2001.750] (-2006.967) -- 0:05:55
      113000 -- (-2005.179) [-1993.647] (-2000.722) (-1997.047) * (-2011.212) (-2015.086) (-2015.323) [-1998.267] -- 0:05:53
      113500 -- (-2002.441) [-1997.519] (-2005.747) (-2014.052) * (-2001.728) [-2010.478] (-2008.118) (-2005.597) -- 0:05:59
      114000 -- (-2000.810) (-2006.650) [-1999.228] (-2004.422) * (-2010.875) (-2000.018) (-1996.779) [-1999.667] -- 0:05:57
      114500 -- (-2001.538) (-2010.728) [-1998.122] (-2001.653) * (-2006.149) (-2010.603) (-2012.741) [-2000.908] -- 0:05:55
      115000 -- (-2012.446) [-2001.195] (-2001.560) (-1991.835) * (-2005.077) (-2004.791) (-2009.703) [-1997.976] -- 0:05:54

      Average standard deviation of split frequencies: 0.033273

      115500 -- (-2004.037) (-2003.394) (-2003.985) [-1995.816] * (-2000.723) (-2012.430) (-2017.644) [-2000.622] -- 0:05:52
      116000 -- (-1997.858) [-2001.484] (-2000.748) (-2009.255) * (-2001.871) (-2009.513) [-1999.244] (-2002.730) -- 0:05:58
      116500 -- (-2011.381) [-2008.772] (-2014.446) (-2006.346) * (-2009.388) (-2013.262) (-2002.545) [-2005.097] -- 0:05:56
      117000 -- (-2006.978) [-1993.954] (-2016.378) (-2013.518) * (-2013.556) [-2009.822] (-2008.346) (-2009.542) -- 0:05:54
      117500 -- (-2008.764) (-2007.852) [-2004.838] (-2003.500) * (-1999.503) (-2013.395) (-2011.020) [-2006.414] -- 0:05:53
      118000 -- (-2005.423) (-2003.287) [-1997.475] (-1999.763) * (-2003.856) (-2009.998) (-2010.167) [-1997.912] -- 0:05:51
      118500 -- (-2005.916) (-2007.025) (-2010.322) [-2000.850] * [-1998.337] (-2004.302) (-2006.562) (-2006.939) -- 0:05:57
      119000 -- (-2005.740) (-2011.895) (-2004.785) [-1995.003] * [-1997.257] (-2009.875) (-2005.912) (-2010.172) -- 0:05:55
      119500 -- (-1997.862) [-2007.812] (-2011.906) (-2001.562) * [-1996.098] (-2004.402) (-1995.414) (-2011.065) -- 0:05:53
      120000 -- (-2013.515) (-2005.784) [-2006.618] (-1998.308) * (-2007.361) [-2004.212] (-2007.239) (-2004.192) -- 0:05:52

      Average standard deviation of split frequencies: 0.038823

      120500 -- [-2002.123] (-2003.873) (-2024.437) (-2002.718) * (-2007.591) (-1994.652) (-2008.486) [-2006.428] -- 0:05:50
      121000 -- [-1996.577] (-2005.333) (-1998.589) (-2014.672) * (-2013.854) [-2001.884] (-2006.617) (-2006.860) -- 0:05:55
      121500 -- (-2014.027) (-2019.243) [-2002.617] (-2003.504) * (-2006.865) [-2006.376] (-2015.021) (-2014.144) -- 0:05:54
      122000 -- (-2015.286) (-2000.866) (-2000.678) [-2005.975] * (-2008.674) (-2005.157) [-1998.077] (-2007.901) -- 0:05:52
      122500 -- (-2011.395) (-1997.416) (-2011.991) [-2006.863] * (-2009.970) (-2010.587) [-1999.263] (-2002.136) -- 0:05:51
      123000 -- (-2009.726) (-1996.918) (-2006.010) [-2008.969] * [-2002.369] (-2007.925) (-1994.198) (-1999.189) -- 0:05:49
      123500 -- [-2006.227] (-2020.427) (-2006.200) (-2004.179) * (-2012.039) [-2012.386] (-2011.526) (-2003.040) -- 0:05:54
      124000 -- (-2013.883) (-2006.003) (-1996.761) [-2009.969] * (-2015.525) (-2001.877) (-2008.478) [-1998.376] -- 0:05:53
      124500 -- (-2004.140) (-2001.465) [-2004.881] (-2004.231) * [-2005.310] (-2015.836) (-2004.625) (-2003.796) -- 0:05:51
      125000 -- (-2003.341) (-1995.573) (-2013.805) [-2003.220] * (-2015.542) (-2008.182) (-2006.841) [-1998.671] -- 0:05:50

      Average standard deviation of split frequencies: 0.036712

      125500 -- (-2008.349) [-2001.012] (-2007.931) (-2006.703) * (-2001.261) [-1999.939] (-2011.118) (-2017.843) -- 0:05:48
      126000 -- (-2016.425) (-2003.331) [-2013.060] (-2007.586) * (-2002.312) (-2006.807) (-2013.882) [-1996.333] -- 0:05:53
      126500 -- (-2001.563) (-2011.841) [-2006.019] (-2000.388) * (-2007.523) [-2004.521] (-2025.749) (-1997.848) -- 0:05:52
      127000 -- [-1998.152] (-2012.966) (-2000.304) (-2006.459) * (-2002.364) (-2010.576) (-2011.394) [-2001.477] -- 0:05:50
      127500 -- (-2000.399) (-2005.243) [-1999.047] (-2009.335) * (-2011.192) [-1997.200] (-2011.748) (-2020.262) -- 0:05:49
      128000 -- (-2005.414) (-1999.028) [-2001.330] (-2021.456) * (-2006.856) [-2005.641] (-2000.724) (-2006.066) -- 0:05:47
      128500 -- (-2010.540) [-1998.585] (-2002.334) (-2005.698) * (-2010.739) (-2013.911) (-2017.149) [-2003.646] -- 0:05:52
      129000 -- [-2011.874] (-1998.955) (-2014.435) (-2010.809) * (-1999.357) (-2001.079) [-2003.294] (-2011.726) -- 0:05:51
      129500 -- (-2013.190) (-2006.763) (-2022.389) [-2014.587] * (-2012.945) [-2003.906] (-2007.588) (-2002.941) -- 0:05:49
      130000 -- (-2005.525) [-1999.117] (-2005.520) (-2015.584) * (-2005.706) (-2004.351) [-1998.222] (-2009.269) -- 0:05:48

      Average standard deviation of split frequencies: 0.033822

      130500 -- (-2007.297) (-2003.987) (-2005.027) [-2005.199] * (-2012.181) (-2013.855) [-2001.075] (-2024.129) -- 0:05:46
      131000 -- (-1999.718) (-2021.922) (-2000.208) [-2001.440] * (-2004.147) (-2010.562) (-2021.731) [-2009.851] -- 0:05:51
      131500 -- [-2004.006] (-2006.592) (-2004.138) (-2003.732) * (-2012.333) [-2004.938] (-2018.034) (-2007.496) -- 0:05:50
      132000 -- (-2012.764) (-2011.477) (-2003.275) [-1999.319] * [-2009.943] (-2001.184) (-2020.408) (-2009.652) -- 0:05:48
      132500 -- (-2004.454) (-2010.573) [-2001.401] (-2001.100) * [-2001.458] (-2007.439) (-2021.559) (-2007.380) -- 0:05:47
      133000 -- [-2001.199] (-2008.499) (-2004.364) (-2014.414) * [-2003.473] (-2002.136) (-2025.445) (-2009.345) -- 0:05:45
      133500 -- (-2005.941) (-2011.203) [-1997.381] (-2014.904) * [-2005.031] (-2003.957) (-2011.375) (-1999.652) -- 0:05:50
      134000 -- (-1996.695) (-2016.759) [-2004.315] (-2002.919) * [-2010.675] (-1998.016) (-2018.388) (-2020.409) -- 0:05:48
      134500 -- (-2000.176) [-2000.106] (-2001.853) (-2013.773) * [-2006.180] (-1999.505) (-2010.457) (-2003.221) -- 0:05:47
      135000 -- [-1997.080] (-2006.953) (-1996.487) (-2019.171) * (-2006.056) [-2000.533] (-2004.706) (-2023.134) -- 0:05:46

      Average standard deviation of split frequencies: 0.032215

      135500 -- (-2001.027) (-2001.833) [-2001.012] (-2007.692) * [-1997.978] (-2001.913) (-1996.132) (-2001.735) -- 0:05:44
      136000 -- (-2001.314) (-2003.840) (-2021.192) [-2010.523] * [-2001.894] (-2001.457) (-2001.361) (-2001.005) -- 0:05:49
      136500 -- (-1992.851) (-2010.287) [-2004.232] (-2012.052) * (-2005.327) [-1997.629] (-2012.280) (-2008.896) -- 0:05:47
      137000 -- (-2000.976) (-2009.460) (-2007.149) [-2002.341] * (-2008.195) (-1999.167) (-2009.596) [-2001.571] -- 0:05:46
      137500 -- (-2010.448) (-2000.284) [-2005.312] (-2013.776) * (-2002.784) [-2001.420] (-2001.165) (-2000.492) -- 0:05:45
      138000 -- (-2008.566) (-2004.863) [-2006.139] (-2013.352) * [-2007.813] (-2011.041) (-2016.296) (-2005.243) -- 0:05:43
      138500 -- [-2003.289] (-2013.572) (-2003.659) (-2004.252) * (-2014.564) (-2003.325) [-2007.995] (-1995.083) -- 0:05:48
      139000 -- (-2006.717) (-2001.783) (-2014.149) [-2003.153] * (-2000.508) (-2011.894) (-2012.087) [-2005.364] -- 0:05:46
      139500 -- (-2008.940) (-2003.500) [-2013.352] (-2015.081) * (-2006.445) (-2012.462) [-2007.931] (-2007.017) -- 0:05:45
      140000 -- [-2003.010] (-2004.686) (-2012.740) (-2005.013) * (-2006.710) [-2002.393] (-2011.947) (-1999.043) -- 0:05:44

      Average standard deviation of split frequencies: 0.032527

      140500 -- (-2009.961) [-2001.572] (-2001.579) (-2011.577) * (-2010.012) [-2014.086] (-2007.965) (-1997.684) -- 0:05:42
      141000 -- (-2005.710) [-1998.456] (-2004.627) (-2011.918) * (-1998.638) (-2007.195) (-2014.525) [-2008.797] -- 0:05:47
      141500 -- (-2013.881) [-2015.104] (-2009.899) (-1998.615) * (-2003.893) [-2002.004] (-2015.637) (-2014.505) -- 0:05:45
      142000 -- (-2003.257) (-2011.696) (-2016.110) [-2000.004] * [-2000.376] (-1997.925) (-2013.686) (-2020.728) -- 0:05:44
      142500 -- (-2012.200) [-1995.853] (-2001.800) (-1997.690) * (-2011.343) (-2006.618) (-2007.549) [-2005.831] -- 0:05:43
      143000 -- (-2010.583) (-2013.253) [-1993.736] (-2007.019) * (-2006.254) [-2007.635] (-1998.449) (-2012.194) -- 0:05:41
      143500 -- [-1999.652] (-2004.235) (-2007.887) (-1997.659) * (-2007.201) (-1997.727) [-2002.677] (-2010.606) -- 0:05:46
      144000 -- [-1994.202] (-2000.871) (-2018.501) (-2006.464) * (-2015.527) (-2002.197) [-2008.086] (-2004.706) -- 0:05:44
      144500 -- [-2001.167] (-2004.185) (-2002.829) (-2016.331) * (-2006.139) (-2004.627) (-2005.175) [-1997.925] -- 0:05:43
      145000 -- (-2002.616) (-2013.243) (-2010.427) [-2003.773] * (-1993.896) [-2001.540] (-2016.502) (-1998.956) -- 0:05:42

      Average standard deviation of split frequencies: 0.031718

      145500 -- (-2001.187) [-2008.497] (-2000.833) (-2002.830) * [-2001.343] (-1999.990) (-2012.782) (-2007.056) -- 0:05:40
      146000 -- (-2009.178) (-1999.978) [-2002.595] (-2002.925) * [-2003.747] (-1998.905) (-2010.424) (-2010.078) -- 0:05:45
      146500 -- (-2007.118) [-2002.066] (-2005.560) (-2021.210) * (-2012.388) (-2010.550) [-2002.189] (-2002.786) -- 0:05:43
      147000 -- (-1997.990) (-2003.861) (-2007.187) [-2001.682] * [-1999.266] (-2010.060) (-2005.960) (-2021.614) -- 0:05:42
      147500 -- (-2003.742) (-2002.469) [-1999.792] (-2012.373) * (-1996.909) [-2005.748] (-2013.640) (-2010.185) -- 0:05:41
      148000 -- [-2004.854] (-2019.806) (-2015.701) (-2003.701) * [-2007.258] (-2008.030) (-2007.324) (-2014.936) -- 0:05:39
      148500 -- (-2017.850) (-2011.213) [-1998.616] (-1999.448) * (-2006.565) (-2022.639) (-2008.016) [-2003.324] -- 0:05:44
      149000 -- [-2005.537] (-2010.785) (-2010.875) (-2006.771) * (-2005.591) (-2015.697) (-2010.704) [-2004.331] -- 0:05:42
      149500 -- (-2003.265) [-2008.184] (-2009.723) (-2001.235) * (-1993.693) (-2017.731) [-2002.210] (-2010.836) -- 0:05:41
      150000 -- [-1998.748] (-2008.765) (-2001.481) (-2008.893) * (-2011.236) (-2010.660) [-1999.795] (-2002.803) -- 0:05:40

      Average standard deviation of split frequencies: 0.026790

      150500 -- (-2019.863) [-1998.479] (-2018.302) (-1999.386) * (-2016.217) (-2001.012) [-2005.039] (-2011.644) -- 0:05:38
      151000 -- (-2012.958) [-1999.080] (-2004.501) (-1996.480) * (-2003.091) (-1994.527) [-1999.506] (-2001.478) -- 0:05:42
      151500 -- (-1997.853) [-1995.020] (-2010.568) (-1999.541) * (-2008.978) [-1994.210] (-1997.728) (-2004.368) -- 0:05:41
      152000 -- [-1994.600] (-2008.341) (-2003.676) (-2013.740) * (-2017.705) (-2000.519) [-2001.951] (-2004.151) -- 0:05:40
      152500 -- (-2003.604) (-2005.366) [-2009.307] (-2007.753) * (-2008.359) [-1997.617] (-2001.687) (-2015.357) -- 0:05:39
      153000 -- [-2010.988] (-2003.817) (-2029.357) (-2008.006) * (-2005.162) (-2003.969) [-1997.631] (-2005.102) -- 0:05:37
      153500 -- [-2000.360] (-2001.626) (-2011.535) (-2008.030) * (-2005.421) (-2008.843) [-2004.689] (-2009.560) -- 0:05:41
      154000 -- (-2000.851) [-1999.541] (-2009.476) (-2014.623) * [-2007.333] (-2002.249) (-2004.321) (-2012.194) -- 0:05:40
      154500 -- (-2012.024) (-2004.884) (-2007.004) [-2002.818] * (-2005.113) (-1999.458) (-2003.426) [-1997.445] -- 0:05:39
      155000 -- [-1993.273] (-2018.012) (-2011.761) (-2008.992) * (-2008.243) [-2002.933] (-1998.345) (-2006.538) -- 0:05:38

      Average standard deviation of split frequencies: 0.029085

      155500 -- (-1998.742) (-2011.085) (-2017.348) [-2006.528] * [-2009.082] (-2014.345) (-2002.995) (-2005.007) -- 0:05:36
      156000 -- (-2008.678) [-1998.828] (-2007.498) (-2002.968) * [-1999.073] (-2007.155) (-2001.836) (-2005.571) -- 0:05:40
      156500 -- (-2006.043) (-2000.206) [-2005.934] (-2000.687) * [-1999.425] (-2014.483) (-2007.362) (-2006.494) -- 0:05:39
      157000 -- (-2008.837) (-2005.345) [-2005.388] (-2006.173) * (-2001.501) [-2000.154] (-2008.890) (-2007.321) -- 0:05:38
      157500 -- (-2012.347) [-2004.999] (-2012.903) (-2014.718) * (-1996.224) [-2008.404] (-2015.555) (-2006.175) -- 0:05:37
      158000 -- (-2014.131) (-2008.920) [-1994.458] (-2004.772) * [-2016.064] (-2011.400) (-2012.099) (-2012.240) -- 0:05:35
      158500 -- [-1997.840] (-2009.508) (-1995.576) (-2008.067) * (-2008.516) (-2017.224) (-2011.094) [-2001.334] -- 0:05:39
      159000 -- (-2012.892) (-2002.874) [-2009.310] (-2002.479) * [-2004.445] (-2003.350) (-2009.908) (-2002.987) -- 0:05:38
      159500 -- (-2002.928) (-2008.872) [-2003.608] (-2008.062) * [-2002.478] (-2010.220) (-2011.308) (-2006.416) -- 0:05:37
      160000 -- (-2002.494) (-2010.211) (-2003.253) [-1997.439] * [-1996.502] (-2002.459) (-2016.412) (-2001.989) -- 0:05:36

      Average standard deviation of split frequencies: 0.029707

      160500 -- (-2014.270) (-2009.155) [-2008.711] (-2002.159) * (-2012.051) [-2000.547] (-2019.474) (-2001.148) -- 0:05:34
      161000 -- (-1999.246) [-1998.684] (-1998.116) (-2011.205) * [-2008.319] (-2008.769) (-2014.951) (-2004.139) -- 0:05:38
      161500 -- (-2001.933) (-2021.500) (-2003.867) [-2001.906] * (-2016.516) (-2004.213) (-2012.537) [-1998.295] -- 0:05:37
      162000 -- (-1996.399) [-2007.415] (-2001.895) (-2002.728) * [-1999.387] (-2001.985) (-2012.596) (-1999.534) -- 0:05:36
      162500 -- (-2001.196) [-2000.820] (-2016.741) (-2001.112) * [-2002.316] (-1999.330) (-2006.685) (-2001.897) -- 0:05:35
      163000 -- (-2006.878) (-2007.191) [-2000.292] (-2005.252) * [-1998.944] (-2007.250) (-2010.348) (-2006.357) -- 0:05:33
      163500 -- [-2006.423] (-2001.183) (-2014.170) (-2001.653) * (-2006.400) (-2009.072) (-2010.680) [-1999.677] -- 0:05:37
      164000 -- (-2008.824) (-2009.719) (-1999.325) [-1994.028] * (-2011.797) [-1998.633] (-2004.303) (-2005.917) -- 0:05:36
      164500 -- [-2002.343] (-2012.843) (-1999.694) (-2007.923) * (-2001.494) [-2007.708] (-2013.759) (-2000.362) -- 0:05:35
      165000 -- (-2011.980) [-2006.868] (-1999.736) (-2001.237) * (-2006.171) (-1993.501) (-2015.708) [-2000.554] -- 0:05:34

      Average standard deviation of split frequencies: 0.023219

      165500 -- (-2014.365) [-1999.508] (-2001.353) (-2010.681) * [-1997.170] (-2001.085) (-2012.818) (-1999.469) -- 0:05:32
      166000 -- (-2000.771) (-2002.069) (-1996.001) [-2008.421] * (-1997.230) [-1999.113] (-2024.343) (-2011.766) -- 0:05:36
      166500 -- [-1996.858] (-2006.131) (-2013.735) (-1998.223) * (-2003.964) [-2006.842] (-2013.992) (-2019.983) -- 0:05:35
      167000 -- (-2005.480) (-2009.440) (-2012.337) [-2001.469] * [-2001.564] (-2008.971) (-2009.898) (-2011.081) -- 0:05:34
      167500 -- (-2001.318) [-1999.922] (-1998.445) (-2008.532) * [-2007.419] (-2012.945) (-2009.540) (-2007.430) -- 0:05:33
      168000 -- (-1999.339) (-2005.922) (-2008.997) [-2012.510] * (-2008.848) (-2015.664) [-2006.211] (-1999.959) -- 0:05:31
      168500 -- (-2002.535) (-2004.785) [-2007.924] (-2009.426) * (-2003.713) (-2006.890) [-1999.012] (-1999.459) -- 0:05:35
      169000 -- (-2004.407) (-2014.064) [-2003.597] (-2001.374) * (-2009.076) [-1998.358] (-2000.801) (-2013.782) -- 0:05:34
      169500 -- (-2006.017) (-2000.370) (-2007.171) [-1998.209] * (-1995.804) (-2005.785) [-2000.878] (-2014.837) -- 0:05:33
      170000 -- (-2005.336) (-2002.392) (-1992.597) [-2001.065] * (-2006.434) (-2007.108) (-2009.046) [-2001.877] -- 0:05:32

      Average standard deviation of split frequencies: 0.025722

      170500 -- (-1997.947) (-2004.840) (-2010.400) [-2015.353] * (-2002.351) (-2005.762) [-2007.111] (-1998.899) -- 0:05:30
      171000 -- (-2003.853) [-1999.187] (-2007.642) (-2015.499) * [-1997.544] (-2008.031) (-2007.060) (-2010.700) -- 0:05:34
      171500 -- (-2012.303) (-2005.463) [-2001.533] (-2001.953) * (-2003.649) (-2003.848) [-2011.676] (-2007.645) -- 0:05:33
      172000 -- (-2005.455) (-2002.929) [-1994.481] (-2003.954) * (-2000.536) [-1999.164] (-2011.167) (-2006.369) -- 0:05:32
      172500 -- (-2004.990) [-2000.990] (-2012.306) (-2006.660) * (-1999.884) [-2000.677] (-2007.054) (-2006.553) -- 0:05:31
      173000 -- (-2003.920) [-2008.206] (-2005.371) (-2004.705) * [-2008.590] (-2010.176) (-2001.603) (-2012.324) -- 0:05:29
      173500 -- [-2011.521] (-2014.972) (-2023.022) (-2008.450) * (-2003.735) (-2003.259) [-1998.169] (-2010.365) -- 0:05:33
      174000 -- (-1999.966) (-2003.981) (-2009.453) [-2005.191] * (-2004.573) [-2007.214] (-2007.327) (-2015.578) -- 0:05:32
      174500 -- (-2003.057) (-2000.956) (-2011.459) [-1999.844] * [-2000.294] (-2008.617) (-2001.626) (-2012.930) -- 0:05:31
      175000 -- (-2001.958) [-2000.590] (-2013.691) (-2020.371) * (-2010.888) [-2005.055] (-2017.715) (-2012.337) -- 0:05:30

      Average standard deviation of split frequencies: 0.022097

      175500 -- (-2020.174) (-1996.023) (-2008.884) [-2002.053] * (-2004.864) (-2010.581) [-2012.271] (-2027.696) -- 0:05:28
      176000 -- (-2004.060) (-2002.572) [-2001.431] (-1999.869) * (-2004.326) (-2023.058) [-2008.301] (-2007.807) -- 0:05:32
      176500 -- [-2012.494] (-2012.806) (-2006.744) (-2019.067) * (-1999.457) (-2009.115) [-2002.474] (-2006.053) -- 0:05:31
      177000 -- [-2001.018] (-2011.579) (-2008.115) (-2011.306) * (-2003.414) (-2006.695) (-2003.474) [-2012.011] -- 0:05:30
      177500 -- (-2002.355) [-2003.236] (-2001.922) (-2009.064) * (-2003.610) (-2017.282) (-1996.790) [-1994.329] -- 0:05:29
      178000 -- [-1999.804] (-2003.882) (-2009.274) (-1997.024) * (-2013.947) (-2019.091) (-2010.334) [-1992.954] -- 0:05:27
      178500 -- (-2009.518) (-2003.147) [-2016.786] (-2000.696) * [-2003.544] (-2016.761) (-2008.675) (-1998.404) -- 0:05:31
      179000 -- (-2003.498) (-2011.354) (-2003.523) [-1995.952] * (-2001.827) [-2003.657] (-2007.460) (-2004.965) -- 0:05:30
      179500 -- (-2006.831) (-2017.696) (-2010.891) [-2000.126] * [-2002.100] (-2005.578) (-1993.891) (-2003.213) -- 0:05:29
      180000 -- (-2003.866) (-2013.987) [-2006.953] (-2008.217) * (-2010.242) (-2007.790) (-2004.415) [-1999.168] -- 0:05:28

      Average standard deviation of split frequencies: 0.021037

      180500 -- [-1998.500] (-2016.890) (-2003.575) (-2004.878) * (-2014.326) (-2005.000) (-2000.991) [-2000.552] -- 0:05:26
      181000 -- (-2003.636) (-2009.439) [-2000.274] (-2005.355) * (-2000.716) (-2013.789) [-2007.295] (-1999.196) -- 0:05:30
      181500 -- (-2003.970) (-2008.575) (-2000.399) [-2022.637] * [-1998.032] (-2010.873) (-2018.569) (-2008.240) -- 0:05:29
      182000 -- (-2006.102) (-2022.007) (-2006.713) [-2006.048] * (-1999.166) (-2010.194) [-2004.568] (-2016.953) -- 0:05:28
      182500 -- (-2002.716) (-2007.460) (-2014.057) [-2003.795] * (-2007.371) [-2000.350] (-2018.573) (-2003.456) -- 0:05:27
      183000 -- (-1999.406) (-2010.627) [-2008.026] (-2011.425) * (-2007.689) (-1997.548) (-2004.008) [-2008.885] -- 0:05:25
      183500 -- (-2006.036) (-2007.406) [-2002.438] (-2000.605) * (-1999.751) (-2001.649) (-2013.712) [-2004.847] -- 0:05:29
      184000 -- [-2006.549] (-2012.001) (-2007.992) (-1998.912) * (-2001.117) [-2005.900] (-2000.338) (-2017.539) -- 0:05:28
      184500 -- (-2012.250) (-2004.251) [-1998.800] (-2008.848) * (-2006.464) (-2005.693) (-2005.401) [-1999.557] -- 0:05:27
      185000 -- (-2003.158) (-2001.943) (-2006.936) [-1998.504] * (-2005.313) [-2001.760] (-2008.210) (-2004.881) -- 0:05:26

      Average standard deviation of split frequencies: 0.019381

      185500 -- (-2010.306) (-2003.166) [-2000.551] (-2021.704) * [-2001.626] (-2009.602) (-1995.911) (-1996.406) -- 0:05:24
      186000 -- [-2000.272] (-2000.564) (-1999.160) (-2018.314) * (-1997.114) (-2003.658) (-2001.856) [-1999.465] -- 0:05:28
      186500 -- (-2000.692) (-2002.902) [-2002.272] (-2019.552) * (-1996.901) [-1993.822] (-2006.994) (-1998.999) -- 0:05:27
      187000 -- (-2012.696) [-2004.577] (-2001.923) (-2006.539) * (-1998.281) (-2004.530) (-2003.218) [-1997.839] -- 0:05:26
      187500 -- (-2000.727) (-2009.475) (-2010.015) [-2002.384] * [-2004.559] (-1998.585) (-2010.554) (-2000.025) -- 0:05:25
      188000 -- (-2001.504) [-2003.552] (-2012.479) (-2012.495) * (-2013.477) (-2002.622) [-2012.833] (-2005.732) -- 0:05:23
      188500 -- [-2000.173] (-2000.223) (-2006.471) (-1998.740) * (-2003.462) (-1997.138) (-2015.183) [-1999.616] -- 0:05:27
      189000 -- (-2008.098) (-2004.333) [-1998.914] (-2000.929) * (-2010.266) (-2005.906) (-2010.086) [-1998.590] -- 0:05:26
      189500 -- (-2007.823) (-2011.623) [-2002.892] (-2002.753) * (-1998.117) (-2001.440) (-2015.547) [-2006.710] -- 0:05:25
      190000 -- (-2009.078) (-2012.901) [-2001.642] (-2010.817) * (-2005.351) (-2012.569) [-2004.723] (-2007.995) -- 0:05:24

      Average standard deviation of split frequencies: 0.021379

      190500 -- (-2014.551) (-2013.577) [-2007.117] (-2015.300) * (-2005.758) [-2002.016] (-2004.280) (-2004.227) -- 0:05:22
      191000 -- (-2007.237) [-2001.319] (-1999.290) (-2015.727) * (-2003.377) (-2005.603) (-2002.785) [-2004.567] -- 0:05:26
      191500 -- (-2003.803) (-2006.338) [-1998.880] (-2003.522) * [-2000.402] (-2006.521) (-2008.151) (-2003.611) -- 0:05:25
      192000 -- (-2007.994) (-2019.743) [-2001.945] (-2003.449) * (-1997.746) [-2012.946] (-2009.318) (-2008.321) -- 0:05:24
      192500 -- (-2007.146) (-1997.187) [-2002.890] (-2008.114) * [-2002.667] (-2011.180) (-2022.941) (-2007.684) -- 0:05:23
      193000 -- (-2009.473) [-2000.957] (-2001.528) (-2017.444) * (-2009.768) (-2010.922) [-2002.990] (-2017.737) -- 0:05:21
      193500 -- [-2013.327] (-2006.520) (-2002.792) (-2014.545) * (-2013.291) (-2015.316) [-2000.451] (-2010.976) -- 0:05:20
      194000 -- (-2012.284) [-1995.031] (-2013.234) (-1999.055) * [-2009.888] (-2009.377) (-2012.365) (-2015.356) -- 0:05:24
      194500 -- [-2007.480] (-2014.487) (-2013.024) (-2005.906) * [-2017.038] (-2013.108) (-2008.173) (-2012.556) -- 0:05:23
      195000 -- (-2009.531) (-2005.307) [-2009.574] (-2005.890) * (-2002.975) (-2015.584) [-2003.216] (-2001.603) -- 0:05:22

      Average standard deviation of split frequencies: 0.021646

      195500 -- (-2008.117) (-2016.029) (-2002.811) [-2010.918] * (-2006.868) [-2008.726] (-1997.616) (-2002.998) -- 0:05:20
      196000 -- (-2006.371) [-1995.210] (-2001.208) (-2003.952) * (-1998.125) [-2001.619] (-2002.976) (-2010.001) -- 0:05:19
      196500 -- (-2002.112) (-2002.657) (-2005.392) [-2004.932] * [-2008.362] (-2003.719) (-2003.966) (-2010.402) -- 0:05:23
      197000 -- [-2007.162] (-2000.504) (-1999.449) (-2011.031) * (-2007.779) [-2002.607] (-2005.970) (-2004.473) -- 0:05:22
      197500 -- (-2012.081) [-2006.602] (-2004.048) (-2007.021) * (-2001.762) (-2014.631) (-2004.038) [-1994.750] -- 0:05:21
      198000 -- [-1999.252] (-2002.520) (-2010.024) (-2003.860) * (-2001.778) (-2010.928) [-1992.763] (-2004.084) -- 0:05:19
      198500 -- (-1998.759) [-2010.254] (-2002.144) (-2007.432) * (-2001.246) (-2006.496) [-2007.644] (-1999.244) -- 0:05:18
      199000 -- (-2004.085) (-2016.003) [-2004.542] (-2012.181) * (-2011.893) [-2002.542] (-2003.020) (-2008.133) -- 0:05:22
      199500 -- (-1997.331) (-2009.310) [-2009.530] (-2006.769) * (-2003.714) (-2015.327) [-1999.076] (-2005.623) -- 0:05:21
      200000 -- (-2001.344) (-2018.922) (-2007.772) [-2001.121] * (-2013.527) (-2010.489) (-2000.538) [-1996.614] -- 0:05:20

      Average standard deviation of split frequencies: 0.021972

      200500 -- (-1995.165) [-2000.915] (-2007.542) (-2005.136) * (-2007.595) (-2017.035) (-2002.217) [-2006.583] -- 0:05:19
      201000 -- (-2005.869) (-1998.049) (-1995.516) [-1997.764] * (-2007.206) [-2007.807] (-2010.267) (-2008.901) -- 0:05:18
      201500 -- (-2003.522) (-2016.177) [-2003.574] (-2006.912) * (-1999.075) [-2012.506] (-2004.331) (-2014.055) -- 0:05:20
      202000 -- (-2010.448) [-2002.692] (-2008.995) (-2007.195) * (-2003.395) [-2000.821] (-2006.066) (-2017.806) -- 0:05:19
      202500 -- (-2005.875) (-2010.502) [-2009.958] (-2000.226) * [-2000.450] (-2007.726) (-2000.498) (-2004.218) -- 0:05:19
      203000 -- (-2001.362) [-2005.067] (-2015.749) (-2002.368) * (-2012.002) (-2009.230) (-2004.917) [-2007.439] -- 0:05:18
      203500 -- (-2008.471) [-2004.508] (-2005.536) (-2004.026) * (-2012.404) [-2003.269] (-2004.021) (-2013.245) -- 0:05:17
      204000 -- [-1998.028] (-2005.074) (-2011.973) (-2000.676) * (-2010.368) [-1997.446] (-2001.918) (-2006.629) -- 0:05:19
      204500 -- (-2000.057) (-2014.051) [-2001.040] (-2006.622) * [-2000.430] (-2004.190) (-2005.867) (-2009.908) -- 0:05:18
      205000 -- (-1999.825) [-1998.826] (-2002.067) (-2004.115) * (-2004.905) (-2005.343) (-2002.541) [-2011.917] -- 0:05:18

      Average standard deviation of split frequencies: 0.023557

      205500 -- (-2003.455) (-2008.537) (-2003.616) [-2001.862] * [-2006.853] (-2004.349) (-2006.443) (-2018.675) -- 0:05:17
      206000 -- (-2002.786) [-1996.572] (-1998.552) (-2006.825) * (-1998.056) (-2010.068) (-2003.642) [-2003.167] -- 0:05:16
      206500 -- [-2007.399] (-2004.801) (-2022.307) (-2009.839) * (-1999.303) [-1995.489] (-2015.037) (-1997.468) -- 0:05:18
      207000 -- [-1999.173] (-2003.422) (-2005.523) (-2011.307) * [-1999.617] (-1997.999) (-2003.103) (-2009.144) -- 0:05:17
      207500 -- (-2006.808) (-2010.804) [-2014.347] (-2001.753) * [-1999.644] (-2008.104) (-2024.231) (-1999.924) -- 0:05:17
      208000 -- (-2005.703) (-2002.034) [-2004.227] (-2009.901) * (-2011.657) [-2007.700] (-2016.643) (-2004.133) -- 0:05:16
      208500 -- (-2003.495) (-2012.343) (-1998.010) [-1999.436] * (-2011.479) (-2008.792) [-2001.978] (-2006.270) -- 0:05:15
      209000 -- (-2002.892) (-2006.954) [-2001.320] (-2007.933) * (-2007.522) [-2007.254] (-2002.608) (-2010.909) -- 0:05:17
      209500 -- (-2000.095) (-2003.596) (-1997.559) [-2000.530] * [-2003.569] (-2019.765) (-1999.733) (-2014.749) -- 0:05:16
      210000 -- (-2003.665) [-2000.215] (-2014.634) (-2011.512) * (-2005.510) (-2011.350) (-2013.905) [-2006.011] -- 0:05:16

      Average standard deviation of split frequencies: 0.023167

      210500 -- [-2001.086] (-2014.649) (-2004.365) (-2006.697) * (-2005.286) [-2012.368] (-2003.586) (-2011.130) -- 0:05:15
      211000 -- (-2002.251) (-2003.630) [-1997.067] (-2010.090) * (-2008.970) (-2008.507) [-1997.203] (-2007.845) -- 0:05:14
      211500 -- (-2000.556) [-2000.380] (-2004.650) (-2002.193) * (-1997.277) (-2026.697) (-2005.287) [-2005.300] -- 0:05:16
      212000 -- [-2008.097] (-2008.922) (-2005.067) (-2004.471) * (-2001.121) [-2011.937] (-2002.590) (-2011.534) -- 0:05:15
      212500 -- (-1999.911) (-2001.991) (-2010.871) [-2000.789] * (-2004.756) (-2010.109) [-1995.855] (-2015.847) -- 0:05:15
      213000 -- (-2004.670) [-2000.787] (-2006.313) (-2014.524) * (-2011.867) (-2004.635) [-2004.283] (-2010.129) -- 0:05:14
      213500 -- (-2007.959) (-2002.806) [-2000.123] (-2001.907) * (-2008.336) [-2002.935] (-1996.289) (-2001.017) -- 0:05:13
      214000 -- (-2012.356) (-2018.088) [-2003.610] (-1997.461) * (-2016.747) (-2000.641) [-2002.548] (-2021.010) -- 0:05:15
      214500 -- (-2024.835) (-2010.044) [-2006.579] (-2005.766) * [-2000.610] (-1999.914) (-2008.118) (-2023.960) -- 0:05:14
      215000 -- [-2007.737] (-2007.488) (-2010.196) (-2018.658) * (-2005.826) (-2003.969) [-1998.664] (-2005.922) -- 0:05:14

      Average standard deviation of split frequencies: 0.023188

      215500 -- (-2003.519) [-2000.462] (-2010.010) (-2014.165) * (-2004.103) [-2001.122] (-2002.814) (-2008.205) -- 0:05:13
      216000 -- (-2008.194) [-2006.367] (-2011.461) (-2009.716) * [-1999.120] (-2009.330) (-2002.605) (-2011.191) -- 0:05:12
      216500 -- [-2000.364] (-2007.080) (-2006.634) (-2007.679) * [-2004.248] (-2005.444) (-1995.720) (-2001.093) -- 0:05:14
      217000 -- (-2002.004) [-2004.925] (-2014.227) (-2007.519) * (-2006.976) (-1999.301) [-2006.225] (-2003.230) -- 0:05:13
      217500 -- (-2001.910) (-2011.169) (-2003.354) [-2001.443] * [-2003.384] (-2018.606) (-2004.052) (-1996.831) -- 0:05:13
      218000 -- (-2012.279) (-2005.880) (-2006.228) [-2006.500] * [-1996.730] (-2007.088) (-1997.428) (-2000.556) -- 0:05:12
      218500 -- (-2009.390) (-2013.750) [-2003.567] (-2007.414) * (-2010.034) (-2005.771) (-2009.472) [-2004.367] -- 0:05:11
      219000 -- (-2003.387) (-2003.557) (-2011.246) [-1999.879] * (-1996.816) (-2009.880) [-2001.660] (-2014.591) -- 0:05:10
      219500 -- (-1993.722) [-2005.500] (-2006.528) (-2006.610) * [-2007.596] (-2001.349) (-2010.446) (-2006.870) -- 0:05:12
      220000 -- [-1999.005] (-2005.499) (-2014.258) (-2002.259) * (-2011.051) (-1999.544) (-1999.768) [-1998.529] -- 0:05:12

      Average standard deviation of split frequencies: 0.022965

      220500 -- (-2007.552) (-2015.209) [-2005.806] (-2000.312) * [-2000.849] (-1997.446) (-2004.717) (-1995.580) -- 0:05:11
      221000 -- (-2008.751) (-2015.784) (-2000.226) [-1995.383] * (-2010.812) [-1998.044] (-2013.202) (-2004.343) -- 0:05:10
      221500 -- [-1997.002] (-2000.662) (-2001.655) (-2009.334) * (-2004.396) (-2008.254) [-2000.867] (-2007.111) -- 0:05:09
      222000 -- (-1989.625) [-2003.208] (-2008.305) (-2000.627) * (-1998.739) (-2002.046) (-2001.394) [-2005.756] -- 0:05:11
      222500 -- (-2002.420) (-2015.179) (-1998.334) [-2012.458] * (-2006.475) (-2006.537) [-1997.180] (-2008.993) -- 0:05:11
      223000 -- (-2014.146) [-2000.736] (-1995.462) (-2016.482) * (-2002.296) (-2004.393) [-1997.137] (-2009.468) -- 0:05:10
      223500 -- (-2006.010) (-2002.721) (-2003.795) [-2010.864] * (-2004.664) [-2007.064] (-2005.809) (-2001.871) -- 0:05:09
      224000 -- (-1997.060) [-2005.704] (-2012.383) (-2008.394) * (-2010.186) [-1999.607] (-2005.943) (-2006.105) -- 0:05:08
      224500 -- (-1999.905) (-2010.694) [-2001.361] (-2010.836) * (-2005.249) (-2005.454) [-2001.138] (-2003.878) -- 0:05:10
      225000 -- (-2010.926) (-2010.604) (-2005.180) [-2003.980] * (-2001.825) (-2001.863) [-2005.154] (-2013.687) -- 0:05:10

      Average standard deviation of split frequencies: 0.022208

      225500 -- (-2008.637) (-2007.934) [-1999.027] (-2010.614) * (-2012.782) (-2002.817) [-2001.574] (-2006.669) -- 0:05:09
      226000 -- [-2002.343] (-2004.410) (-2005.943) (-2001.172) * (-2011.147) (-2010.840) (-1995.064) [-2006.029] -- 0:05:08
      226500 -- [-2003.665] (-2000.072) (-2003.553) (-1998.989) * (-2012.969) [-2003.194] (-2009.103) (-2013.130) -- 0:05:07
      227000 -- (-2009.457) [-2002.541] (-1996.794) (-2011.661) * (-2008.875) [-1995.775] (-2008.183) (-2010.096) -- 0:05:09
      227500 -- (-2004.007) [-1994.700] (-2005.314) (-2008.262) * (-2002.957) (-2012.130) [-1996.533] (-2005.755) -- 0:05:09
      228000 -- (-2007.085) [-2009.249] (-2014.337) (-2002.568) * (-2014.996) [-2007.290] (-2009.382) (-1998.084) -- 0:05:08
      228500 -- [-2003.220] (-2013.883) (-2003.920) (-2007.314) * (-2004.612) [-2004.934] (-2009.013) (-2005.654) -- 0:05:07
      229000 -- (-2005.072) (-2003.842) [-2007.857] (-2004.701) * (-2013.751) (-2010.024) [-2011.378] (-2002.603) -- 0:05:06
      229500 -- [-2013.308] (-2013.844) (-2003.996) (-2011.148) * [-2005.357] (-2010.383) (-2000.260) (-2008.367) -- 0:05:08
      230000 -- (-2002.996) (-2019.313) [-2002.124] (-2001.750) * [-2006.995] (-2007.654) (-2002.771) (-2009.190) -- 0:05:08

      Average standard deviation of split frequencies: 0.023119

      230500 -- (-2005.921) (-2014.662) [-2000.975] (-2006.520) * (-2018.058) (-2013.727) (-2005.845) [-2009.380] -- 0:05:07
      231000 -- [-2008.033] (-2011.003) (-2003.768) (-2010.264) * (-2013.709) (-2012.993) (-2011.240) [-2006.781] -- 0:05:06
      231500 -- (-2016.749) (-2004.727) (-2003.658) [-2007.705] * (-1999.652) (-2004.117) [-1996.196] (-2003.081) -- 0:05:05
      232000 -- (-1997.501) (-2006.571) (-2010.285) [-2008.125] * (-2004.389) (-2001.827) (-1996.323) [-2008.547] -- 0:05:07
      232500 -- (-2011.931) (-2010.683) (-2003.045) [-2006.822] * (-1995.730) (-2018.733) (-2005.984) [-1995.736] -- 0:05:07
      233000 -- (-2006.379) (-2000.446) [-2001.377] (-2009.554) * [-2005.554] (-2011.233) (-2014.076) (-2002.016) -- 0:05:06
      233500 -- (-2003.325) (-2003.634) (-2011.592) [-1997.882] * (-2006.002) [-2006.156] (-2000.082) (-2005.604) -- 0:05:05
      234000 -- (-2000.895) [-2011.970] (-2001.155) (-1995.722) * [-2003.728] (-2017.458) (-2005.653) (-1998.561) -- 0:05:04
      234500 -- (-2000.023) [-1994.342] (-2005.617) (-2009.624) * (-2011.456) (-2011.997) (-1997.144) [-2000.115] -- 0:05:06
      235000 -- (-2009.264) [-1997.372] (-2009.288) (-2003.277) * (-2009.570) (-2006.849) (-2005.660) [-1995.833] -- 0:05:06

      Average standard deviation of split frequencies: 0.022090

      235500 -- [-1999.275] (-2003.477) (-1998.848) (-2006.084) * (-2006.393) [-1998.486] (-2010.955) (-1996.034) -- 0:05:05
      236000 -- (-2001.147) (-2008.848) [-1994.044] (-2018.358) * [-2004.822] (-2020.427) (-2000.952) (-2001.476) -- 0:05:04
      236500 -- (-2001.891) (-2003.702) (-2007.718) [-1997.407] * (-2012.057) (-2006.680) (-2006.291) [-2002.911] -- 0:05:03
      237000 -- (-2010.037) (-2006.076) [-2006.968] (-1995.219) * (-2014.467) [-1997.599] (-1999.621) (-2006.266) -- 0:05:02
      237500 -- (-2025.851) (-2003.218) [-2003.064] (-2000.716) * (-2003.809) (-2004.315) [-2010.604] (-2010.051) -- 0:05:05
      238000 -- (-2005.334) [-1995.643] (-2004.905) (-1998.029) * (-2000.623) (-2010.343) (-2004.791) [-1996.678] -- 0:05:04
      238500 -- (-2010.520) (-2009.897) [-2004.445] (-2012.934) * (-2000.688) (-2010.697) (-2006.092) [-1999.443] -- 0:05:03
      239000 -- (-2011.146) [-1996.585] (-2003.546) (-1998.634) * (-2004.210) (-2000.542) [-1998.973] (-2008.310) -- 0:05:02
      239500 -- (-2005.938) (-2012.702) [-2002.900] (-2005.828) * [-2005.004] (-2006.566) (-2011.000) (-2003.735) -- 0:05:01
      240000 -- [-2009.452] (-2013.964) (-2010.870) (-2003.329) * (-2006.927) [-2004.606] (-2000.352) (-1999.372) -- 0:05:04

      Average standard deviation of split frequencies: 0.023627

      240500 -- (-2004.372) [-1996.462] (-2003.308) (-2004.939) * [-2005.155] (-2005.037) (-2014.441) (-2006.915) -- 0:05:03
      241000 -- (-2007.235) (-1998.354) (-2005.027) [-2007.704] * [-1999.508] (-1996.573) (-2006.435) (-2007.894) -- 0:05:02
      241500 -- [-1999.448] (-2020.525) (-2001.070) (-2006.068) * (-2001.226) [-1999.918] (-2004.562) (-2008.051) -- 0:05:01
      242000 -- [-1991.593] (-1998.158) (-1998.509) (-2004.856) * [-2003.388] (-2008.769) (-2006.906) (-2004.384) -- 0:05:00
      242500 -- [-2005.716] (-1997.275) (-1999.347) (-2001.680) * [-1999.195] (-2002.743) (-1999.746) (-1998.421) -- 0:05:03
      243000 -- (-2005.551) (-1997.991) (-2008.738) [-1999.241] * (-2003.514) (-2003.958) [-1997.725] (-2002.193) -- 0:05:02
      243500 -- (-2003.458) (-2011.022) [-1999.079] (-2005.306) * (-2010.233) (-2001.241) [-2000.422] (-2006.975) -- 0:05:01
      244000 -- (-2012.656) (-2012.761) [-2002.677] (-2005.657) * (-2006.214) [-2001.913] (-2009.290) (-2010.977) -- 0:05:00
      244500 -- (-2003.216) (-2004.468) [-2000.634] (-2004.659) * (-1999.581) [-1998.752] (-2011.921) (-1996.792) -- 0:04:59
      245000 -- (-1998.349) (-1996.473) [-1999.791] (-2007.531) * (-2009.573) (-2012.045) (-2017.814) [-1998.029] -- 0:05:02

      Average standard deviation of split frequencies: 0.021319

      245500 -- [-2001.644] (-2005.920) (-2000.983) (-2013.001) * (-2012.592) (-1995.019) (-2027.559) [-2005.110] -- 0:05:01
      246000 -- (-2005.445) (-2003.996) [-1993.536] (-2002.003) * (-2001.670) [-2002.295] (-2007.888) (-1998.107) -- 0:05:00
      246500 -- (-2004.510) [-1995.621] (-1995.566) (-1994.792) * (-2007.364) [-2001.250] (-2010.162) (-2014.318) -- 0:04:59
      247000 -- [-2009.160] (-2011.956) (-2001.188) (-1996.595) * (-2007.741) (-2016.060) [-1999.582] (-2008.379) -- 0:04:58
      247500 -- (-1996.505) (-2001.056) (-2007.573) [-1997.873] * (-2013.531) (-2008.831) [-2002.620] (-2013.397) -- 0:05:01
      248000 -- [-2000.340] (-2006.821) (-1999.724) (-2005.258) * [-2001.344] (-2006.059) (-1997.039) (-2012.126) -- 0:05:00
      248500 -- (-2006.733) (-2003.059) [-2000.013] (-2002.163) * (-2002.149) [-2000.690] (-2005.594) (-2009.588) -- 0:04:59
      249000 -- (-2003.939) [-2000.476] (-2012.200) (-2001.874) * (-2014.581) (-2001.474) [-2005.742] (-2001.515) -- 0:04:58
      249500 -- (-2014.875) [-2000.627] (-2009.733) (-2000.006) * (-2005.069) [-2003.871] (-2000.895) (-2002.843) -- 0:04:57
      250000 -- (-2001.567) (-2005.041) (-2018.151) [-1999.820] * [-2003.866] (-2001.206) (-2021.002) (-2003.736) -- 0:05:00

      Average standard deviation of split frequencies: 0.021744

      250500 -- (-2002.818) (-2009.357) (-2014.285) [-2002.603] * (-2000.493) (-2010.857) [-2012.216] (-2000.953) -- 0:04:59
      251000 -- (-2002.543) (-2013.386) [-2006.876] (-2003.486) * (-2008.052) (-2010.475) [-2003.265] (-2006.884) -- 0:04:58
      251500 -- (-2010.272) (-2016.687) [-2000.478] (-2001.831) * (-2012.931) [-1997.999] (-2009.699) (-2005.349) -- 0:04:57
      252000 -- (-2006.628) (-2013.104) (-2004.140) [-2000.009] * (-2001.025) [-2002.997] (-2005.786) (-2001.362) -- 0:04:56
      252500 -- [-2007.320] (-2012.102) (-2006.414) (-2010.920) * (-2005.069) (-1997.673) (-2013.580) [-1999.042] -- 0:04:59
      253000 -- (-1999.348) (-2028.203) (-2005.861) [-2005.817] * (-1999.843) [-1999.680] (-2010.987) (-2005.293) -- 0:04:58
      253500 -- (-2010.864) (-2015.792) (-1995.241) [-2000.029] * [-2003.434] (-2001.450) (-2004.091) (-2006.425) -- 0:04:57
      254000 -- (-2006.280) (-2004.425) [-1999.982] (-1999.774) * (-2007.318) (-2006.061) [-2001.005] (-2016.331) -- 0:04:56
      254500 -- (-1998.896) [-2008.868] (-2007.051) (-2003.380) * [-1998.591] (-2018.020) (-2011.188) (-2010.832) -- 0:04:55
      255000 -- [-2010.011] (-2007.002) (-2009.721) (-2005.474) * (-1994.781) (-2014.255) [-2007.251] (-2002.432) -- 0:04:58

      Average standard deviation of split frequencies: 0.019450

      255500 -- [-1997.871] (-2012.685) (-2011.322) (-2013.566) * (-2004.138) [-2003.324] (-2002.690) (-2004.981) -- 0:04:57
      256000 -- [-2005.950] (-2005.564) (-2009.964) (-2015.998) * (-2001.631) [-2005.928] (-2003.098) (-2000.995) -- 0:04:56
      256500 -- [-2004.705] (-2003.990) (-2009.936) (-2014.040) * [-2010.223] (-2013.329) (-2009.962) (-2017.621) -- 0:04:55
      257000 -- [-2009.117] (-2014.835) (-2011.908) (-2013.929) * (-2013.148) (-2010.721) (-2013.555) [-1999.194] -- 0:04:54
      257500 -- (-2025.781) [-1998.955] (-1996.801) (-2004.617) * (-2005.541) [-2000.740] (-2005.000) (-2003.411) -- 0:04:57
      258000 -- [-1998.017] (-2005.449) (-2002.426) (-2006.355) * (-1997.380) (-2006.075) (-2002.021) [-2005.352] -- 0:04:56
      258500 -- (-1998.459) [-1993.224] (-2011.996) (-2004.621) * [-1999.981] (-2008.000) (-1996.796) (-1999.532) -- 0:04:55
      259000 -- (-2005.825) (-2011.874) (-2013.246) [-2004.909] * (-2004.800) (-2007.158) [-2003.641] (-2005.686) -- 0:04:54
      259500 -- (-2003.918) [-2012.615] (-2012.437) (-2004.083) * (-2010.880) (-2006.555) (-2009.280) [-2002.952] -- 0:04:53
      260000 -- (-2010.213) (-2004.879) (-2017.527) [-2002.480] * (-2004.627) (-2003.607) [-2010.605] (-2004.701) -- 0:04:56

      Average standard deviation of split frequencies: 0.019893

      260500 -- (-2007.464) [-2012.275] (-2018.085) (-1999.552) * (-2012.169) (-2010.572) [-2003.467] (-2007.101) -- 0:04:55
      261000 -- (-1996.812) (-2008.012) (-2007.898) [-2005.541] * [-2006.027] (-2010.331) (-2000.190) (-2001.124) -- 0:04:54
      261500 -- (-2004.667) (-2007.906) (-1998.777) [-2003.280] * (-2005.008) [-1999.904] (-2006.212) (-2005.392) -- 0:04:53
      262000 -- [-1999.777] (-2011.038) (-2001.901) (-2002.828) * (-2007.544) (-2001.665) [-2005.731] (-2004.053) -- 0:04:52
      262500 -- [-1996.776] (-2007.121) (-2004.424) (-2008.886) * (-2005.326) (-2011.484) (-2019.732) [-1997.833] -- 0:04:55
      263000 -- (-2000.735) (-2007.779) [-2005.295] (-2022.089) * (-2010.732) (-2028.351) (-2000.193) [-2004.166] -- 0:04:54
      263500 -- (-2004.690) (-2006.147) [-1999.139] (-2017.425) * (-2001.214) [-2004.110] (-2006.173) (-2004.454) -- 0:04:53
      264000 -- [-2006.102] (-2013.635) (-2006.716) (-2018.806) * (-2006.070) (-2003.949) [-1997.447] (-2005.143) -- 0:04:52
      264500 -- (-1996.917) (-2014.523) [-2003.992] (-2018.196) * [-2006.042] (-2010.535) (-2005.221) (-2001.241) -- 0:04:51
      265000 -- [-1995.719] (-2015.845) (-2004.077) (-2012.126) * (-2003.629) [-2010.136] (-2005.901) (-2006.183) -- 0:04:54

      Average standard deviation of split frequencies: 0.020602

      265500 -- (-2008.936) (-2020.580) (-2009.590) [-2002.357] * (-2003.196) (-2021.168) [-2004.403] (-1999.760) -- 0:04:53
      266000 -- (-2005.153) (-2004.744) (-2005.897) [-2001.044] * (-2006.831) [-2005.179] (-2005.605) (-2003.483) -- 0:04:52
      266500 -- (-2017.982) [-2013.432] (-2003.431) (-1999.393) * (-2005.361) [-1999.097] (-2014.306) (-2005.328) -- 0:04:51
      267000 -- (-2023.636) (-2004.527) [-2002.913] (-1998.958) * (-2008.049) [-2000.108] (-2012.043) (-2005.241) -- 0:04:51
      267500 -- [-2002.231] (-1998.631) (-2003.946) (-2008.565) * [-2000.972] (-2011.593) (-2010.014) (-2010.933) -- 0:04:53
      268000 -- (-2021.439) (-1998.537) [-1996.307] (-1999.494) * [-2005.976] (-2005.562) (-1995.378) (-2017.081) -- 0:04:52
      268500 -- (-2019.442) [-1996.827] (-2002.490) (-2001.626) * (-2004.128) [-2004.512] (-1998.794) (-2027.530) -- 0:04:51
      269000 -- [-2010.631] (-2008.382) (-2010.329) (-1999.526) * (-2005.109) (-2000.597) [-2000.933] (-2002.265) -- 0:04:50
      269500 -- (-2009.926) (-2004.807) (-2002.893) [-2006.431] * (-2004.695) (-2002.937) (-2004.082) [-1995.012] -- 0:04:50
      270000 -- (-2008.002) [-1991.467] (-1997.695) (-2010.587) * (-2021.616) (-2006.239) (-2003.908) [-1998.591] -- 0:04:52

      Average standard deviation of split frequencies: 0.019261

      270500 -- [-2004.735] (-1999.562) (-2003.166) (-2002.170) * (-2003.913) [-1995.502] (-2011.596) (-2005.180) -- 0:04:51
      271000 -- (-2011.960) (-2002.097) (-2004.988) [-1999.284] * (-2008.230) (-2010.266) (-2006.340) [-1998.370] -- 0:04:50
      271500 -- (-2004.376) [-2009.233] (-2002.221) (-2009.457) * (-2015.765) (-2006.679) [-2005.674] (-2005.821) -- 0:04:49
      272000 -- (-2010.596) (-2007.293) [-1999.505] (-2003.499) * (-2010.967) [-1995.956] (-1997.544) (-2006.358) -- 0:04:49
      272500 -- (-2006.014) (-2005.071) (-2010.319) [-1992.037] * (-2001.612) (-2004.905) (-2000.752) [-2001.883] -- 0:04:51
      273000 -- (-2001.534) (-2013.624) (-2009.994) [-2001.432] * (-2006.488) (-2007.058) (-2020.237) [-1999.037] -- 0:04:50
      273500 -- (-2009.167) (-2008.137) [-2008.345] (-2021.930) * (-2003.335) (-2011.002) [-2004.930] (-2010.212) -- 0:04:49
      274000 -- (-2009.002) (-2021.861) [-2002.566] (-2007.863) * [-1997.430] (-1999.081) (-2004.075) (-2002.704) -- 0:04:48
      274500 -- [-2000.579] (-2000.142) (-2005.192) (-2001.409) * (-2004.148) [-2001.354] (-2007.886) (-1996.211) -- 0:04:48
      275000 -- (-2009.781) [-1995.732] (-2013.320) (-1998.978) * (-2005.157) (-2012.378) [-2003.777] (-2007.740) -- 0:04:50

      Average standard deviation of split frequencies: 0.018788

      275500 -- (-2009.762) (-1999.052) [-1995.473] (-2004.464) * (-2000.132) [-2022.273] (-2004.797) (-2004.307) -- 0:04:49
      276000 -- [-2004.995] (-2008.191) (-1998.463) (-2000.051) * (-2014.325) (-2020.420) [-2001.113] (-2004.550) -- 0:04:48
      276500 -- [-2004.602] (-2008.164) (-2006.186) (-2013.831) * (-2006.096) (-2007.737) [-2009.783] (-2004.054) -- 0:04:47
      277000 -- (-2007.074) (-2007.206) (-2002.646) [-2005.160] * (-2005.394) (-2018.960) (-2014.502) [-2003.902] -- 0:04:47
      277500 -- (-2013.382) (-2010.141) (-2012.017) [-1996.109] * (-2010.854) [-2008.254] (-2013.543) (-2015.272) -- 0:04:46
      278000 -- (-2008.369) [-1997.105] (-2003.813) (-1996.016) * (-2008.024) (-2003.435) (-2015.429) [-2005.970] -- 0:04:48
      278500 -- [-1999.270] (-2003.261) (-2003.778) (-2007.394) * (-2020.278) (-2015.770) (-2008.815) [-1998.225] -- 0:04:47
      279000 -- (-1997.790) (-2002.546) (-2001.233) [-2008.136] * [-2001.325] (-2002.537) (-1997.744) (-2004.370) -- 0:04:46
      279500 -- (-2010.749) (-1998.897) [-2003.713] (-2009.228) * (-2000.214) [-2001.675] (-2002.195) (-2000.409) -- 0:04:46
      280000 -- (-2025.437) (-1999.566) [-1991.984] (-2008.246) * (-2006.901) [-1999.587] (-2011.224) (-2010.351) -- 0:04:45

      Average standard deviation of split frequencies: 0.019562

      280500 -- (-2022.233) (-2003.050) [-2002.689] (-2001.310) * (-2017.958) (-1996.680) [-2006.094] (-2011.320) -- 0:04:47
      281000 -- (-2008.269) (-2001.139) [-2002.287] (-2005.720) * (-2004.153) [-2007.533] (-2011.784) (-2003.233) -- 0:04:46
      281500 -- [-2002.502] (-2003.482) (-2007.542) (-2010.421) * (-2001.285) [-2002.133] (-2013.590) (-2003.608) -- 0:04:45
      282000 -- [-2006.443] (-2000.753) (-2005.934) (-2021.183) * [-2005.278] (-2002.735) (-2013.231) (-2003.538) -- 0:04:45
      282500 -- (-2008.686) [-2017.875] (-2003.895) (-1993.638) * [-2000.236] (-2005.826) (-2012.070) (-2010.811) -- 0:04:44
      283000 -- (-1999.631) (-2008.267) (-2011.666) [-2002.955] * (-2006.781) [-2004.876] (-2001.491) (-1999.000) -- 0:04:46
      283500 -- (-1998.805) (-2006.256) [-2004.692] (-2006.694) * (-2006.549) (-2010.674) (-2001.844) [-2004.380] -- 0:04:45
      284000 -- (-2003.064) [-2007.055] (-2006.212) (-2010.091) * [-2003.492] (-2021.205) (-2012.720) (-2010.430) -- 0:04:44
      284500 -- (-2000.547) (-2012.181) (-2007.543) [-2001.457] * (-2001.778) [-2000.427] (-2005.139) (-1994.608) -- 0:04:44
      285000 -- [-2007.253] (-2001.073) (-2013.760) (-2002.717) * (-2008.277) [-1997.331] (-2014.023) (-1996.398) -- 0:04:43

      Average standard deviation of split frequencies: 0.018616

      285500 -- (-2013.481) (-2005.973) (-2007.334) [-2004.330] * (-2002.100) (-2007.504) [-1994.394] (-2000.004) -- 0:04:45
      286000 -- [-2002.238] (-2005.217) (-2016.145) (-2006.022) * [-1996.560] (-2011.739) (-2002.676) (-2007.766) -- 0:04:44
      286500 -- [-1998.354] (-2008.333) (-2010.225) (-2003.928) * [-2004.428] (-2010.507) (-2013.781) (-2004.695) -- 0:04:43
      287000 -- [-2008.975] (-2013.682) (-2000.079) (-2014.879) * (-2010.588) (-2000.830) (-1997.922) [-2006.697] -- 0:04:43
      287500 -- (-2003.823) (-1999.039) [-1997.604] (-2003.933) * (-2014.679) [-2001.183] (-2009.740) (-2009.760) -- 0:04:42
      288000 -- (-2008.152) (-2002.634) [-2004.572] (-2005.554) * [-2003.536] (-2012.881) (-2004.133) (-1999.149) -- 0:04:44
      288500 -- (-2007.021) (-2009.674) [-2008.857] (-2006.408) * (-2004.551) (-2002.840) [-1998.866] (-2003.167) -- 0:04:43
      289000 -- (-2002.973) (-2015.061) [-2002.309] (-2001.581) * (-2000.988) (-2015.222) (-1996.251) [-1997.994] -- 0:04:42
      289500 -- (-2013.836) [-2005.558] (-2016.124) (-2017.068) * (-2003.119) (-2010.144) [-2004.813] (-2001.201) -- 0:04:42
      290000 -- (-2009.254) [-2001.167] (-2008.076) (-2002.580) * [-1991.466] (-2013.248) (-2007.195) (-2003.101) -- 0:04:41

      Average standard deviation of split frequencies: 0.018412

      290500 -- (-2008.821) (-1998.430) [-2001.053] (-1999.449) * (-1995.747) [-2002.718] (-2018.318) (-2013.948) -- 0:04:43
      291000 -- (-2009.352) (-2001.651) [-2008.209] (-1998.725) * [-1998.992] (-2005.919) (-2011.204) (-2003.793) -- 0:04:42
      291500 -- (-2008.510) [-1996.658] (-2004.464) (-1996.878) * (-2005.687) [-2005.045] (-2023.747) (-2009.488) -- 0:04:41
      292000 -- [-2007.324] (-2009.102) (-2006.897) (-2007.391) * (-2009.286) (-2011.934) [-1996.453] (-2008.480) -- 0:04:41
      292500 -- [-2001.328] (-2002.768) (-2006.419) (-2005.851) * [-2000.450] (-2002.929) (-2003.471) (-2010.054) -- 0:04:40
      293000 -- [-1999.788] (-2001.149) (-1999.945) (-2016.613) * [-2009.139] (-2006.962) (-2009.749) (-2004.784) -- 0:04:42
      293500 -- (-2018.223) [-1999.222] (-2001.902) (-2004.822) * (-2020.793) (-2013.188) [-2003.164] (-2007.774) -- 0:04:41
      294000 -- (-2010.711) [-1998.008] (-2014.550) (-2006.203) * (-2020.441) [-2002.573] (-1997.593) (-2007.518) -- 0:04:40
      294500 -- (-1998.171) [-2004.464] (-2022.298) (-2006.740) * (-1999.100) (-2001.108) (-2011.746) [-2006.361] -- 0:04:40
      295000 -- (-2000.352) [-1998.777] (-2017.549) (-2016.703) * [-2003.589] (-2008.920) (-2001.362) (-2007.291) -- 0:04:39

      Average standard deviation of split frequencies: 0.019673

      295500 -- (-2009.536) (-2010.760) [-1997.655] (-2002.080) * [-1999.495] (-2005.648) (-2003.721) (-2007.569) -- 0:04:41
      296000 -- [-1996.931] (-2002.078) (-2009.738) (-1996.845) * (-1999.188) (-2002.792) (-2013.223) [-1998.603] -- 0:04:40
      296500 -- (-2003.901) (-2002.413) (-2000.781) [-1999.860] * (-2005.256) (-2007.223) [-1998.416] (-2000.267) -- 0:04:39
      297000 -- (-1999.430) (-2003.012) (-2000.907) [-2004.305] * (-2009.843) [-2003.162] (-2001.214) (-2008.446) -- 0:04:39
      297500 -- (-2006.577) [-2008.904] (-2015.539) (-2013.292) * (-2000.733) (-2011.922) [-2002.647] (-2007.469) -- 0:04:38
      298000 -- (-2005.034) (-2006.122) [-2000.516] (-2011.143) * (-2002.050) (-2002.187) [-2001.772] (-2006.853) -- 0:04:40
      298500 -- (-2003.304) (-2002.610) (-2006.312) [-1997.914] * (-1999.847) [-1999.247] (-1999.134) (-2008.670) -- 0:04:39
      299000 -- [-2003.081] (-2012.500) (-2012.419) (-2006.761) * (-2001.224) (-2001.823) [-2004.634] (-2011.433) -- 0:04:38
      299500 -- [-2006.984] (-2010.423) (-1999.222) (-2009.319) * (-2009.518) (-2005.511) [-2000.358] (-2010.159) -- 0:04:38
      300000 -- (-2005.678) (-2001.303) (-2010.009) [-2004.017] * (-2005.709) [-2003.220] (-2000.580) (-2005.892) -- 0:04:37

      Average standard deviation of split frequencies: 0.020751

      300500 -- (-2001.043) (-1999.780) (-2010.462) [-2001.460] * (-2011.382) [-2002.325] (-2008.270) (-2009.801) -- 0:04:37
      301000 -- (-2009.227) (-2007.964) [-2004.180] (-2002.602) * (-2007.164) [-2003.296] (-2002.898) (-2009.184) -- 0:04:38
      301500 -- (-1999.902) [-2002.969] (-2005.544) (-2008.881) * [-2005.047] (-2005.924) (-2004.095) (-2004.288) -- 0:04:38
      302000 -- (-2007.159) (-2004.189) [-2004.260] (-2008.742) * (-1999.919) (-2005.291) [-2008.711] (-2011.177) -- 0:04:37
      302500 -- [-1999.228] (-2004.889) (-2016.627) (-2008.278) * (-2033.507) (-2005.247) (-2009.493) [-2001.734] -- 0:04:36
      303000 -- (-2008.858) (-2011.120) (-2013.264) [-2007.151] * (-2009.198) [-2002.852] (-2008.229) (-2003.392) -- 0:04:36
      303500 -- [-2006.869] (-2001.476) (-2000.878) (-2010.881) * (-1995.976) [-2002.121] (-2006.060) (-2004.544) -- 0:04:37
      304000 -- (-2018.031) (-2003.103) [-2005.123] (-2009.359) * [-2002.199] (-2013.376) (-2015.825) (-2008.105) -- 0:04:37
      304500 -- (-2003.886) (-2006.002) [-1997.399] (-2014.302) * (-2013.401) (-2008.768) [-2006.582] (-2002.700) -- 0:04:36
      305000 -- (-2015.499) (-2005.577) (-2001.798) [-1999.701] * (-2009.322) (-1996.485) [-2001.513] (-2006.878) -- 0:04:35

      Average standard deviation of split frequencies: 0.019936

      305500 -- [-2001.309] (-2014.714) (-2004.323) (-2004.732) * (-1998.820) (-1992.788) (-2006.045) [-1996.072] -- 0:04:35
      306000 -- (-2004.390) (-2001.152) (-2011.582) [-1996.064] * (-2017.696) [-2000.298] (-2000.560) (-1996.742) -- 0:04:36
      306500 -- [-2005.962] (-2012.965) (-2011.076) (-2001.308) * (-1999.441) (-2000.991) [-1997.412] (-2000.573) -- 0:04:36
      307000 -- (-2013.144) (-2019.549) [-2008.931] (-2010.144) * (-1997.508) (-2013.844) (-2013.162) [-2001.351] -- 0:04:35
      307500 -- (-2007.777) (-2017.457) (-2013.904) [-2004.295] * (-2018.748) (-2007.916) (-2007.772) [-2007.779] -- 0:04:34
      308000 -- (-2009.395) (-2008.223) (-2010.819) [-2005.022] * (-2006.633) (-2016.090) [-2010.122] (-2007.774) -- 0:04:34
      308500 -- (-2002.785) (-2019.648) (-1994.824) [-2001.864] * (-2003.283) (-2017.340) (-2008.680) [-2008.305] -- 0:04:35
      309000 -- (-2020.506) [-2000.280] (-2000.941) (-2005.841) * [-1999.171] (-2006.251) (-2005.143) (-2010.414) -- 0:04:35
      309500 -- (-2003.417) (-2007.283) [-2008.902] (-2003.493) * (-2001.221) (-2014.894) [-2003.599] (-2009.426) -- 0:04:34
      310000 -- [-1998.772] (-2000.198) (-2008.793) (-2006.422) * [-2015.673] (-2011.489) (-2005.048) (-2006.409) -- 0:04:33

      Average standard deviation of split frequencies: 0.019548

      310500 -- (-2018.950) (-1999.620) [-2000.700] (-2001.910) * [-1999.268] (-2014.178) (-2011.875) (-2012.278) -- 0:04:33
      311000 -- (-2013.245) (-2014.695) [-2001.768] (-2003.783) * [-2005.859] (-2010.438) (-2005.974) (-2014.539) -- 0:04:34
      311500 -- (-1998.084) [-2002.312] (-2006.781) (-1997.029) * (-2001.205) [-2005.174] (-2008.102) (-2004.373) -- 0:04:34
      312000 -- (-2001.772) (-2016.603) [-2001.238] (-1991.573) * (-2012.479) (-2006.783) [-2001.481] (-2011.086) -- 0:04:33
      312500 -- (-2008.725) (-1999.798) (-2013.601) [-1996.594] * (-2006.035) (-2013.880) (-2021.083) [-2014.228] -- 0:04:32
      313000 -- (-2017.274) [-1998.647] (-2008.397) (-2009.156) * (-2013.382) (-2013.312) [-1998.287] (-1999.097) -- 0:04:32
      313500 -- (-2010.504) [-2001.881] (-2006.663) (-2010.372) * (-2007.759) [-2003.349] (-1998.881) (-2000.929) -- 0:04:33
      314000 -- (-2002.367) (-2009.758) (-2005.720) [-1999.476] * (-2014.247) [-1998.880] (-2005.544) (-1999.089) -- 0:04:33
      314500 -- (-2010.916) [-2002.466] (-2001.382) (-1999.520) * (-2006.884) (-2000.554) (-2013.703) [-2002.728] -- 0:04:32
      315000 -- (-2010.137) (-2002.995) (-2011.589) [-2007.035] * (-2007.687) (-2004.502) [-2000.657] (-2014.554) -- 0:04:31

      Average standard deviation of split frequencies: 0.019130

      315500 -- (-2002.569) (-2006.922) [-2005.363] (-2006.797) * [-2000.742] (-2011.654) (-2005.802) (-1992.946) -- 0:04:31
      316000 -- (-2013.038) (-2000.663) [-1996.893] (-2035.866) * (-2020.546) [-2009.504] (-2007.792) (-1997.178) -- 0:04:32
      316500 -- (-2019.591) [-1998.229] (-1997.443) (-2005.644) * (-2004.518) [-1996.211] (-2002.750) (-2006.615) -- 0:04:32
      317000 -- (-2017.006) [-2003.704] (-2007.433) (-2003.275) * [-2015.461] (-2006.838) (-1994.121) (-2009.081) -- 0:04:31
      317500 -- [-2002.769] (-2010.625) (-1996.054) (-2000.789) * (-2006.397) (-2004.135) [-2011.172] (-2003.460) -- 0:04:30
      318000 -- (-2008.106) (-2011.484) (-2012.839) [-1998.829] * (-2020.955) (-2003.944) (-2011.493) [-2006.908] -- 0:04:30
      318500 -- (-2001.214) (-2002.849) [-2002.181] (-2006.606) * (-2012.347) (-1997.181) [-1999.224] (-2005.075) -- 0:04:31
      319000 -- [-2005.760] (-2017.269) (-2005.625) (-2014.078) * (-2008.883) [-2002.055] (-2009.260) (-2010.995) -- 0:04:31
      319500 -- (-2003.759) (-2020.824) [-2008.019] (-2023.775) * (-2006.602) (-2007.710) [-1997.194] (-2006.800) -- 0:04:30
      320000 -- [-2003.564] (-2004.970) (-2002.790) (-2022.758) * (-2010.945) (-2004.200) [-1995.716] (-2018.217) -- 0:04:29

      Average standard deviation of split frequencies: 0.018073

      320500 -- (-2008.830) [-2007.809] (-2007.593) (-2017.928) * [-2003.395] (-2004.427) (-2006.889) (-2013.658) -- 0:04:29
      321000 -- [-2003.540] (-2007.944) (-2011.853) (-2007.118) * [-2013.046] (-2012.258) (-2006.394) (-2015.587) -- 0:04:30
      321500 -- (-2011.577) [-2010.163] (-2014.720) (-2004.259) * (-2007.554) (-2012.785) (-2006.594) [-1999.220] -- 0:04:30
      322000 -- (-2007.419) [-2005.939] (-2012.305) (-2004.184) * [-2007.981] (-2014.008) (-1999.937) (-1997.165) -- 0:04:29
      322500 -- (-2013.323) [-2003.779] (-2001.755) (-2004.519) * (-2015.037) (-2009.238) [-2004.544] (-2002.910) -- 0:04:31
      323000 -- (-2017.247) (-1999.599) (-2021.273) [-2004.612] * (-2010.377) [-2002.632] (-2007.547) (-2003.921) -- 0:04:30
      323500 -- [-2000.078] (-2008.040) (-2011.408) (-2002.217) * (-2013.421) (-2005.280) [-2000.621] (-1994.020) -- 0:04:29
      324000 -- [-2002.958] (-2007.178) (-2008.057) (-2008.336) * (-2021.324) (-2007.937) [-1998.810] (-1998.689) -- 0:04:31
      324500 -- (-2012.565) (-2002.808) [-1999.829] (-1994.565) * (-2023.333) (-2004.217) (-2002.264) [-2008.644] -- 0:04:30
      325000 -- (-2002.106) [-2006.079] (-2006.642) (-2004.023) * (-2019.037) (-2006.133) [-2004.636] (-2006.671) -- 0:04:30

      Average standard deviation of split frequencies: 0.017693

      325500 -- (-2000.826) (-2002.682) [-2006.521] (-1998.007) * (-2008.644) (-2003.761) (-2003.039) [-2006.929] -- 0:04:31
      326000 -- (-2018.074) (-2002.772) [-2004.412] (-2007.015) * (-2013.040) (-2003.036) [-2002.241] (-2016.608) -- 0:04:30
      326500 -- (-2004.344) (-1996.562) [-2007.484] (-2012.673) * (-2008.826) (-2001.857) [-2003.280] (-2012.503) -- 0:04:30
      327000 -- (-2015.696) (-2011.438) [-2006.569] (-2017.029) * (-2004.450) [-1995.847] (-2007.830) (-2004.180) -- 0:04:29
      327500 -- [-2004.873] (-2011.499) (-2003.132) (-2005.028) * (-2007.777) [-1999.203] (-2012.189) (-2007.880) -- 0:04:31
      328000 -- (-2004.643) (-2020.844) [-2007.179] (-2005.702) * [-1997.541] (-2004.159) (-2017.191) (-2012.080) -- 0:04:30
      328500 -- [-2007.967] (-2015.219) (-2004.016) (-2003.034) * [-2001.699] (-2003.261) (-2016.385) (-2008.698) -- 0:04:29
      329000 -- (-2001.752) (-2017.269) [-2008.010] (-2006.810) * (-2009.320) (-2008.076) (-2001.006) [-2003.224] -- 0:04:29
      329500 -- (-2008.861) (-2009.606) [-2005.935] (-2006.746) * (-2005.005) (-2008.886) [-2001.552] (-2006.730) -- 0:04:28
      330000 -- [-2008.207] (-2003.214) (-2000.451) (-2009.490) * [-1994.746] (-2006.865) (-2029.478) (-1996.550) -- 0:04:30

      Average standard deviation of split frequencies: 0.017862

      330500 -- (-2006.804) (-2004.703) [-2007.538] (-2005.182) * [-2004.027] (-2005.848) (-2006.023) (-2001.027) -- 0:04:29
      331000 -- (-2000.445) (-2011.452) (-1996.939) [-2004.475] * (-1996.967) (-2004.615) [-2010.487] (-1998.728) -- 0:04:28
      331500 -- (-2009.493) (-2019.381) (-2001.387) [-2000.314] * (-2003.265) [-1996.520] (-2008.675) (-2011.918) -- 0:04:28
      332000 -- (-2009.505) (-1999.416) [-2006.784] (-2006.237) * [-1999.878] (-2021.324) (-2007.245) (-2012.522) -- 0:04:27
      332500 -- (-1999.611) [-1998.029] (-2005.840) (-2005.309) * (-1995.358) (-2012.768) [-2004.112] (-2010.225) -- 0:04:29
      333000 -- (-2006.455) [-2009.724] (-2013.149) (-1997.760) * (-1998.339) (-2003.428) (-2002.593) [-2005.270] -- 0:04:28
      333500 -- (-2011.948) [-1996.601] (-2011.268) (-2013.555) * [-1993.618] (-2011.360) (-2002.104) (-2006.129) -- 0:04:27
      334000 -- (-2010.075) [-1999.678] (-2007.526) (-2013.813) * (-2011.266) [-2006.745] (-2008.353) (-2003.181) -- 0:04:27
      334500 -- [-2002.754] (-2019.056) (-2005.408) (-2013.752) * (-2006.504) [-2016.623] (-2018.602) (-2002.663) -- 0:04:26
      335000 -- (-2009.160) [-2014.193] (-2014.368) (-2010.009) * (-2002.503) (-2008.409) [-2005.649] (-2000.459) -- 0:04:26

      Average standard deviation of split frequencies: 0.017826

      335500 -- [-2012.754] (-2009.995) (-2008.779) (-2009.796) * (-2004.348) (-2004.414) [-2001.604] (-2001.085) -- 0:04:27
      336000 -- (-2010.752) (-2010.027) [-2009.223] (-2005.969) * (-2011.877) (-2008.647) [-2001.677] (-2010.897) -- 0:04:26
      336500 -- (-2010.431) [-2001.027] (-2008.740) (-2004.618) * (-2009.437) (-2003.715) [-1997.014] (-1997.284) -- 0:04:26
      337000 -- (-2015.314) (-2000.405) [-2004.159] (-2016.838) * (-2011.503) (-2002.605) [-1998.994] (-2003.755) -- 0:04:25
      337500 -- (-2013.033) (-2002.624) [-2004.934] (-2001.659) * (-1997.851) (-2001.635) (-2004.611) [-2002.500] -- 0:04:25
      338000 -- (-2016.052) (-2004.746) [-2005.538] (-2005.522) * (-1996.752) (-2005.572) [-1996.582] (-1999.136) -- 0:04:26
      338500 -- (-2005.824) (-1994.154) [-2004.096] (-2013.226) * (-2000.915) (-2003.924) (-1995.054) [-2003.673] -- 0:04:25
      339000 -- (-2003.590) [-2001.412] (-2003.316) (-2005.584) * (-2005.372) [-2020.438] (-2001.737) (-1997.752) -- 0:04:25
      339500 -- (-2008.357) (-2004.005) (-2005.142) [-2001.249] * (-2007.174) [-2006.341] (-1997.221) (-2001.288) -- 0:04:24
      340000 -- [-2000.414] (-2007.700) (-2000.568) (-2002.373) * (-2009.517) (-2017.018) (-2005.089) [-2002.307] -- 0:04:24

      Average standard deviation of split frequencies: 0.018335

      340500 -- (-2010.838) (-1997.311) (-2003.269) [-1996.661] * (-2011.173) (-2013.120) (-2004.031) [-2002.958] -- 0:04:25
      341000 -- (-2003.141) (-1999.706) (-2002.597) [-2008.265] * [-2002.712] (-2010.477) (-2017.743) (-2014.438) -- 0:04:24
      341500 -- (-2009.438) (-2012.162) [-1995.454] (-2027.317) * [-2001.787] (-2009.807) (-2023.888) (-2017.234) -- 0:04:24
      342000 -- (-2007.617) (-2015.058) [-1996.701] (-2011.653) * (-2004.624) (-2007.159) [-2002.818] (-2019.050) -- 0:04:23
      342500 -- [-1997.022] (-2017.412) (-2010.827) (-2010.982) * (-2010.660) [-2002.044] (-1997.767) (-2017.561) -- 0:04:23
      343000 -- [-2003.724] (-2008.678) (-2018.152) (-2003.374) * (-2015.682) [-2003.315] (-2000.203) (-2005.978) -- 0:04:24
      343500 -- (-2007.343) (-2006.966) [-2003.530] (-2003.851) * (-2009.133) (-2011.951) [-2004.350] (-2007.129) -- 0:04:23
      344000 -- [-1997.060] (-2012.390) (-2013.923) (-2014.984) * (-2009.698) (-2006.669) [-1998.129] (-1998.271) -- 0:04:23
      344500 -- (-2003.051) (-2005.896) (-2017.720) [-2017.586] * (-2013.234) (-2002.601) [-2008.771] (-2011.668) -- 0:04:22
      345000 -- [-2001.059] (-2004.583) (-2007.364) (-2009.411) * (-2010.860) (-2011.315) (-1999.481) [-1997.856] -- 0:04:22

      Average standard deviation of split frequencies: 0.018223

      345500 -- [-1997.433] (-2003.698) (-2011.005) (-2014.420) * (-2014.631) [-2016.409] (-2005.637) (-1996.087) -- 0:04:23
      346000 -- (-2014.164) [-1996.848] (-2007.006) (-2008.177) * [-2006.001] (-2003.939) (-2004.072) (-2005.991) -- 0:04:22
      346500 -- (-2004.511) [-2004.925] (-2011.087) (-2009.533) * (-2004.137) (-2000.458) [-2008.903] (-2010.785) -- 0:04:22
      347000 -- [-1999.307] (-2010.185) (-2010.466) (-2004.029) * [-2001.876] (-1991.958) (-2008.621) (-2016.310) -- 0:04:21
      347500 -- [-2001.182] (-2015.065) (-2010.406) (-1998.321) * [-2002.497] (-2018.558) (-1998.255) (-2000.832) -- 0:04:21
      348000 -- (-2007.592) (-2008.038) (-2012.039) [-2014.424] * (-1997.944) (-2018.166) [-2005.510] (-1998.416) -- 0:04:22
      348500 -- (-2011.605) (-2017.855) (-2012.872) [-1997.745] * [-1998.811] (-2007.714) (-2011.879) (-2011.431) -- 0:04:21
      349000 -- (-2006.472) (-1999.757) (-2001.800) [-2003.345] * (-2005.550) (-2008.727) [-2002.322] (-1997.073) -- 0:04:21
      349500 -- (-2007.362) (-2006.442) [-2003.883] (-2000.249) * (-2017.487) [-1995.008] (-2004.048) (-2007.699) -- 0:04:20
      350000 -- (-2003.012) (-2015.326) [-2001.028] (-2003.157) * (-2008.191) (-2001.788) (-2006.820) [-1998.526] -- 0:04:20

      Average standard deviation of split frequencies: 0.018232

      350500 -- (-2002.333) [-1999.440] (-2001.203) (-2001.366) * [-2010.081] (-2004.026) (-2004.372) (-2013.116) -- 0:04:21
      351000 -- (-2001.483) [-2001.035] (-2000.493) (-1999.868) * (-2010.295) (-2007.651) (-2011.790) [-2010.043] -- 0:04:20
      351500 -- (-2016.209) (-2008.709) [-1999.143] (-2006.821) * (-2001.292) (-2016.510) (-2009.602) [-2004.500] -- 0:04:20
      352000 -- [-2007.064] (-2021.032) (-2003.569) (-1999.492) * [-2005.674] (-2019.819) (-2009.096) (-2000.456) -- 0:04:19
      352500 -- [-2002.230] (-2009.271) (-2007.429) (-2003.584) * (-2004.356) (-2012.647) (-2004.744) [-1994.162] -- 0:04:19
      353000 -- (-2002.678) (-2009.759) (-2001.479) [-2005.685] * (-2017.302) [-2005.518] (-1999.773) (-2005.365) -- 0:04:20
      353500 -- (-2000.223) [-2006.035] (-2006.649) (-2011.971) * (-2001.562) (-2010.775) (-1999.792) [-2004.407] -- 0:04:19
      354000 -- [-2002.796] (-2005.044) (-2010.684) (-2001.373) * (-2016.884) (-2010.197) (-2006.315) [-2002.856] -- 0:04:19
      354500 -- (-2010.756) (-2007.570) [-2011.531] (-2008.899) * (-2017.837) [-2007.538] (-1997.710) (-2008.528) -- 0:04:18
      355000 -- (-2002.788) (-2016.446) (-2017.012) [-2001.635] * (-2001.747) (-2007.431) [-2001.147] (-2004.570) -- 0:04:18

      Average standard deviation of split frequencies: 0.017370

      355500 -- (-2011.573) (-2007.102) (-2013.062) [-2002.509] * (-2002.833) (-2001.069) (-2005.979) [-2003.526] -- 0:04:19
      356000 -- (-2000.689) [-2001.850] (-2003.790) (-2005.423) * (-2002.252) (-1998.681) [-2000.018] (-2008.137) -- 0:04:18
      356500 -- [-2005.741] (-1995.840) (-2009.817) (-2005.883) * (-2004.312) (-2010.646) (-2009.995) [-2010.887] -- 0:04:18
      357000 -- [-1997.009] (-2012.122) (-2017.874) (-2012.345) * (-2002.750) [-2002.130] (-2014.424) (-2003.803) -- 0:04:17
      357500 -- (-2014.343) (-2005.719) (-2007.866) [-2012.305] * [-2002.494] (-1993.825) (-2006.192) (-2003.697) -- 0:04:17
      358000 -- (-1998.223) (-2007.726) (-2010.180) [-2007.867] * (-2001.463) [-2000.879] (-2011.133) (-2013.622) -- 0:04:18
      358500 -- (-2006.022) (-2007.171) [-1996.894] (-2008.973) * (-2025.835) (-2003.026) (-2009.396) [-2003.204] -- 0:04:17
      359000 -- (-2006.953) [-2004.623] (-2011.711) (-2008.593) * (-2010.930) (-2004.030) (-2000.007) [-2003.327] -- 0:04:17
      359500 -- (-2011.843) (-1996.275) [-2007.311] (-2004.404) * (-2008.431) (-2002.765) (-2001.870) [-2000.281] -- 0:04:16
      360000 -- (-2005.612) (-2001.704) [-1996.172] (-1998.133) * (-2007.671) (-2000.306) [-2003.283] (-1997.248) -- 0:04:16

      Average standard deviation of split frequencies: 0.017727

      360500 -- [-2000.730] (-1999.867) (-1998.908) (-2004.891) * (-2009.955) [-2008.098] (-2008.513) (-2006.358) -- 0:04:17
      361000 -- (-2005.091) (-2011.902) [-2004.701] (-2008.511) * (-2001.973) (-2005.879) [-2009.802] (-2010.735) -- 0:04:16
      361500 -- (-2008.696) (-2021.924) (-2005.850) [-2002.308] * [-2005.477] (-2003.240) (-2007.534) (-1995.941) -- 0:04:16
      362000 -- [-2003.425] (-2003.361) (-2005.835) (-2022.508) * (-2011.694) (-2002.228) [-2003.269] (-2010.018) -- 0:04:15
      362500 -- (-1997.766) (-2006.261) [-1997.242] (-2007.970) * (-2007.770) [-2000.694] (-2008.923) (-2009.967) -- 0:04:15
      363000 -- [-1998.088] (-2012.742) (-2001.292) (-2010.649) * [-2003.774] (-1997.970) (-2016.414) (-2009.691) -- 0:04:16
      363500 -- [-2003.318] (-2008.405) (-2005.684) (-2009.443) * (-2025.327) (-1999.660) [-2002.930] (-2017.330) -- 0:04:15
      364000 -- (-2009.427) (-2002.554) (-2005.227) [-2002.970] * (-1999.757) [-2006.168] (-2007.203) (-2003.885) -- 0:04:15
      364500 -- [-2002.321] (-1998.639) (-2016.439) (-2002.060) * [-2001.140] (-2009.554) (-2004.013) (-2007.907) -- 0:04:14
      365000 -- (-2002.853) (-2009.491) (-2001.496) [-2000.168] * (-2011.855) [-1995.295] (-2007.384) (-2009.015) -- 0:04:14

      Average standard deviation of split frequencies: 0.017577

      365500 -- (-2013.386) (-2012.789) [-2000.473] (-2012.173) * (-2004.850) (-2002.911) [-2008.459] (-2011.259) -- 0:04:15
      366000 -- (-2007.876) (-2014.436) (-2004.311) [-2014.565] * (-2005.322) [-1997.671] (-2011.602) (-2008.502) -- 0:04:14
      366500 -- (-2009.192) (-2014.689) [-1994.394] (-2000.595) * [-2005.647] (-2004.381) (-2009.894) (-2023.771) -- 0:04:14
      367000 -- (-2007.180) (-2018.312) [-2000.023] (-2008.799) * [-1993.631] (-2004.520) (-1998.904) (-2008.705) -- 0:04:13
      367500 -- (-2003.259) (-2009.374) (-2000.950) [-2003.524] * (-2004.548) (-2014.712) [-2007.973] (-2016.798) -- 0:04:13
      368000 -- [-2002.644] (-2004.774) (-1996.610) (-1998.292) * (-2007.121) (-1998.416) [-2009.930] (-2017.838) -- 0:04:14
      368500 -- (-2008.193) [-1994.932] (-1999.168) (-2012.256) * (-2006.132) [-2001.296] (-2005.447) (-2004.750) -- 0:04:13
      369000 -- (-2010.151) [-2003.884] (-1998.005) (-1999.210) * [-1999.074] (-2013.283) (-2013.518) (-2013.808) -- 0:04:13
      369500 -- (-2015.861) [-2000.845] (-2003.110) (-1998.702) * (-2010.653) [-2004.355] (-2020.502) (-1997.750) -- 0:04:12
      370000 -- [-2005.235] (-2013.536) (-2018.331) (-2002.067) * (-2001.262) (-2017.870) [-2008.777] (-2006.068) -- 0:04:12

      Average standard deviation of split frequencies: 0.016383

      370500 -- (-2008.241) (-2005.005) (-2010.709) [-2010.913] * (-2005.425) [-2004.073] (-2015.555) (-2004.388) -- 0:04:13
      371000 -- (-2011.758) (-2002.121) (-2010.087) [-2016.186] * (-2011.360) [-1999.037] (-2012.754) (-2014.220) -- 0:04:12
      371500 -- (-1992.436) (-2001.028) (-2020.678) [-1996.717] * (-2003.535) (-2006.013) [-2003.798] (-2013.644) -- 0:04:12
      372000 -- [-1999.250] (-2007.554) (-2001.019) (-2011.529) * (-2005.310) (-1994.870) [-1997.192] (-2020.950) -- 0:04:11
      372500 -- (-2004.073) (-2018.214) [-2005.206] (-2019.020) * [-1992.880] (-2008.836) (-2009.053) (-2003.866) -- 0:04:11
      373000 -- (-2006.263) (-2003.867) [-2004.782] (-2009.325) * (-1998.629) (-2010.638) [-2002.732] (-2001.277) -- 0:04:12
      373500 -- (-2020.171) (-2010.511) [-2000.557] (-2000.208) * [-2000.904] (-2002.986) (-2000.154) (-1997.933) -- 0:04:11
      374000 -- (-2024.240) (-2016.047) (-2003.536) [-2000.931] * [-1996.872] (-2019.574) (-2001.704) (-2003.280) -- 0:04:11
      374500 -- (-2014.514) [-2012.147] (-1999.022) (-1999.345) * (-2007.470) (-2007.371) (-2005.032) [-2013.403] -- 0:04:10
      375000 -- (-2017.309) [-2012.279] (-2010.719) (-2004.288) * (-2012.127) (-2010.914) [-1996.233] (-2013.175) -- 0:04:10

      Average standard deviation of split frequencies: 0.015828

      375500 -- (-2016.639) [-2003.361] (-2010.106) (-2008.179) * (-2015.083) [-2000.657] (-2016.138) (-2003.755) -- 0:04:11
      376000 -- (-2004.736) (-2002.547) (-2005.327) [-1998.589] * (-2007.533) (-2003.547) (-2008.449) [-2004.908] -- 0:04:10
      376500 -- [-1997.239] (-1999.332) (-2007.686) (-1995.881) * [-2010.166] (-2003.889) (-2018.267) (-2006.445) -- 0:04:10
      377000 -- (-2014.015) (-2016.544) [-2005.787] (-1997.000) * (-2023.499) (-2010.475) (-2008.337) [-2005.295] -- 0:04:09
      377500 -- (-2008.515) (-1998.227) (-2003.588) [-1999.855] * (-2007.622) (-2006.616) (-2007.244) [-2002.229] -- 0:04:10
      378000 -- [-2003.077] (-2012.715) (-2006.245) (-2006.683) * [-2002.999] (-2012.260) (-2000.379) (-2010.898) -- 0:04:10
      378500 -- (-2001.460) (-2006.560) (-2010.650) [-2000.735] * (-2009.922) [-2001.916] (-2000.314) (-2001.663) -- 0:04:09
      379000 -- (-2002.035) (-2005.772) (-2003.110) [-2003.919] * [-2006.390] (-2008.826) (-2010.084) (-2005.785) -- 0:04:09
      379500 -- (-2000.630) (-2009.731) [-2006.369] (-2003.140) * (-2018.538) (-2000.868) [-2006.557] (-2015.002) -- 0:04:10
      380000 -- [-1995.352] (-2012.828) (-1999.677) (-2007.049) * [-2013.202] (-2007.283) (-2002.488) (-2012.413) -- 0:04:09

      Average standard deviation of split frequencies: 0.016021

      380500 -- (-2009.579) [-2005.692] (-2012.426) (-2007.599) * (-2000.547) (-1996.228) (-2009.992) [-2003.616] -- 0:04:09
      381000 -- (-2006.738) (-2004.152) (-2008.483) [-2003.093] * (-1998.108) (-2014.168) (-2008.629) [-2001.190] -- 0:04:08
      381500 -- [-2003.542] (-2008.559) (-2009.018) (-2009.957) * (-2006.824) (-2011.256) (-2017.545) [-2000.725] -- 0:04:08
      382000 -- (-2006.487) [-2010.071] (-2009.549) (-2001.253) * (-2009.944) (-2018.694) [-2003.551] (-1999.811) -- 0:04:09
      382500 -- [-2005.505] (-2006.022) (-2005.353) (-2013.165) * (-2005.407) (-2008.028) (-2010.959) [-2002.455] -- 0:04:08
      383000 -- (-2003.404) (-1998.800) (-2005.613) [-2003.120] * (-1999.527) (-2009.109) (-1997.401) [-1997.702] -- 0:04:08
      383500 -- [-2003.543] (-2007.581) (-2006.132) (-2016.156) * [-2005.979] (-2016.067) (-2004.799) (-2012.484) -- 0:04:07
      384000 -- [-1999.504] (-2000.990) (-2019.230) (-2002.007) * (-2007.777) [-2003.878] (-2011.379) (-2006.812) -- 0:04:07
      384500 -- (-2008.135) (-2004.334) [-2005.206] (-2001.819) * (-2000.204) (-1997.886) (-2005.434) [-1998.010] -- 0:04:08
      385000 -- (-2003.081) [-2001.979] (-2023.804) (-1999.451) * (-2007.824) (-2003.341) [-2004.537] (-2000.507) -- 0:04:07

      Average standard deviation of split frequencies: 0.016105

      385500 -- [-2003.959] (-2007.222) (-2006.514) (-2001.013) * (-2001.149) [-2005.958] (-1998.666) (-2016.102) -- 0:04:07
      386000 -- (-2004.005) (-2005.540) (-2005.388) [-1998.795] * (-1997.683) (-2004.441) [-1998.095] (-2019.763) -- 0:04:06
      386500 -- [-2007.548] (-2014.192) (-2006.463) (-1995.224) * [-1998.532] (-2010.142) (-2005.419) (-2007.782) -- 0:04:07
      387000 -- (-2013.065) (-1997.543) (-2025.122) [-2000.025] * (-2006.976) (-2011.775) [-2002.748] (-2004.383) -- 0:04:07
      387500 -- [-2007.146] (-2009.427) (-2004.317) (-2002.785) * [-1995.406] (-2000.359) (-2011.361) (-2004.808) -- 0:04:06
      388000 -- (-2001.350) (-2009.681) [-1999.075] (-2006.033) * (-2009.589) (-1999.741) [-1995.211] (-1999.002) -- 0:04:06
      388500 -- (-2011.185) (-2020.165) (-2015.120) [-1999.788] * [-2000.375] (-2007.576) (-2014.172) (-2003.568) -- 0:04:07
      389000 -- [-2002.660] (-2008.879) (-2005.371) (-2011.247) * (-2006.213) (-2006.715) (-2002.389) [-2003.898] -- 0:04:06
      389500 -- [-2002.931] (-2002.116) (-2022.564) (-2003.396) * [-2001.499] (-2015.124) (-2006.577) (-2004.382) -- 0:04:06
      390000 -- (-2019.431) (-2000.540) [-2003.774] (-1993.538) * [-1997.897] (-1999.662) (-1999.291) (-2008.643) -- 0:04:05

      Average standard deviation of split frequencies: 0.016441

      390500 -- (-1997.501) (-2009.860) (-2008.308) [-1997.100] * (-2003.362) (-1996.599) (-2016.458) [-2003.893] -- 0:04:06
      391000 -- (-2003.973) (-1999.682) (-2009.617) [-1998.194] * (-2000.695) (-2008.575) (-2001.420) [-1996.213] -- 0:04:06
      391500 -- (-2002.980) [-2003.757] (-2009.637) (-2007.441) * (-1998.461) (-2004.946) (-2004.872) [-2001.126] -- 0:04:05
      392000 -- (-2012.679) [-2004.553] (-2006.158) (-2016.007) * (-2021.586) (-1999.691) (-2009.297) [-1995.441] -- 0:04:05
      392500 -- (-2013.910) (-2007.633) (-2004.841) [-2002.315] * (-2013.204) [-2008.085] (-2000.447) (-2000.192) -- 0:04:04
      393000 -- (-2022.883) [-2001.532] (-2001.148) (-2015.032) * [-2002.855] (-2002.379) (-2001.348) (-2003.299) -- 0:04:05
      393500 -- [-2001.571] (-2002.636) (-2005.021) (-2008.157) * (-2014.900) (-2009.952) (-2000.465) [-2004.885] -- 0:04:05
      394000 -- (-2006.841) (-2008.009) (-1996.421) [-2008.370] * (-2007.490) (-2003.972) (-2009.280) [-2001.878] -- 0:04:04
      394500 -- (-2007.620) [-1998.448] (-2004.675) (-1999.984) * (-2008.693) (-2003.394) [-2011.117] (-2013.934) -- 0:04:04
      395000 -- (-2012.657) (-2010.897) (-2007.298) [-1997.938] * (-2010.984) [-2001.423] (-2005.870) (-2003.320) -- 0:04:03

      Average standard deviation of split frequencies: 0.016591

      395500 -- (-2020.109) (-2000.535) (-1999.620) [-2009.916] * (-2001.027) (-2000.409) (-2010.525) [-1995.980] -- 0:04:04
      396000 -- (-2020.813) (-2007.121) (-2007.621) [-2002.232] * (-2013.416) (-2002.232) (-2013.505) [-2000.515] -- 0:04:04
      396500 -- (-2006.643) [-2003.349] (-2001.789) (-2014.771) * [-1999.609] (-2003.697) (-2006.878) (-2012.669) -- 0:04:03
      397000 -- (-2003.935) [-1996.960] (-2010.461) (-2005.392) * (-2008.489) [-2006.165] (-1998.149) (-2009.065) -- 0:04:03
      397500 -- (-2010.717) (-1998.342) (-2015.947) [-2002.232] * (-2005.816) [-2007.312] (-1996.693) (-1996.074) -- 0:04:02
      398000 -- [-2005.905] (-2006.742) (-2021.963) (-1993.259) * [-1994.200] (-1998.505) (-2002.727) (-2005.669) -- 0:04:03
      398500 -- (-2012.143) (-2014.831) (-2003.596) [-1997.344] * [-1997.434] (-1995.445) (-2008.570) (-1999.887) -- 0:04:03
      399000 -- (-2007.302) [-2008.702] (-2004.547) (-2015.934) * (-2020.596) (-2012.547) (-2012.390) [-2001.904] -- 0:04:02
      399500 -- (-2010.694) (-2008.158) (-2012.581) [-2004.775] * (-2014.241) (-2011.291) (-2010.855) [-2005.520] -- 0:04:02
      400000 -- (-2008.634) [-2002.418] (-2007.297) (-2007.279) * (-2010.489) [-1998.232] (-2011.885) (-2005.446) -- 0:04:03

      Average standard deviation of split frequencies: 0.016251

      400500 -- (-2004.597) (-2007.632) (-2001.713) [-2010.151] * (-1998.889) (-2007.301) (-2006.550) [-2006.432] -- 0:04:02
      401000 -- (-2006.219) [-1993.444] (-2004.805) (-2006.870) * (-1998.328) (-2016.115) (-2003.074) [-2012.892] -- 0:04:01
      401500 -- (-2004.692) (-1998.102) [-2004.716] (-1998.204) * [-1995.957] (-2005.071) (-2008.316) (-2008.692) -- 0:04:01
      402000 -- (-2007.497) (-2010.107) [-2002.269] (-2002.645) * (-1995.361) [-1996.805] (-2008.036) (-2016.393) -- 0:04:00
      402500 -- [-2006.130] (-2009.715) (-2007.094) (-1996.634) * [-2000.990] (-1999.259) (-2017.227) (-2008.691) -- 0:04:01
      403000 -- (-2002.539) [-2003.697] (-2011.506) (-2011.427) * (-2003.924) (-2008.491) [-2007.574] (-2006.005) -- 0:04:01
      403500 -- (-2009.637) [-1997.276] (-2002.396) (-1999.070) * (-1999.917) (-1995.309) (-2002.055) [-1998.900] -- 0:04:00
      404000 -- (-1998.869) (-2021.812) [-1997.858] (-2005.644) * (-1997.649) [-2007.302] (-2001.129) (-2012.288) -- 0:04:00
      404500 -- (-2004.313) (-2005.295) [-1998.582] (-2016.605) * [-2006.257] (-2008.633) (-1990.985) (-2007.864) -- 0:03:59
      405000 -- (-1996.869) [-1991.983] (-2001.336) (-2015.512) * (-2020.586) (-2013.912) [-1995.848] (-2002.906) -- 0:04:00

      Average standard deviation of split frequencies: 0.016473

      405500 -- [-1997.337] (-2001.106) (-2003.883) (-2000.143) * [-2014.426] (-2011.241) (-1996.725) (-2012.873) -- 0:04:00
      406000 -- (-2003.009) [-1995.927] (-2003.316) (-2004.014) * (-2018.882) (-2007.004) (-2014.318) [-1998.457] -- 0:03:59
      406500 -- (-1995.646) [-2007.394] (-2010.889) (-2001.212) * [-2008.344] (-2003.028) (-2002.574) (-2005.546) -- 0:03:59
      407000 -- (-1999.984) [-2013.072] (-1999.722) (-1997.942) * (-1997.544) (-2010.831) (-1993.736) [-1996.965] -- 0:03:58
      407500 -- (-2003.090) (-2002.608) [-2006.516] (-2008.692) * (-2010.073) [-1994.699] (-2009.066) (-2006.223) -- 0:03:59
      408000 -- (-2002.018) (-2000.047) (-2007.001) [-2007.706] * [-2011.954] (-2002.134) (-2009.640) (-2008.850) -- 0:03:59
      408500 -- (-1998.197) [-1997.853] (-2004.228) (-2002.829) * [-2000.461] (-2004.918) (-2004.635) (-2006.149) -- 0:03:58
      409000 -- (-2001.305) (-1993.669) [-2003.697] (-2009.790) * (-2007.766) (-2013.884) [-2007.293] (-2005.646) -- 0:03:58
      409500 -- (-2005.821) (-2007.038) [-2004.952] (-2002.901) * (-2003.346) (-2003.913) (-2004.920) [-1996.042] -- 0:03:57
      410000 -- (-2002.358) (-2003.947) (-1996.743) [-1998.471] * (-2007.877) [-2002.336] (-2004.884) (-2011.988) -- 0:03:58

      Average standard deviation of split frequencies: 0.016142

      410500 -- (-1997.904) (-2010.103) [-2004.247] (-2005.862) * [-2002.262] (-2012.169) (-2002.412) (-1996.473) -- 0:03:58
      411000 -- [-2008.795] (-2002.470) (-2003.939) (-2004.875) * (-2003.950) (-2002.972) [-1998.882] (-2000.027) -- 0:03:57
      411500 -- (-2002.250) (-2009.261) (-2007.896) [-2001.414] * (-2018.859) (-2010.643) (-1998.488) [-2001.480] -- 0:03:57
      412000 -- (-2009.501) (-2004.439) [-2006.028] (-2010.336) * [-2005.080] (-2001.645) (-2007.874) (-2005.225) -- 0:03:56
      412500 -- (-2012.460) [-2000.923] (-2014.087) (-1999.166) * [-1999.998] (-2007.493) (-1997.468) (-2004.123) -- 0:03:57
      413000 -- (-2004.615) (-2007.100) (-2004.924) [-2007.096] * (-2008.424) (-2005.785) [-1995.967] (-2010.004) -- 0:03:57
      413500 -- (-2005.143) (-2008.315) [-1997.582] (-1998.136) * (-2001.912) (-2008.759) [-2007.217] (-2007.709) -- 0:03:56
      414000 -- [-2019.538] (-2014.631) (-1996.341) (-2001.736) * [-1998.814] (-2010.562) (-1997.684) (-2008.661) -- 0:03:56
      414500 -- [-1997.208] (-2002.350) (-2002.416) (-2013.572) * (-2001.500) (-2011.896) (-2015.785) [-2001.297] -- 0:03:55
      415000 -- [-1996.360] (-2011.287) (-2006.182) (-2011.414) * (-2002.394) (-2000.903) (-2000.899) [-2000.155] -- 0:03:56

      Average standard deviation of split frequencies: 0.016006

      415500 -- (-2005.145) (-2029.406) [-1997.127] (-2013.764) * (-2005.459) (-2003.835) (-1998.673) [-2008.871] -- 0:03:56
      416000 -- [-2012.568] (-2014.922) (-1998.916) (-1994.793) * (-2005.464) (-2009.948) (-2006.429) [-2000.233] -- 0:03:55
      416500 -- [-2015.129] (-2008.942) (-2005.688) (-2001.916) * (-2018.080) [-1997.728] (-2009.123) (-2005.089) -- 0:03:55
      417000 -- (-2008.896) (-1998.465) [-2004.389] (-2008.621) * (-2013.057) (-2006.807) [-2006.475] (-2006.938) -- 0:03:56
      417500 -- (-2004.944) (-2001.274) [-2011.591] (-2005.761) * (-2006.042) [-1996.288] (-2003.964) (-2005.186) -- 0:03:55
      418000 -- (-2009.327) (-2004.273) [-2009.205] (-1997.035) * (-2006.601) [-1999.812] (-2007.219) (-2019.441) -- 0:03:55
      418500 -- (-2005.654) (-2005.311) [-2006.084] (-1999.368) * (-2003.343) (-2009.403) [-2009.086] (-2006.321) -- 0:03:54
      419000 -- (-2005.029) (-2016.067) [-2001.756] (-1998.137) * [-1999.067] (-2000.975) (-2025.995) (-2007.059) -- 0:03:54
      419500 -- (-2005.037) [-2004.303] (-2008.023) (-2006.743) * (-2007.932) (-2006.861) (-2010.661) [-2007.575] -- 0:03:55
      420000 -- (-2009.030) (-2002.202) (-2000.612) [-1993.715] * [-2001.564] (-2003.875) (-2003.588) (-1994.136) -- 0:03:54

      Average standard deviation of split frequencies: 0.016179

      420500 -- [-2001.330] (-2009.006) (-2013.049) (-2013.787) * (-2004.773) (-1998.635) (-2003.396) [-2005.633] -- 0:03:54
      421000 -- (-2006.618) [-1997.136] (-2014.663) (-2004.093) * [-2010.502] (-2005.270) (-2005.012) (-2006.859) -- 0:03:53
      421500 -- [-1998.427] (-2015.177) (-2010.566) (-2005.198) * (-2000.973) (-2003.572) (-2008.151) [-1996.775] -- 0:03:54
      422000 -- [-2000.146] (-2001.932) (-2003.447) (-2016.868) * (-2003.843) [-2004.706] (-2021.303) (-2003.672) -- 0:03:54
      422500 -- [-1993.998] (-2002.988) (-2019.918) (-2010.340) * [-2004.809] (-2002.768) (-2005.619) (-2008.852) -- 0:03:53
      423000 -- (-2007.470) [-1998.714] (-2010.870) (-2007.833) * (-2017.658) (-2007.815) (-2011.940) [-1999.472] -- 0:03:53
      423500 -- (-2002.180) [-1996.673] (-2011.738) (-2009.861) * (-2006.648) (-2002.287) (-2004.920) [-1999.827] -- 0:03:54
      424000 -- [-2010.418] (-2002.549) (-2016.031) (-2001.845) * (-2008.546) [-2009.559] (-2006.638) (-2009.199) -- 0:03:53
      424500 -- (-2012.206) (-2004.332) (-2011.722) [-2013.784] * (-2025.073) [-1998.119] (-2008.695) (-2011.946) -- 0:03:53
      425000 -- (-2003.230) [-1998.608] (-1998.892) (-2009.519) * (-2007.498) [-2010.576] (-2002.767) (-2013.193) -- 0:03:52

      Average standard deviation of split frequencies: 0.014939

      425500 -- (-2004.736) (-2000.856) [-1998.227] (-2010.137) * (-2012.950) (-2011.288) [-2010.151] (-1997.408) -- 0:03:52
      426000 -- (-2006.275) (-1999.210) [-2000.135] (-2004.100) * (-2010.163) (-2007.568) (-2006.715) [-2001.567] -- 0:03:53
      426500 -- (-2002.751) (-2013.348) [-2003.805] (-2003.630) * (-2003.593) (-2012.063) (-2011.790) [-2001.031] -- 0:03:52
      427000 -- (-2010.324) [-2009.329] (-2008.434) (-2013.858) * [-1991.972] (-2005.873) (-2011.073) (-2001.689) -- 0:03:52
      427500 -- (-2005.277) (-2000.235) [-2002.592] (-2009.844) * (-2011.753) (-2002.283) (-2000.597) [-2000.428] -- 0:03:51
      428000 -- (-2006.874) (-2004.366) (-2008.769) [-2005.656] * (-2015.908) (-2003.431) (-2004.760) [-2002.498] -- 0:03:51
      428500 -- [-2003.350] (-2003.863) (-2000.389) (-2003.638) * (-2002.945) [-1996.913] (-2016.414) (-1996.219) -- 0:03:52
      429000 -- (-2021.627) (-2031.778) (-2003.777) [-2012.900] * (-2015.718) [-1998.861] (-2019.097) (-2002.031) -- 0:03:51
      429500 -- [-2004.294] (-1998.423) (-2006.067) (-2012.997) * (-2008.265) [-1989.368] (-2007.300) (-2003.603) -- 0:03:51
      430000 -- [-1996.701] (-2002.878) (-2004.273) (-2002.883) * (-2010.069) [-2000.043] (-2004.240) (-2002.355) -- 0:03:50

      Average standard deviation of split frequencies: 0.015530

      430500 -- [-2009.877] (-2005.327) (-2016.983) (-2004.084) * (-2001.728) (-2007.912) (-2010.317) [-2003.316] -- 0:03:50
      431000 -- (-2000.823) [-1996.989] (-2010.919) (-2006.855) * (-2010.924) [-2000.471] (-2001.234) (-2011.000) -- 0:03:49
      431500 -- (-2005.436) (-2021.058) (-2004.918) [-1998.873] * [-1993.397] (-1993.604) (-2011.244) (-2006.651) -- 0:03:50
      432000 -- (-1994.493) [-2018.764] (-2001.055) (-1993.405) * (-1993.226) (-2001.677) [-1998.920] (-2002.147) -- 0:03:50
      432500 -- [-2006.053] (-2003.777) (-2004.696) (-2003.386) * [-2003.217] (-2006.491) (-2006.831) (-2000.385) -- 0:03:49
      433000 -- [-1998.353] (-2005.425) (-2009.108) (-2002.947) * (-2002.327) (-1994.512) (-2008.542) [-2005.761] -- 0:03:49
      433500 -- (-2005.330) (-2003.488) [-2002.153] (-2007.007) * (-2008.004) (-2008.012) [-1997.364] (-2013.116) -- 0:03:48
      434000 -- (-2000.252) (-2009.264) [-2004.830] (-2008.978) * [-2002.654] (-2004.598) (-2003.517) (-2003.540) -- 0:03:49
      434500 -- [-1997.249] (-2004.172) (-2011.390) (-2013.336) * (-2007.678) (-1998.254) (-2010.245) [-1999.212] -- 0:03:49
      435000 -- (-2008.768) (-2002.557) [-1991.875] (-2009.272) * (-2009.451) (-2012.944) [-2004.265] (-2011.841) -- 0:03:48

      Average standard deviation of split frequencies: 0.015069

      435500 -- (-2007.552) [-1998.143] (-2005.096) (-2000.686) * (-2006.980) [-2012.899] (-2000.078) (-2012.979) -- 0:03:48
      436000 -- (-2004.206) (-2008.143) [-1997.578] (-2003.175) * (-2006.098) (-2018.165) [-2000.317] (-2008.942) -- 0:03:47
      436500 -- (-2017.966) (-2008.680) [-1997.959] (-2006.368) * (-2002.302) [-2008.675] (-2010.201) (-2011.067) -- 0:03:48
      437000 -- (-1997.448) (-2002.779) [-2002.968] (-2010.645) * (-2006.395) (-2012.695) (-2001.108) [-1998.721] -- 0:03:48
      437500 -- (-2015.480) (-2003.105) [-2000.959] (-2001.254) * (-2010.571) (-2018.867) (-2007.833) [-2003.808] -- 0:03:47
      438000 -- [-2010.836] (-1998.793) (-2006.432) (-2003.170) * (-2009.881) (-2026.632) (-2006.380) [-2001.755] -- 0:03:47
      438500 -- (-2007.972) [-2004.714] (-2001.498) (-2007.034) * [-2003.469] (-2014.631) (-2017.876) (-1999.927) -- 0:03:47
      439000 -- (-2009.635) (-1999.535) [-2001.399] (-2006.933) * (-1998.910) (-2006.948) [-2010.751] (-1998.657) -- 0:03:47
      439500 -- (-2002.254) (-2003.282) (-2010.502) [-2014.383] * (-2007.169) [-1999.392] (-2024.772) (-2008.032) -- 0:03:47
      440000 -- (-1999.238) (-2005.442) [-2006.420] (-2005.217) * [-1996.934] (-2001.876) (-2011.011) (-2007.863) -- 0:03:46

      Average standard deviation of split frequencies: 0.014709

      440500 -- [-2006.162] (-2001.099) (-2007.045) (-2000.788) * (-1999.926) (-2011.606) [-2013.665] (-1998.930) -- 0:03:46
      441000 -- [-2004.343] (-2000.384) (-1997.427) (-2002.456) * [-2011.009] (-2002.689) (-2012.982) (-2008.136) -- 0:03:46
      441500 -- (-2018.461) (-2024.840) (-2011.159) [-2009.448] * (-2006.724) (-2014.519) (-2004.623) [-2001.800] -- 0:03:46
      442000 -- [-1999.542] (-2008.125) (-2012.607) (-2004.305) * (-1999.234) (-2010.554) (-2015.583) [-1999.671] -- 0:03:45
      442500 -- (-2019.497) (-2005.990) (-2009.366) [-2001.188] * (-2003.237) (-2005.370) (-2011.850) [-2002.197] -- 0:03:45
      443000 -- (-2020.918) (-2019.457) [-2009.349] (-2012.828) * [-2001.056] (-2010.062) (-2009.542) (-2001.269) -- 0:03:45
      443500 -- (-2011.321) [-2004.193] (-2005.167) (-2003.307) * (-1998.225) (-1998.417) [-1999.101] (-2005.305) -- 0:03:45
      444000 -- (-2000.209) (-2012.083) [-2006.525] (-2004.725) * (-2004.056) [-1994.426] (-2008.309) (-2009.205) -- 0:03:45
      444500 -- (-2005.302) (-2014.967) [-1996.329] (-2006.619) * (-2014.591) (-2011.222) (-2005.322) [-2000.915] -- 0:03:44
      445000 -- (-2002.663) (-2013.503) (-2001.415) [-2008.765] * (-1999.994) (-2005.601) (-2012.689) [-1998.497] -- 0:03:44

      Average standard deviation of split frequencies: 0.014137

      445500 -- (-2010.654) (-2011.339) [-1998.360] (-2013.880) * (-2016.675) [-2001.152] (-1998.290) (-2011.812) -- 0:03:45
      446000 -- [-2005.163] (-2005.686) (-2007.796) (-2004.379) * [-1993.289] (-2011.063) (-1994.543) (-2013.221) -- 0:03:44
      446500 -- (-2007.813) (-2010.848) [-2003.906] (-2010.058) * (-2002.041) [-1991.944] (-2013.617) (-2009.999) -- 0:03:44
      447000 -- (-2002.807) [-1997.204] (-2011.019) (-2008.487) * (-2003.230) [-2007.484] (-2013.101) (-2006.551) -- 0:03:43
      447500 -- (-1995.072) [-2000.356] (-2006.904) (-2022.978) * (-2002.559) (-2005.975) [-2000.807] (-2003.400) -- 0:03:43
      448000 -- [-2001.879] (-2001.669) (-2010.800) (-2013.278) * (-2006.165) (-1998.759) (-2007.555) [-1996.689] -- 0:03:44
      448500 -- (-2007.299) [-2001.410] (-2010.432) (-2013.412) * [-2009.230] (-2006.800) (-2010.134) (-2005.118) -- 0:03:43
      449000 -- (-2007.952) (-2001.891) (-2001.655) [-2010.214] * (-2011.419) [-1999.037] (-2016.552) (-2012.577) -- 0:03:43
      449500 -- [-2008.283] (-1995.990) (-2004.076) (-2005.633) * [-2013.904] (-1997.835) (-2008.954) (-2010.284) -- 0:03:42
      450000 -- (-2010.931) (-2003.569) (-2009.165) [-2000.146] * (-2016.346) [-2000.355] (-2011.372) (-2000.110) -- 0:03:42

      Average standard deviation of split frequencies: 0.013925

      450500 -- (-1997.657) (-2006.524) (-2005.359) [-2005.170] * [-1999.432] (-2001.448) (-2014.404) (-2005.968) -- 0:03:43
      451000 -- (-2010.517) (-2009.693) (-2010.655) [-2003.404] * (-2006.214) [-1995.311] (-2010.487) (-2004.342) -- 0:03:42
      451500 -- [-2008.894] (-2007.914) (-2006.883) (-2003.299) * [-2001.961] (-1999.908) (-2014.247) (-2020.744) -- 0:03:42
      452000 -- (-2012.681) (-2001.969) (-2001.229) [-2005.233] * (-2013.202) (-2005.519) [-2003.180] (-2008.354) -- 0:03:41
      452500 -- (-2008.902) (-2002.714) (-2005.598) [-2001.677] * (-2005.495) (-2003.391) [-2001.863] (-2006.452) -- 0:03:41
      453000 -- (-2012.349) [-2006.445] (-2007.584) (-2005.715) * (-2000.611) (-2010.269) (-2007.453) [-2019.074] -- 0:03:42
      453500 -- [-2002.787] (-2003.794) (-2007.313) (-2009.728) * [-2015.488] (-2001.023) (-2008.520) (-2012.136) -- 0:03:41
      454000 -- [-2000.097] (-2003.849) (-1999.045) (-2008.403) * (-2002.308) (-2004.034) (-2016.547) [-2004.841] -- 0:03:41
      454500 -- [-2001.879] (-1997.442) (-2001.580) (-2000.264) * (-2011.690) (-2016.296) (-2019.601) [-1993.249] -- 0:03:40
      455000 -- (-2003.401) [-2000.100] (-2000.595) (-2016.722) * (-2009.132) [-2009.544] (-1996.858) (-2006.403) -- 0:03:40

      Average standard deviation of split frequencies: 0.013827

      455500 -- [-2008.519] (-2000.629) (-2010.300) (-2008.925) * [-2015.781] (-2002.389) (-2000.028) (-1999.589) -- 0:03:41
      456000 -- (-2006.845) (-2001.004) (-2002.000) [-1992.565] * (-2006.505) [-1996.232] (-1999.987) (-2004.774) -- 0:03:40
      456500 -- (-2001.813) (-2004.543) [-2000.163] (-2009.335) * (-2015.309) (-2003.404) [-2013.476] (-2006.601) -- 0:03:40
      457000 -- (-2008.253) (-2030.295) [-2005.602] (-2002.015) * (-2012.776) [-1998.108] (-2016.873) (-2002.947) -- 0:03:39
      457500 -- (-2008.922) (-2019.786) (-2010.401) [-2004.562] * (-2022.315) (-1994.331) (-2016.700) [-2006.399] -- 0:03:39
      458000 -- (-2010.107) [-2008.225] (-2004.191) (-2004.488) * (-2009.346) (-2007.510) [-2000.877] (-2015.174) -- 0:03:40
      458500 -- (-2002.570) (-2011.547) (-2008.016) [-2001.544] * (-2009.532) [-2008.522] (-2008.154) (-2007.223) -- 0:03:39
      459000 -- [-2005.797] (-2010.820) (-2010.645) (-2000.644) * (-2006.524) (-2008.723) [-2001.158] (-2003.854) -- 0:03:39
      459500 -- (-2005.974) (-2010.167) [-1999.457] (-2015.362) * (-2003.444) (-2020.347) [-1995.276] (-2002.004) -- 0:03:38
      460000 -- [-2011.886] (-2004.099) (-1999.310) (-2010.847) * (-2001.891) (-2011.977) (-1998.209) [-2001.699] -- 0:03:38

      Average standard deviation of split frequencies: 0.013367

      460500 -- (-2001.487) [-2006.554] (-1998.983) (-2002.523) * (-2010.280) (-2003.402) [-2000.868] (-1991.976) -- 0:03:39
      461000 -- (-2012.462) [-1991.702] (-2013.747) (-2008.850) * (-2011.269) (-2002.889) (-2007.889) [-2004.037] -- 0:03:38
      461500 -- (-2006.566) [-1995.305] (-1996.254) (-2010.816) * (-1998.585) [-1999.281] (-2017.976) (-2001.524) -- 0:03:38
      462000 -- (-2002.966) (-1998.004) (-2018.502) [-1999.996] * (-2022.578) [-1999.150] (-2013.935) (-2000.110) -- 0:03:37
      462500 -- (-2007.578) [-2005.518] (-2004.875) (-2002.885) * (-2023.074) [-2000.572] (-2019.398) (-2009.189) -- 0:03:37
      463000 -- (-2013.494) [-2005.818] (-2029.325) (-2007.703) * (-2003.993) [-2003.751] (-2005.742) (-2009.149) -- 0:03:38
      463500 -- [-2006.035] (-1996.221) (-2007.804) (-2003.705) * (-2018.749) [-2000.696] (-2000.564) (-1996.183) -- 0:03:37
      464000 -- (-2012.912) (-2016.957) (-2005.943) [-2003.681] * (-2001.363) [-1999.557] (-1999.882) (-2005.531) -- 0:03:37
      464500 -- (-2006.615) (-2007.191) [-2006.704] (-2001.521) * (-2013.033) (-2013.682) [-2003.236] (-2007.686) -- 0:03:36
      465000 -- (-2012.549) (-2014.452) [-2006.730] (-2009.852) * (-2014.260) (-2000.747) (-2010.151) [-2009.792] -- 0:03:37

      Average standard deviation of split frequencies: 0.013404

      465500 -- (-2000.436) (-2005.296) [-2005.752] (-2005.178) * (-1993.169) [-2000.354] (-2003.397) (-2002.736) -- 0:03:37
      466000 -- (-2012.699) (-2002.869) [-2008.167] (-1999.379) * [-1994.681] (-1998.723) (-2014.720) (-2005.186) -- 0:03:36
      466500 -- (-1998.736) (-2005.790) (-2015.408) [-1997.598] * [-2009.112] (-1999.427) (-2007.118) (-2007.253) -- 0:03:36
      467000 -- (-2004.369) (-2014.313) [-2005.540] (-2006.659) * (-2006.030) (-2008.499) (-2015.241) [-2001.034] -- 0:03:35
      467500 -- [-2004.843] (-2012.426) (-2012.720) (-1998.549) * (-2007.329) (-2011.254) [-2003.537] (-1996.928) -- 0:03:36
      468000 -- [-1998.311] (-2000.252) (-2011.332) (-2002.510) * (-2006.200) (-2004.524) (-2007.447) [-1996.255] -- 0:03:35
      468500 -- (-2004.935) (-2000.396) (-2006.909) [-2002.472] * (-2005.800) [-2004.257] (-2004.265) (-2003.743) -- 0:03:35
      469000 -- [-1994.380] (-2005.954) (-2019.153) (-2002.365) * (-2008.006) [-1998.892] (-2004.812) (-2003.469) -- 0:03:35
      469500 -- (-2010.107) (-2008.349) (-2004.301) [-1992.543] * [-2004.974] (-1997.707) (-1995.454) (-2002.210) -- 0:03:34
      470000 -- [-2005.770] (-1999.211) (-2013.486) (-1999.945) * (-2009.946) [-2004.683] (-2018.904) (-2013.245) -- 0:03:35

      Average standard deviation of split frequencies: 0.012961

      470500 -- (-2010.376) (-2005.307) (-2001.361) [-2000.014] * (-2004.920) (-2008.597) [-2006.703] (-2002.204) -- 0:03:34
      471000 -- (-2009.605) [-2002.938] (-2011.052) (-1999.621) * [-1996.884] (-2014.356) (-2011.815) (-2005.575) -- 0:03:34
      471500 -- (-2005.865) (-2012.838) (-1997.285) [-2008.511] * [-2002.332] (-2012.491) (-2005.546) (-2006.182) -- 0:03:34
      472000 -- [-1997.715] (-2013.146) (-1999.525) (-2012.590) * (-1999.314) (-2017.977) [-1996.770] (-2014.875) -- 0:03:33
      472500 -- [-2001.119] (-2013.531) (-2009.608) (-2018.193) * (-2002.264) [-2003.644] (-2003.726) (-2017.177) -- 0:03:34
      473000 -- (-2011.765) (-2015.748) (-2001.397) [-2001.223] * (-2011.747) (-2010.008) (-1993.903) [-2009.149] -- 0:03:33
      473500 -- (-2008.685) [-2005.382] (-2003.478) (-1996.086) * [-2010.184] (-2014.087) (-1999.326) (-2017.329) -- 0:03:33
      474000 -- (-2016.649) (-2018.386) (-2013.577) [-2008.870] * (-2007.190) (-2021.909) (-2000.945) [-1999.084] -- 0:03:33
      474500 -- [-2001.532] (-2011.727) (-2009.651) (-2015.856) * (-2009.216) (-2001.424) (-2022.849) [-2006.812] -- 0:03:32
      475000 -- [-2003.931] (-2005.124) (-2009.710) (-1995.295) * (-2000.742) (-2008.923) (-2019.560) [-2004.994] -- 0:03:33

      Average standard deviation of split frequencies: 0.013989

      475500 -- [-2002.560] (-2009.609) (-2012.227) (-1999.649) * (-2015.000) (-2006.977) [-2005.655] (-2006.638) -- 0:03:32
      476000 -- (-2002.083) (-2012.103) (-2005.441) [-1998.277] * (-2004.408) (-1994.558) (-2006.406) [-1999.261] -- 0:03:32
      476500 -- (-2014.196) (-2011.137) (-2001.749) [-1999.791] * (-2007.949) [-1999.528] (-2007.832) (-2013.466) -- 0:03:32
      477000 -- (-2019.365) (-1997.394) (-2000.393) [-2010.689] * (-2015.736) [-1998.214] (-2007.209) (-2007.824) -- 0:03:31
      477500 -- (-2024.042) [-2000.601] (-2015.907) (-2009.348) * (-2008.164) (-1999.600) [-2008.992] (-1998.636) -- 0:03:32
      478000 -- [-2010.040] (-2000.764) (-2015.626) (-2015.176) * [-2001.468] (-2013.465) (-2012.179) (-2006.689) -- 0:03:31
      478500 -- [-2000.160] (-1998.255) (-2002.425) (-2012.246) * (-2008.084) [-2007.689] (-2005.428) (-2020.022) -- 0:03:31
      479000 -- (-2009.782) [-1999.137] (-1995.783) (-2009.396) * (-2006.656) [-2006.917] (-2001.089) (-2007.158) -- 0:03:31
      479500 -- [-2005.322] (-2003.514) (-2006.058) (-2009.737) * (-1999.084) [-2006.464] (-2001.923) (-2011.165) -- 0:03:30
      480000 -- (-2008.981) (-2004.662) [-2001.077] (-2009.128) * [-2008.823] (-2010.248) (-2010.545) (-2012.952) -- 0:03:31

      Average standard deviation of split frequencies: 0.014404

      480500 -- [-1998.278] (-1995.132) (-1999.029) (-2013.610) * (-2005.836) [-2009.190] (-2012.431) (-2007.195) -- 0:03:30
      481000 -- (-2003.795) (-2017.211) [-1996.452] (-2008.053) * (-2010.034) (-1999.613) [-2003.654] (-2016.816) -- 0:03:30
      481500 -- (-1997.386) (-2010.645) (-2001.739) [-2003.765] * (-2001.844) [-1999.597] (-2008.286) (-2012.832) -- 0:03:29
      482000 -- (-2009.025) (-2013.672) [-1999.351] (-2009.469) * [-2007.326] (-2000.982) (-1995.489) (-2019.653) -- 0:03:30
      482500 -- [-2003.920] (-2008.156) (-2004.732) (-2005.513) * (-2005.629) (-2008.459) [-2007.777] (-2020.182) -- 0:03:30
      483000 -- (-2005.921) [-1997.940] (-2011.133) (-2021.697) * (-2002.366) (-2007.456) [-2004.884] (-2008.989) -- 0:03:29
      483500 -- (-2002.953) (-2002.794) [-1996.711] (-2000.772) * (-2010.424) (-2002.094) (-2003.756) [-2009.725] -- 0:03:29
      484000 -- [-2003.772] (-2002.812) (-2000.026) (-2002.684) * (-2004.906) (-2003.027) (-2003.934) [-2008.354] -- 0:03:28
      484500 -- (-2006.316) (-2003.854) (-2002.044) [-2000.692] * [-2011.280] (-2008.980) (-1998.615) (-1999.424) -- 0:03:29
      485000 -- (-2007.982) (-2004.081) (-2011.638) [-1999.988] * (-2005.197) [-1997.005] (-2017.811) (-2009.220) -- 0:03:29

      Average standard deviation of split frequencies: 0.013640

      485500 -- [-1996.650] (-2007.881) (-2000.153) (-2000.228) * (-2009.033) (-2016.856) (-2006.665) [-2001.708] -- 0:03:28
      486000 -- (-2006.769) (-2007.869) (-2004.170) [-1993.704] * [-2004.377] (-2002.473) (-2010.564) (-2006.064) -- 0:03:28
      486500 -- (-2008.179) [-2015.147] (-2009.757) (-2013.140) * (-2007.637) [-2011.126] (-2004.961) (-2002.120) -- 0:03:27
      487000 -- [-1995.583] (-2005.440) (-2009.221) (-2007.618) * (-2004.715) (-2004.854) (-1999.376) [-2008.259] -- 0:03:28
      487500 -- (-2002.409) [-2001.188] (-2004.708) (-2001.627) * (-2002.528) [-1998.741] (-2011.030) (-2002.637) -- 0:03:28
      488000 -- (-2000.992) [-2000.852] (-2014.022) (-2001.746) * (-2007.355) [-2003.525] (-1993.926) (-2011.696) -- 0:03:27
      488500 -- (-2000.907) (-2008.891) (-2019.168) [-1999.504] * [-2003.165] (-2015.326) (-2002.534) (-2002.053) -- 0:03:27
      489000 -- [-1998.005] (-2000.556) (-2006.596) (-2002.388) * [-1999.585] (-2010.088) (-2009.793) (-2004.949) -- 0:03:26
      489500 -- (-2007.416) [-2011.630] (-2011.044) (-2004.682) * [-2005.493] (-2002.446) (-2015.547) (-2003.085) -- 0:03:27
      490000 -- (-2006.889) [-2013.192] (-1998.137) (-2005.586) * [-2001.029] (-1998.262) (-2005.117) (-1999.923) -- 0:03:27

      Average standard deviation of split frequencies: 0.014291

      490500 -- (-2003.451) [-2002.981] (-1999.980) (-1999.209) * (-2008.858) (-2000.732) [-2004.871] (-1993.621) -- 0:03:26
      491000 -- (-2016.842) (-2017.296) [-1992.795] (-1999.928) * (-2013.733) (-2004.572) [-2001.311] (-2000.086) -- 0:03:26
      491500 -- [-2002.511] (-2003.065) (-1999.006) (-2009.726) * (-2007.136) [-1996.736] (-2008.050) (-2001.615) -- 0:03:25
      492000 -- (-2001.290) [-2010.292] (-2012.328) (-2013.545) * (-1999.084) (-2004.937) (-2016.769) [-2000.314] -- 0:03:26
      492500 -- (-2004.218) (-2015.050) [-1999.071] (-2011.648) * (-2000.288) (-1999.542) [-1997.223] (-2004.099) -- 0:03:26
      493000 -- (-2000.008) (-2008.463) [-2011.058] (-2014.285) * [-1998.520] (-2013.191) (-2008.255) (-2007.016) -- 0:03:25
      493500 -- (-2008.061) (-2015.634) (-2014.241) [-2015.868] * [-1997.980] (-2006.680) (-2000.777) (-2018.328) -- 0:03:25
      494000 -- [-2010.543] (-2013.740) (-2004.988) (-2000.201) * (-2010.304) (-2005.110) [-2011.083] (-2033.281) -- 0:03:24
      494500 -- (-2004.175) (-2005.875) [-2009.490] (-2003.138) * (-2004.971) [-1999.556] (-2015.670) (-2006.285) -- 0:03:25
      495000 -- (-2004.313) (-2005.924) (-2004.746) [-2000.560] * (-2016.999) (-2003.227) [-2002.728] (-2001.390) -- 0:03:25

      Average standard deviation of split frequencies: 0.014434

      495500 -- [-2003.193] (-2004.141) (-2002.408) (-2016.183) * (-1999.872) [-2004.637] (-2001.602) (-2015.906) -- 0:03:24
      496000 -- [-2000.078] (-2021.119) (-1995.938) (-2008.523) * (-2008.682) [-1994.511] (-2017.771) (-2011.210) -- 0:03:24
      496500 -- (-2011.932) (-2019.516) (-2002.774) [-2002.968] * [-2007.016] (-2016.876) (-2005.456) (-2005.350) -- 0:03:23
      497000 -- (-2006.896) (-2008.046) [-2003.211] (-2001.788) * (-2013.534) (-2004.097) [-1996.132] (-2015.785) -- 0:03:24
      497500 -- [-2008.816] (-2009.041) (-2004.850) (-2007.671) * (-2006.459) (-2014.971) [-1997.057] (-2023.963) -- 0:03:24
      498000 -- (-1994.092) (-2010.083) [-2002.403] (-2004.201) * (-2003.617) [-2005.424] (-2006.620) (-2001.230) -- 0:03:23
      498500 -- (-2003.110) (-2009.533) [-2009.090] (-2001.374) * (-2010.188) (-2003.364) (-2005.422) [-1995.390] -- 0:03:23
      499000 -- (-1990.967) (-2019.128) (-2006.145) [-2003.279] * (-2012.055) [-1999.202] (-2014.213) (-2010.609) -- 0:03:22
      499500 -- (-1998.570) (-2005.631) [-1996.916] (-2012.880) * (-2007.512) [-2006.099] (-2013.239) (-2012.527) -- 0:03:23
      500000 -- [-1993.546] (-1999.616) (-2008.270) (-2014.136) * [-2000.365] (-2009.212) (-2003.463) (-2022.139) -- 0:03:23

      Average standard deviation of split frequencies: 0.014947

      500500 -- (-1996.144) [-1992.175] (-2009.097) (-2024.439) * (-2008.872) [-2000.480] (-2001.223) (-2005.197) -- 0:03:22
      501000 -- (-2001.711) [-2002.756] (-2008.990) (-2004.948) * (-2012.249) [-1997.884] (-2012.735) (-2005.195) -- 0:03:22
      501500 -- (-2006.116) (-2027.183) [-2009.027] (-2003.825) * (-2002.334) [-2012.726] (-2012.200) (-2004.139) -- 0:03:21
      502000 -- (-1996.990) [-1997.519] (-2006.086) (-2001.636) * (-2000.837) (-2016.073) [-2006.083] (-2016.370) -- 0:03:22
      502500 -- (-2007.464) (-2001.924) (-2007.698) [-2004.126] * (-2002.306) (-2008.386) (-2022.372) [-2005.826] -- 0:03:21
      503000 -- [-1999.930] (-2007.495) (-2020.455) (-1996.415) * (-2001.553) (-2006.653) (-2037.050) [-2003.683] -- 0:03:21
      503500 -- (-1995.578) (-2006.408) (-2007.939) [-1997.971] * (-2011.801) [-2004.351] (-2038.096) (-2004.647) -- 0:03:21
      504000 -- [-1995.651] (-2006.564) (-2007.948) (-2011.085) * (-2011.571) [-2001.357] (-2017.386) (-2001.456) -- 0:03:20
      504500 -- (-2005.945) (-2006.870) [-2005.043] (-1999.086) * [-2007.116] (-2007.175) (-2022.684) (-2004.189) -- 0:03:21
      505000 -- (-1999.904) (-2009.145) [-1993.984] (-1999.661) * (-2015.126) [-2004.423] (-2004.207) (-2010.275) -- 0:03:20

      Average standard deviation of split frequencies: 0.015081

      505500 -- [-2000.579] (-2004.604) (-2008.675) (-2000.682) * (-2020.508) (-2003.466) [-1998.887] (-2006.068) -- 0:03:20
      506000 -- (-2007.961) (-2008.739) [-2005.973] (-1996.584) * [-2003.926] (-2003.280) (-2000.542) (-2005.179) -- 0:03:20
      506500 -- (-2007.242) (-2001.567) [-1994.464] (-2003.616) * (-2008.993) [-1999.072] (-1995.700) (-1996.407) -- 0:03:19
      507000 -- (-2010.113) [-1998.142] (-2006.580) (-2013.804) * (-2002.287) [-2004.230] (-2003.349) (-2015.951) -- 0:03:20
      507500 -- [-2000.917] (-2009.434) (-2005.822) (-2009.587) * (-2006.404) [-2006.401] (-2010.149) (-2001.907) -- 0:03:19
      508000 -- (-2011.466) (-1999.982) (-2012.452) [-2003.440] * (-2011.054) (-2007.031) [-2002.782] (-2010.635) -- 0:03:19
      508500 -- (-2004.770) [-2000.350] (-2006.403) (-2002.263) * (-1998.200) (-2003.922) (-2011.268) [-2000.599] -- 0:03:19
      509000 -- (-2011.093) (-2011.970) (-2017.265) [-1996.802] * (-1999.680) [-1995.958] (-2013.467) (-2007.818) -- 0:03:18
      509500 -- [-1999.088] (-2006.937) (-2014.639) (-1998.934) * (-2014.356) (-2014.391) (-2006.012) [-2007.937] -- 0:03:19
      510000 -- (-2007.085) (-2013.764) [-2007.377] (-2002.269) * (-2003.563) (-2002.849) [-2003.123] (-1996.615) -- 0:03:18

      Average standard deviation of split frequencies: 0.014654

      510500 -- (-2007.565) [-1998.670] (-2009.124) (-2006.709) * (-1999.023) (-2007.261) [-2012.613] (-2003.892) -- 0:03:18
      511000 -- (-1999.671) [-2000.589] (-2003.628) (-2006.141) * (-2006.191) (-2009.190) (-2006.235) [-1992.888] -- 0:03:18
      511500 -- [-2006.392] (-2005.568) (-2001.034) (-2017.239) * (-2012.182) (-2011.107) (-2009.122) [-1995.323] -- 0:03:17
      512000 -- [-2005.118] (-2016.391) (-2010.888) (-2011.139) * (-2008.589) (-2008.514) (-2000.604) [-1998.951] -- 0:03:18
      512500 -- (-2000.652) (-2000.006) (-2005.773) [-2012.707] * (-2021.598) (-2006.615) (-2006.552) [-2010.041] -- 0:03:17
      513000 -- (-2020.645) (-1999.780) (-2003.955) [-2007.102] * (-2028.105) (-2007.209) (-2019.946) [-1997.141] -- 0:03:17
      513500 -- (-1999.829) (-2009.873) (-2012.870) [-2000.570] * (-2010.562) (-2009.130) (-2005.583) [-2014.116] -- 0:03:17
      514000 -- [-2003.661] (-2003.059) (-2009.080) (-2004.444) * (-2003.588) (-2014.126) [-2002.405] (-2002.069) -- 0:03:17
      514500 -- (-2005.245) (-2015.435) (-2007.858) [-2002.195] * (-2003.156) (-1997.070) (-2010.593) [-1996.986] -- 0:03:17
      515000 -- [-2005.688] (-2014.139) (-1994.219) (-2000.836) * (-2000.128) [-1999.751] (-2004.966) (-2007.527) -- 0:03:16

      Average standard deviation of split frequencies: 0.013972

      515500 -- (-2003.558) [-1998.990] (-1998.796) (-2003.699) * (-2011.894) (-2004.770) (-2010.380) [-1996.306] -- 0:03:16
      516000 -- [-2007.976] (-2005.500) (-1999.849) (-2004.006) * (-2007.396) (-2010.556) (-1997.844) [-2005.370] -- 0:03:16
      516500 -- (-2015.016) [-2005.313] (-2000.977) (-2005.178) * (-2002.255) (-2006.140) (-2004.195) [-2002.314] -- 0:03:16
      517000 -- (-2010.019) (-2007.169) (-2004.549) [-2001.796] * (-2003.067) (-2007.459) [-2001.739] (-2012.222) -- 0:03:16
      517500 -- [-2009.451] (-2002.418) (-2002.488) (-2010.255) * [-2003.672] (-2005.499) (-2003.873) (-2014.856) -- 0:03:15
      518000 -- (-2021.107) (-2003.590) [-1999.544] (-2000.661) * (-2012.770) (-2006.285) (-1998.827) [-1995.540] -- 0:03:15
      518500 -- [-2009.257] (-2014.414) (-2001.181) (-2001.327) * (-2008.407) (-2007.787) [-2007.741] (-1997.346) -- 0:03:15
      519000 -- (-2014.228) (-2005.960) (-2003.688) [-2004.872] * (-2008.636) (-2015.856) (-2005.543) [-2000.232] -- 0:03:15
      519500 -- (-2017.708) (-2000.768) (-2007.853) [-2002.384] * [-2003.336] (-2013.884) (-2005.282) (-1997.691) -- 0:03:15
      520000 -- (-2009.604) (-1999.281) [-2001.058] (-2006.589) * [-2002.764] (-1997.812) (-1999.048) (-1999.573) -- 0:03:14

      Average standard deviation of split frequencies: 0.013807

      520500 -- (-2012.593) [-1999.480] (-2010.102) (-2007.401) * (-2013.177) (-2016.156) [-2011.579] (-2018.029) -- 0:03:14
      521000 -- (-2017.361) (-2009.854) [-2006.721] (-2007.405) * (-2024.546) (-2008.409) (-2002.964) [-1996.719] -- 0:03:13
      521500 -- (-2007.763) (-2002.806) [-2004.083] (-1994.736) * (-2002.625) [-2004.865] (-2000.475) (-2007.467) -- 0:03:14
      522000 -- (-2005.679) [-2000.274] (-2015.047) (-2000.732) * (-2000.676) (-2014.834) (-2012.057) [-1997.165] -- 0:03:14
      522500 -- [-1999.633] (-2009.716) (-2002.923) (-1995.908) * (-1996.421) (-2007.814) (-2006.748) [-1998.867] -- 0:03:13
      523000 -- (-2006.710) (-2007.587) (-2009.909) [-1999.182] * (-2000.078) (-2001.484) [-2002.607] (-2002.694) -- 0:03:13
      523500 -- (-2010.839) (-2018.269) (-2003.107) [-2005.136] * (-2002.877) (-2004.500) [-1995.455] (-2004.678) -- 0:03:12
      524000 -- (-2001.682) (-2010.395) (-2004.882) [-2001.701] * (-2013.404) (-2013.450) [-2015.604] (-2000.968) -- 0:03:13
      524500 -- (-2013.663) (-2005.655) [-1999.298] (-2003.802) * (-1998.530) [-1999.786] (-2007.022) (-2007.357) -- 0:03:13
      525000 -- (-2007.279) (-2005.755) [-2006.084] (-1996.045) * (-2013.283) [-1997.265] (-2013.874) (-2005.238) -- 0:03:12

      Average standard deviation of split frequencies: 0.014227

      525500 -- (-2016.689) (-2006.936) (-2009.114) [-2006.843] * (-2002.414) [-1995.528] (-2006.881) (-2009.656) -- 0:03:12
      526000 -- (-2007.536) [-2004.008] (-2018.401) (-2005.369) * (-2006.254) (-2002.143) (-2010.661) [-2007.680] -- 0:03:11
      526500 -- (-1999.763) [-2001.218] (-2013.404) (-2005.429) * [-1996.798] (-2003.714) (-2008.633) (-2012.528) -- 0:03:12
      527000 -- (-2023.672) (-2013.752) (-2006.265) [-2001.538] * (-2002.026) [-2008.485] (-2003.897) (-2008.276) -- 0:03:12
      527500 -- (-2003.301) (-2000.823) (-2002.643) [-2006.284] * (-2009.052) (-2012.748) (-2004.495) [-1999.649] -- 0:03:11
      528000 -- (-2012.978) [-1995.716] (-2006.089) (-1997.795) * (-2021.784) (-2005.804) (-2005.954) [-2004.294] -- 0:03:11
      528500 -- (-2002.262) (-2015.019) (-2013.217) [-1999.553] * (-2008.701) [-2011.401] (-2001.279) (-2018.329) -- 0:03:10
      529000 -- (-2008.475) (-2011.414) (-2003.048) [-1999.496] * [-2012.451] (-2010.341) (-2001.339) (-2001.237) -- 0:03:11
      529500 -- [-2004.783] (-2005.601) (-2003.963) (-2006.071) * [-2003.616] (-2007.726) (-1999.953) (-2007.000) -- 0:03:11
      530000 -- [-2000.644] (-2008.357) (-2011.066) (-1998.563) * (-2001.398) (-2011.651) (-2003.716) [-2011.648] -- 0:03:10

      Average standard deviation of split frequencies: 0.014768

      530500 -- (-2008.173) (-2002.708) (-2015.225) [-1998.999] * (-2009.298) [-2004.523] (-2010.127) (-2004.387) -- 0:03:10
      531000 -- (-2001.102) (-2008.335) (-2019.033) [-2000.315] * (-2011.949) (-1998.693) [-2007.230] (-2005.220) -- 0:03:09
      531500 -- (-2003.315) [-2007.352] (-2011.499) (-2006.090) * [-2002.368] (-2005.696) (-2003.505) (-2007.631) -- 0:03:10
      532000 -- [-1998.382] (-2010.363) (-2026.298) (-2001.710) * (-2008.263) [-1996.768] (-2005.543) (-2007.862) -- 0:03:10
      532500 -- (-2010.231) (-2000.405) (-2007.765) [-1998.247] * [-2001.911] (-2005.071) (-1997.780) (-2008.813) -- 0:03:09
      533000 -- (-1997.830) [-1997.090] (-2018.386) (-2010.672) * (-2006.479) [-2002.192] (-2007.040) (-2011.184) -- 0:03:09
      533500 -- [-2001.202] (-2005.181) (-2007.256) (-1998.170) * (-1999.726) (-2001.955) [-2006.371] (-2003.595) -- 0:03:08
      534000 -- [-1994.426] (-2015.395) (-1996.516) (-2005.415) * [-2002.894] (-1999.080) (-2010.738) (-2005.113) -- 0:03:09
      534500 -- (-2006.572) (-2016.469) (-1999.610) [-2001.877] * (-2008.121) (-2006.017) (-2009.021) [-2000.526] -- 0:03:08
      535000 -- (-2009.972) (-2012.253) [-2008.756] (-2006.058) * (-2012.023) (-2008.496) [-1997.540] (-1996.527) -- 0:03:08

      Average standard deviation of split frequencies: 0.015171

      535500 -- (-2019.659) (-2006.286) (-2007.142) [-2012.939] * (-1999.851) [-1998.924] (-2002.735) (-2003.782) -- 0:03:08
      536000 -- [-2013.807] (-2008.484) (-1999.071) (-2018.155) * (-2008.391) (-1995.240) (-2009.985) [-2004.706] -- 0:03:08
      536500 -- (-2005.814) [-2004.420] (-1996.844) (-2024.495) * [-2007.403] (-1997.590) (-2009.025) (-2009.724) -- 0:03:08
      537000 -- (-1999.137) (-2009.914) [-2003.968] (-2011.013) * (-2020.745) (-1997.682) [-2001.772] (-1996.123) -- 0:03:07
      537500 -- (-2002.617) (-2009.079) [-2005.930] (-2007.311) * (-2017.327) [-2001.596] (-2009.326) (-2004.894) -- 0:03:07
      538000 -- [-2004.115] (-2017.897) (-2005.786) (-2005.601) * (-2005.162) (-1995.561) [-2004.339] (-2008.596) -- 0:03:07
      538500 -- [-2004.612] (-2014.651) (-2008.506) (-2002.682) * [-2005.121] (-2000.142) (-2006.966) (-2008.588) -- 0:03:07
      539000 -- [-2001.821] (-2013.445) (-2003.327) (-2006.443) * (-2007.242) (-2021.210) [-1994.391] (-2007.807) -- 0:03:07
      539500 -- (-2004.708) [-1999.151] (-2005.959) (-2005.058) * (-2021.626) (-2016.555) [-2000.951] (-1999.940) -- 0:03:06
      540000 -- [-1996.456] (-2006.033) (-2004.659) (-2003.262) * (-2014.000) (-2004.323) (-1998.027) [-2000.649] -- 0:03:06

      Average standard deviation of split frequencies: 0.015040

      540500 -- (-2008.893) (-2006.026) (-2013.497) [-2004.617] * (-2015.215) [-2000.369] (-2011.525) (-2005.752) -- 0:03:06
      541000 -- (-2010.775) (-2008.120) (-2001.983) [-2012.074] * (-2011.527) (-2002.434) (-2006.215) [-1998.238] -- 0:03:06
      541500 -- [-1997.487] (-2006.017) (-2005.030) (-2012.060) * (-2009.366) (-2005.716) [-1998.237] (-1993.745) -- 0:03:06
      542000 -- (-2002.930) (-2003.563) (-2004.261) [-2003.753] * (-1999.884) [-1998.124] (-2003.669) (-2006.782) -- 0:03:05
      542500 -- [-2001.291] (-2000.911) (-2014.504) (-2004.361) * (-2004.622) (-2007.383) (-2006.549) [-2005.331] -- 0:03:05
      543000 -- (-2001.876) [-2000.116] (-2034.359) (-2015.463) * [-2007.739] (-2000.160) (-2007.328) (-2011.942) -- 0:03:05
      543500 -- (-2012.143) (-1998.918) (-2010.720) [-1997.521] * (-2015.209) [-1998.645] (-2013.165) (-2008.115) -- 0:03:05
      544000 -- [-2001.190] (-2003.322) (-2008.903) (-2006.735) * (-2011.792) (-2010.007) [-1995.362] (-2009.693) -- 0:03:05
      544500 -- (-2007.247) [-2007.386] (-2010.226) (-2010.098) * (-2026.447) (-2005.802) (-2005.335) [-2001.215] -- 0:03:04
      545000 -- [-2006.883] (-2013.672) (-2006.059) (-2001.557) * [-2011.996] (-2008.035) (-2006.208) (-2002.482) -- 0:03:04

      Average standard deviation of split frequencies: 0.015271

      545500 -- (-1996.265) (-2009.281) [-2003.309] (-2007.377) * [-1998.226] (-2008.826) (-2000.536) (-2008.117) -- 0:03:04
      546000 -- (-2018.497) [-2005.840] (-2004.539) (-2006.150) * (-2008.511) (-1999.548) (-2012.039) [-2006.236] -- 0:03:04
      546500 -- [-2007.573] (-2007.151) (-2012.895) (-2000.523) * [-1998.953] (-2000.104) (-2012.657) (-2010.277) -- 0:03:04
      547000 -- [-1999.662] (-2011.797) (-2005.781) (-2002.756) * (-2003.333) (-2013.408) [-1996.873] (-2004.474) -- 0:03:03
      547500 -- (-2002.441) (-2008.195) [-1999.034] (-2003.557) * (-2002.707) (-2003.317) (-2012.273) [-1999.898] -- 0:03:03
      548000 -- (-2011.836) (-2014.016) [-1994.040] (-2009.122) * (-1998.800) (-2000.609) (-2009.142) [-2001.560] -- 0:03:03
      548500 -- (-2005.613) (-2012.478) [-1993.117] (-1999.277) * (-1998.921) (-2002.716) [-1998.477] (-2000.013) -- 0:03:03
      549000 -- [-1999.897] (-2007.089) (-2005.920) (-1995.121) * [-2000.625] (-2004.405) (-2003.057) (-2016.650) -- 0:03:03
      549500 -- (-2007.151) (-2004.563) (-2026.915) [-1995.782] * (-2009.380) [-2007.757] (-2006.836) (-2009.323) -- 0:03:02
      550000 -- (-2010.990) (-1998.393) [-2003.465] (-2008.652) * (-2000.113) [-1995.800] (-2012.005) (-2002.396) -- 0:03:02

      Average standard deviation of split frequencies: 0.015088

      550500 -- (-2015.888) [-2008.820] (-1999.522) (-2002.700) * [-1995.462] (-2006.021) (-2010.762) (-2009.135) -- 0:03:02
      551000 -- (-2010.856) (-2006.338) (-2007.695) [-2005.173] * (-2006.432) (-2012.991) (-2009.294) [-1995.926] -- 0:03:02
      551500 -- [-2008.471] (-2006.917) (-2001.393) (-2000.261) * (-2012.970) (-2004.592) (-2011.262) [-1998.582] -- 0:03:02
      552000 -- (-2014.583) (-2011.290) [-1999.004] (-2003.149) * [-1997.704] (-2007.518) (-2010.048) (-2011.345) -- 0:03:01
      552500 -- (-2006.172) (-2003.628) [-1997.679] (-2017.469) * (-2001.361) (-1996.834) [-1998.712] (-2012.132) -- 0:03:01
      553000 -- [-1997.411] (-2005.752) (-2003.058) (-2006.834) * (-2023.446) (-2001.001) (-2009.058) [-2006.161] -- 0:03:01
      553500 -- [-1999.893] (-2009.516) (-2012.847) (-2010.507) * (-2009.464) (-2004.041) [-2002.172] (-2003.123) -- 0:03:01
      554000 -- [-1994.954] (-2006.823) (-2008.688) (-2012.314) * [-2004.998] (-2009.664) (-2009.192) (-2011.194) -- 0:03:01
      554500 -- [-2003.701] (-1998.914) (-2024.000) (-2004.109) * [-2006.437] (-2003.227) (-2012.530) (-2007.915) -- 0:03:00
      555000 -- (-2009.681) [-2003.860] (-2005.929) (-2005.580) * (-2023.313) (-2002.826) [-1994.444] (-2002.624) -- 0:03:00

      Average standard deviation of split frequencies: 0.014996

      555500 -- (-2008.081) [-2001.359] (-2006.191) (-2005.987) * (-2023.200) (-2000.420) [-1998.180] (-2001.182) -- 0:03:00
      556000 -- (-2007.222) [-1995.474] (-2003.522) (-2015.879) * (-2012.149) (-2002.102) [-2004.777] (-2011.413) -- 0:03:00
      556500 -- (-2008.900) (-2003.722) [-2010.751] (-2005.450) * (-2007.761) (-2002.935) (-2014.978) [-2008.294] -- 0:03:00
      557000 -- [-1993.989] (-2005.398) (-2002.146) (-2002.056) * (-2010.277) (-1998.646) [-1998.014] (-2010.833) -- 0:02:59
      557500 -- [-1997.235] (-2008.343) (-2012.017) (-1996.671) * [-2001.810] (-2005.880) (-2003.064) (-2007.216) -- 0:02:59
      558000 -- [-2008.150] (-2008.554) (-2010.710) (-2004.118) * (-1995.251) [-2002.677] (-1997.773) (-1999.158) -- 0:02:59
      558500 -- [-1999.740] (-2018.133) (-2007.223) (-2003.588) * [-1999.329] (-2012.316) (-2007.300) (-2005.904) -- 0:02:59
      559000 -- (-2004.875) (-2007.379) (-2004.480) [-2013.942] * (-2005.497) [-2007.462] (-2008.793) (-2006.518) -- 0:02:59
      559500 -- (-2010.104) (-2012.614) (-2000.479) [-2001.291] * (-1999.317) [-1998.931] (-2005.515) (-2009.970) -- 0:02:58
      560000 -- (-2003.020) (-2005.887) [-2005.267] (-2009.084) * (-2009.641) (-2005.611) [-1993.137] (-2004.983) -- 0:02:58

      Average standard deviation of split frequencies: 0.014083

      560500 -- [-1993.238] (-1999.568) (-2013.899) (-2009.499) * (-2010.068) [-2004.028] (-2005.642) (-2006.102) -- 0:02:57
      561000 -- (-2011.232) [-2011.839] (-2011.005) (-2006.194) * [-2004.328] (-2007.608) (-2007.437) (-2003.362) -- 0:02:58
      561500 -- [-1997.175] (-2007.428) (-2000.866) (-2017.450) * (-2010.042) (-2000.848) [-2008.712] (-2000.816) -- 0:02:58
      562000 -- (-1999.776) (-2004.802) (-2004.089) [-1997.088] * [-2004.921] (-2007.733) (-2003.333) (-2018.284) -- 0:02:57
      562500 -- (-2001.428) (-2001.217) (-2001.295) [-1999.576] * (-1999.919) (-1993.652) (-2004.428) [-2008.334] -- 0:02:57
      563000 -- (-2009.227) [-2005.686] (-2014.444) (-2011.148) * (-2005.560) (-1999.198) [-2005.693] (-2005.306) -- 0:02:56
      563500 -- (-2004.138) [-2005.834] (-2012.756) (-2003.958) * (-2008.737) (-2013.763) (-1998.600) [-2006.354] -- 0:02:57
      564000 -- (-2005.716) (-2005.374) (-2015.402) [-1995.719] * [-2000.981] (-2016.915) (-2007.815) (-2004.995) -- 0:02:57
      564500 -- [-1998.975] (-2008.909) (-2015.623) (-2010.217) * [-1997.824] (-2013.517) (-2015.057) (-2010.486) -- 0:02:56
      565000 -- (-2019.659) (-2011.328) (-2009.692) [-1995.587] * (-2002.470) (-2023.043) (-2026.639) [-1995.872] -- 0:02:56

      Average standard deviation of split frequencies: 0.013846

      565500 -- (-2014.818) (-2000.680) (-2002.536) [-2002.406] * (-2009.851) [-1995.231] (-2023.897) (-1998.988) -- 0:02:55
      566000 -- (-2004.930) (-2004.920) (-2013.444) [-2000.428] * (-2004.111) (-2005.517) (-2024.372) [-2006.407] -- 0:02:56
      566500 -- (-2011.346) [-2006.559] (-2012.441) (-2005.858) * [-1996.614] (-2007.332) (-2007.241) (-2001.354) -- 0:02:56
      567000 -- (-2007.215) (-2005.226) [-1999.622] (-2010.251) * [-2001.691] (-2011.427) (-2014.396) (-1998.544) -- 0:02:55
      567500 -- (-2006.891) (-2000.312) (-2012.547) [-1999.506] * (-2005.546) [-2007.957] (-2010.230) (-2003.245) -- 0:02:55
      568000 -- (-2008.151) (-2006.158) [-1999.827] (-2013.925) * (-2003.125) (-1999.244) [-2001.377] (-2013.530) -- 0:02:54
      568500 -- (-2004.134) (-2005.137) [-2005.646] (-2000.616) * (-2003.725) [-1996.797] (-2019.958) (-1999.783) -- 0:02:55
      569000 -- (-2009.386) (-1995.212) [-2006.136] (-2018.735) * (-2011.074) (-1996.914) [-1994.594] (-2010.431) -- 0:02:54
      569500 -- [-2007.367] (-2006.518) (-2014.008) (-2004.162) * (-2002.995) (-2009.182) (-2002.964) [-1997.486] -- 0:02:54
      570000 -- (-2008.429) (-2002.160) (-2019.401) [-2001.125] * (-1997.879) (-2016.936) [-1994.672] (-2004.529) -- 0:02:54

      Average standard deviation of split frequencies: 0.013372

      570500 -- (-2016.726) (-2010.870) (-2020.720) [-1996.236] * (-2009.640) (-2006.480) [-2004.019] (-2013.358) -- 0:02:53
      571000 -- [-2000.999] (-2004.774) (-2007.966) (-2007.713) * (-2007.350) (-2020.734) [-2001.176] (-1996.984) -- 0:02:54
      571500 -- (-1999.266) (-1998.327) (-2015.293) [-1999.741] * (-2008.522) (-2009.599) (-1996.443) [-2000.723] -- 0:02:53
      572000 -- (-2003.515) [-1997.803] (-2013.914) (-2009.023) * (-2013.991) (-2003.218) [-2004.090] (-2009.752) -- 0:02:53
      572500 -- (-2007.953) [-2002.788] (-2005.638) (-2005.283) * (-2006.369) (-1997.085) [-2003.576] (-2005.745) -- 0:02:53
      573000 -- (-2011.749) (-2005.371) [-2008.654] (-2010.037) * (-2011.872) (-1998.148) (-2007.724) [-1998.897] -- 0:02:52
      573500 -- [-2000.873] (-2002.847) (-2022.215) (-2008.646) * (-2018.752) (-2002.484) (-2007.576) [-2000.854] -- 0:02:53
      574000 -- (-2003.283) [-2009.789] (-2006.865) (-2002.408) * (-2013.359) (-2011.552) (-2008.977) [-2002.208] -- 0:02:52
      574500 -- (-2005.967) (-2008.621) (-2006.196) [-2009.402] * (-2010.137) (-2001.488) [-2001.178] (-2007.387) -- 0:02:52
      575000 -- (-2002.030) (-2003.812) [-2003.843] (-2007.110) * [-2002.554] (-2007.579) (-2005.283) (-2009.011) -- 0:02:52

      Average standard deviation of split frequencies: 0.012430

      575500 -- [-2004.644] (-2008.476) (-1996.035) (-2007.811) * [-1999.727] (-2004.342) (-2013.428) (-2015.232) -- 0:02:51
      576000 -- (-1997.640) [-2001.105] (-2004.769) (-2002.171) * (-1999.982) (-2010.740) [-2007.140] (-2011.716) -- 0:02:52
      576500 -- [-2001.478] (-2015.902) (-2007.645) (-2006.896) * (-2003.068) (-2006.693) [-2013.683] (-2007.790) -- 0:02:51
      577000 -- (-2006.684) (-2005.579) [-2013.193] (-2000.424) * (-2002.187) (-2001.552) [-2010.067] (-2013.717) -- 0:02:51
      577500 -- (-2004.814) (-2012.801) [-1999.731] (-2008.520) * [-2005.595] (-1998.427) (-2003.176) (-2014.671) -- 0:02:51
      578000 -- (-2005.608) (-1996.832) [-1997.605] (-2009.435) * [-2008.985] (-1997.491) (-2008.374) (-1999.466) -- 0:02:50
      578500 -- (-2014.206) (-2004.655) [-1997.537] (-1999.636) * (-2012.940) (-2011.862) (-2005.067) [-1995.689] -- 0:02:51
      579000 -- (-2008.444) (-1993.065) [-1992.470] (-2009.502) * (-1998.014) (-2007.429) [-2010.338] (-1999.347) -- 0:02:50
      579500 -- (-2007.872) [-2003.428] (-1999.934) (-2000.133) * (-2002.718) (-2002.144) [-1998.650] (-1999.193) -- 0:02:50
      580000 -- [-1993.071] (-2015.455) (-2005.987) (-1999.690) * [-1994.595] (-2011.562) (-2006.375) (-2014.020) -- 0:02:50

      Average standard deviation of split frequencies: 0.011264

      580500 -- [-2005.966] (-2016.182) (-2006.369) (-2000.444) * [-1994.721] (-2007.033) (-2014.143) (-2007.042) -- 0:02:49
      581000 -- [-2005.905] (-2004.098) (-2006.512) (-2004.811) * (-2013.092) [-2003.009] (-2010.619) (-2007.722) -- 0:02:50
      581500 -- (-2014.083) (-2015.439) (-2004.007) [-2013.533] * [-1995.054] (-1995.418) (-2010.004) (-2010.424) -- 0:02:49
      582000 -- (-2009.481) [-2001.288] (-2015.404) (-2003.799) * (-2001.443) (-2005.662) (-2009.499) [-2002.503] -- 0:02:49
      582500 -- [-2005.607] (-1999.602) (-2010.613) (-1999.962) * (-2021.366) (-2001.571) (-2003.879) [-2002.955] -- 0:02:49
      583000 -- (-2004.108) [-2014.879] (-2000.502) (-2012.058) * (-2012.468) (-2008.908) (-1998.698) [-2001.014] -- 0:02:48
      583500 -- [-2000.239] (-2003.103) (-1996.377) (-2000.778) * [-2001.188] (-2011.436) (-2006.968) (-2009.408) -- 0:02:49
      584000 -- (-2010.954) (-2004.751) [-2002.119] (-2011.474) * (-2000.826) (-2015.450) (-2018.829) [-2003.966] -- 0:02:48
      584500 -- (-2011.500) [-2004.937] (-1992.397) (-2018.295) * [-1995.986] (-2012.408) (-2002.384) (-2003.377) -- 0:02:48
      585000 -- [-2008.725] (-2002.927) (-2001.853) (-2007.469) * (-2013.448) (-1999.448) (-2005.651) [-2007.098] -- 0:02:48

      Average standard deviation of split frequencies: 0.010609

      585500 -- [-1999.377] (-2006.663) (-2001.374) (-1999.587) * (-2009.397) (-2006.883) (-2006.529) [-2012.824] -- 0:02:47
      586000 -- (-2016.959) (-1998.704) (-2010.719) [-2000.083] * (-2004.719) [-1998.898] (-2006.745) (-1998.392) -- 0:02:48
      586500 -- (-2004.187) [-2004.913] (-2014.742) (-2005.477) * (-2004.422) (-2009.313) (-2005.426) [-2001.614] -- 0:02:47
      587000 -- (-2005.877) (-2008.511) (-2011.902) [-2009.411] * (-1998.769) (-2004.710) (-2003.088) [-1998.863] -- 0:02:47
      587500 -- (-2008.278) (-2011.649) [-2002.266] (-2015.167) * (-2004.777) [-1998.400] (-2010.081) (-2008.247) -- 0:02:47
      588000 -- (-2016.633) (-2004.144) [-1995.324] (-2003.111) * [-2004.453] (-2015.811) (-2012.626) (-2019.137) -- 0:02:46
      588500 -- (-2008.221) (-2002.730) (-2014.602) [-2002.448] * (-2020.254) (-2002.750) (-2000.159) [-1999.296] -- 0:02:46
      589000 -- (-2004.890) (-2010.094) [-2001.823] (-2003.700) * (-2013.934) (-2007.566) [-2002.886] (-2011.013) -- 0:02:46
      589500 -- (-2015.039) (-1998.142) (-2005.341) [-1999.523] * (-2007.052) (-2000.016) (-2006.256) [-2001.769] -- 0:02:46
      590000 -- (-2008.940) [-1999.716] (-2012.758) (-1993.493) * (-2011.870) (-2003.020) (-2008.897) [-2003.832] -- 0:02:46

      Average standard deviation of split frequencies: 0.010375

      590500 -- (-2008.258) [-2008.815] (-2002.838) (-2004.020) * (-2008.474) (-2014.841) [-2009.926] (-2007.016) -- 0:02:45
      591000 -- (-2007.056) (-2004.444) [-2002.051] (-2019.684) * (-2000.373) [-2024.051] (-2004.867) (-2009.677) -- 0:02:45
      591500 -- [-2015.118] (-2006.318) (-2008.068) (-2007.394) * (-2014.976) (-2003.118) [-1996.440] (-2014.243) -- 0:02:45
      592000 -- [-2001.732] (-2006.141) (-2006.195) (-2002.421) * [-2004.408] (-2012.676) (-2010.890) (-2004.869) -- 0:02:45
      592500 -- [-2004.064] (-2016.023) (-2004.511) (-2009.286) * [-1998.883] (-2006.240) (-2012.273) (-2010.534) -- 0:02:45
      593000 -- (-2006.014) (-1996.787) [-2001.282] (-2021.682) * [-2003.392] (-2005.565) (-2007.661) (-2013.025) -- 0:02:44
      593500 -- [-2002.932] (-2010.787) (-2005.035) (-2015.374) * [-2005.272] (-2000.805) (-2023.892) (-2013.293) -- 0:02:44
      594000 -- (-1994.263) (-2015.584) [-1999.599] (-2019.815) * [-2006.770] (-2001.392) (-2006.633) (-2015.780) -- 0:02:44
      594500 -- (-2004.788) (-2004.936) [-1991.036] (-2000.029) * (-2008.401) [-1996.022] (-2016.563) (-2017.141) -- 0:02:44
      595000 -- (-2006.986) (-2009.056) (-2006.671) [-2000.301] * [-2003.182] (-2007.657) (-2000.520) (-2006.717) -- 0:02:44

      Average standard deviation of split frequencies: 0.010381

      595500 -- (-2007.411) (-2003.448) [-2004.155] (-2009.061) * [-2003.581] (-2000.444) (-2003.404) (-2014.973) -- 0:02:43
      596000 -- (-1997.788) (-2003.251) [-2003.796] (-2010.489) * [-2008.123] (-2005.581) (-2011.721) (-2003.065) -- 0:02:43
      596500 -- (-2028.968) (-2010.579) (-1997.068) [-2001.087] * (-2005.516) (-2012.490) (-2006.242) [-2005.274] -- 0:02:43
      597000 -- (-2022.252) (-2013.663) [-1992.971] (-2003.424) * (-1997.278) (-2014.010) (-2000.569) [-2003.933] -- 0:02:43
      597500 -- (-2005.639) (-2012.197) [-1999.507] (-2014.826) * (-2001.087) (-2003.573) (-2002.612) [-2005.949] -- 0:02:43
      598000 -- (-2000.862) [-2005.492] (-2003.456) (-2005.647) * (-2028.575) [-2006.930] (-2018.091) (-2011.743) -- 0:02:42
      598500 -- (-2011.081) (-2012.743) (-2007.595) [-1999.119] * (-2003.737) (-2001.105) (-2001.529) [-2002.005] -- 0:02:42
      599000 -- [-1996.126] (-2008.694) (-2008.876) (-2005.244) * (-2014.745) (-2011.929) (-2005.795) [-1999.566] -- 0:02:42
      599500 -- [-2008.077] (-2009.556) (-2007.740) (-1999.824) * (-2006.614) [-2005.936] (-2005.108) (-2010.266) -- 0:02:42
      600000 -- [-2003.609] (-2004.979) (-2014.572) (-1999.229) * (-2015.953) (-2005.101) [-2000.544] (-2012.664) -- 0:02:42

      Average standard deviation of split frequencies: 0.009663

      600500 -- (-2006.179) [-2006.575] (-2026.021) (-2002.329) * (-2005.824) [-2002.591] (-2014.505) (-2007.442) -- 0:02:41
      601000 -- (-1998.609) (-2003.610) [-2006.634] (-2009.865) * [-1999.544] (-1998.514) (-2011.528) (-1998.666) -- 0:02:41
      601500 -- (-1998.253) (-2003.347) (-2011.342) [-2008.746] * [-2000.297] (-2007.150) (-2003.828) (-2003.469) -- 0:02:41
      602000 -- [-2001.744] (-2002.239) (-2005.695) (-1998.598) * (-1996.609) (-2014.484) [-2008.434] (-2009.860) -- 0:02:41
      602500 -- [-2017.817] (-2001.119) (-2014.186) (-2011.226) * (-2001.502) (-2003.699) (-2012.353) [-1999.454] -- 0:02:40
      603000 -- (-2019.118) [-1998.434] (-2009.379) (-2003.322) * [-2006.615] (-2006.063) (-2008.256) (-2000.360) -- 0:02:40
      603500 -- (-2014.665) (-2006.974) (-2017.146) [-1990.902] * (-2006.276) (-2006.474) (-2003.179) [-1996.713] -- 0:02:40
      604000 -- (-1999.614) (-2008.632) (-2014.678) [-1996.363] * (-2008.482) [-1992.816] (-2006.870) (-2008.066) -- 0:02:40
      604500 -- (-2004.257) (-2008.823) (-2008.615) [-1997.892] * (-2005.418) (-1998.277) (-2004.628) [-2006.512] -- 0:02:40
      605000 -- [-2000.152] (-2010.467) (-2008.901) (-2023.149) * (-2007.414) [-2003.705] (-2002.763) (-2015.606) -- 0:02:39

      Average standard deviation of split frequencies: 0.009967

      605500 -- (-2002.971) [-2007.784] (-2010.117) (-2011.448) * (-2012.653) [-1998.450] (-2012.910) (-1997.790) -- 0:02:39
      606000 -- (-2003.999) (-2015.319) [-2005.378] (-2006.266) * (-2010.455) (-1996.116) [-2010.971] (-2010.796) -- 0:02:39
      606500 -- (-2005.935) (-2010.535) (-2003.228) [-2004.409] * (-2019.060) (-2004.936) (-2002.270) [-2003.555] -- 0:02:39
      607000 -- (-2011.104) (-2009.053) (-2004.753) [-1998.992] * (-2000.696) (-2011.058) (-2003.018) [-2006.588] -- 0:02:39
      607500 -- (-2019.828) (-2000.095) [-1996.334] (-2002.086) * (-2009.807) (-2005.857) (-1995.135) [-2000.107] -- 0:02:38
      608000 -- (-2000.403) [-2008.918] (-2014.138) (-2005.453) * (-2010.668) (-2005.301) (-2000.142) [-2005.160] -- 0:02:38
      608500 -- [-2005.713] (-2007.945) (-2010.817) (-2003.159) * (-2008.148) (-2002.821) [-1997.227] (-2002.394) -- 0:02:38
      609000 -- [-2001.048] (-1994.494) (-2009.523) (-2018.039) * [-2001.836] (-2004.642) (-2004.732) (-2004.062) -- 0:02:38
      609500 -- (-2016.033) (-2001.809) (-2004.447) [-2012.858] * (-2007.722) (-2013.186) [-2008.802] (-1999.968) -- 0:02:38
      610000 -- (-2002.662) (-2011.347) (-2000.500) [-2005.170] * (-2013.769) (-2002.954) [-1996.050] (-2006.981) -- 0:02:37

      Average standard deviation of split frequencies: 0.010614

      610500 -- [-2008.938] (-2020.816) (-2013.816) (-2003.187) * (-2011.104) (-2001.275) (-2015.853) [-1996.512] -- 0:02:37
      611000 -- [-2006.102] (-2015.711) (-2006.816) (-2007.027) * [-2006.372] (-2014.343) (-1997.285) (-2006.017) -- 0:02:37
      611500 -- [-1995.660] (-2015.708) (-2002.972) (-2004.517) * (-2004.466) (-2004.061) [-2001.253] (-2008.516) -- 0:02:37
      612000 -- (-1998.411) (-2013.294) (-2010.501) [-2005.843] * (-2004.100) (-2002.229) (-2004.830) [-2009.046] -- 0:02:37
      612500 -- (-2011.061) (-2015.336) (-2016.737) [-2001.204] * (-2004.387) (-1999.278) [-1994.177] (-2011.270) -- 0:02:36
      613000 -- (-2006.765) (-1998.825) [-2001.786] (-2000.407) * (-1999.101) [-2003.193] (-1999.654) (-2009.445) -- 0:02:36
      613500 -- (-2007.030) (-1998.077) [-2001.121] (-2000.265) * (-2003.539) (-2015.032) [-1997.250] (-2008.088) -- 0:02:36
      614000 -- (-2018.446) (-2012.376) [-2001.946] (-2006.410) * (-2001.323) (-2008.774) [-2016.589] (-2011.513) -- 0:02:36
      614500 -- (-2019.138) (-2014.191) (-2003.342) [-2000.630] * (-1995.845) [-1999.576] (-2022.393) (-2004.890) -- 0:02:36
      615000 -- (-2014.589) [-2003.945] (-2009.989) (-2006.576) * (-2010.370) [-2001.265] (-2017.827) (-2007.285) -- 0:02:35

      Average standard deviation of split frequencies: 0.010714

      615500 -- (-2006.696) [-1996.903] (-2008.491) (-2004.378) * (-2008.530) [-2008.710] (-2007.247) (-2002.702) -- 0:02:35
      616000 -- [-1999.301] (-2009.905) (-2008.055) (-1999.403) * (-2005.994) (-2020.140) [-1999.834] (-2010.291) -- 0:02:35
      616500 -- [-1996.418] (-2004.919) (-2008.061) (-2000.598) * [-2006.700] (-2001.136) (-2012.673) (-2001.926) -- 0:02:35
      617000 -- (-2008.027) (-1997.031) (-2003.271) [-2001.641] * (-2008.132) (-2006.220) (-2010.835) [-2001.675] -- 0:02:35
      617500 -- (-2016.094) (-2017.808) [-2003.254] (-1999.770) * (-2003.002) (-2012.079) [-2005.082] (-2008.515) -- 0:02:34
      618000 -- (-2012.028) (-2004.335) (-2001.861) [-2001.002] * (-2002.828) (-1998.475) (-2015.994) [-2001.440] -- 0:02:34
      618500 -- (-2023.032) (-2009.783) (-2016.109) [-2002.872] * (-1996.700) [-2002.687] (-2008.215) (-2000.201) -- 0:02:34
      619000 -- [-2001.091] (-2013.324) (-2004.646) (-2007.642) * (-1999.525) (-2002.064) (-2006.478) [-2005.618] -- 0:02:34
      619500 -- (-2003.081) (-2006.933) (-2014.568) [-2006.697] * (-1997.364) (-2012.630) (-2003.124) [-2005.525] -- 0:02:34
      620000 -- (-2006.574) [-2007.394] (-2009.435) (-2020.345) * (-2009.903) [-2005.268] (-2004.620) (-1995.192) -- 0:02:33

      Average standard deviation of split frequencies: 0.011393

      620500 -- (-2005.957) (-2003.427) (-2017.331) [-1998.831] * [-1997.044] (-2002.494) (-2000.463) (-1997.002) -- 0:02:33
      621000 -- (-2011.012) (-2006.903) [-1999.329] (-2010.403) * [-2009.083] (-1996.853) (-2013.352) (-2003.304) -- 0:02:33
      621500 -- (-2006.027) (-2012.513) [-1995.321] (-2007.852) * (-2003.301) [-2005.960] (-2016.845) (-2008.859) -- 0:02:33
      622000 -- (-2007.514) (-2007.962) [-1996.802] (-2002.873) * [-2003.571] (-2011.312) (-2001.522) (-2002.154) -- 0:02:33
      622500 -- (-2010.506) (-2012.883) (-1992.611) [-2007.844] * [-1998.155] (-2005.010) (-2000.044) (-2007.660) -- 0:02:32
      623000 -- [-2000.754] (-2006.231) (-2003.491) (-2008.439) * (-2003.236) (-2018.979) [-2003.002] (-2002.986) -- 0:02:32
      623500 -- (-2004.704) (-2010.361) [-2001.496] (-2004.831) * [-2011.864] (-2000.914) (-2006.778) (-2002.889) -- 0:02:32
      624000 -- [-2012.765] (-2008.330) (-2005.450) (-2005.490) * (-2013.904) (-2003.480) [-2010.067] (-2005.476) -- 0:02:32
      624500 -- (-2003.445) [-2003.141] (-2010.211) (-2009.495) * [-2001.855] (-2003.269) (-2026.905) (-2002.173) -- 0:02:32
      625000 -- (-2019.402) (-2004.685) [-2010.127] (-2012.185) * (-2002.557) (-2011.028) [-2000.981] (-2019.993) -- 0:02:31

      Average standard deviation of split frequencies: 0.011249

      625500 -- (-2009.317) [-1999.636] (-2014.601) (-2010.621) * (-1998.756) (-2018.572) (-2009.128) [-2006.564] -- 0:02:31
      626000 -- (-2008.134) (-1994.626) [-2007.014] (-2007.689) * (-2003.462) (-2000.041) (-2008.992) [-2002.318] -- 0:02:31
      626500 -- [-1999.279] (-2002.569) (-2002.938) (-2025.539) * [-2001.126] (-1999.777) (-2008.812) (-2004.839) -- 0:02:31
      627000 -- (-2008.990) (-1998.346) [-1998.457] (-2001.062) * (-2011.140) [-1995.701] (-2006.950) (-2013.341) -- 0:02:31
      627500 -- (-2018.818) (-2001.482) (-2000.939) [-1994.138] * (-2003.778) (-2004.137) (-2011.982) [-2011.036] -- 0:02:30
      628000 -- (-2010.428) [-2000.185] (-2012.042) (-2011.761) * [-2001.731] (-2015.566) (-2014.542) (-2011.359) -- 0:02:30
      628500 -- (-2000.275) [-2005.462] (-2004.139) (-2004.494) * (-2015.626) [-2003.277] (-2012.760) (-1998.221) -- 0:02:30
      629000 -- (-2006.275) (-2009.081) [-1993.404] (-2002.215) * [-2005.183] (-2001.638) (-2009.260) (-1998.276) -- 0:02:30
      629500 -- [-2002.021] (-2012.167) (-2002.979) (-2006.582) * [-2008.212] (-2005.009) (-2007.726) (-2010.666) -- 0:02:30
      630000 -- (-2005.038) [-1998.519] (-1996.846) (-2008.099) * [-2004.433] (-2010.591) (-1994.921) (-2020.399) -- 0:02:29

      Average standard deviation of split frequencies: 0.011586

      630500 -- [-2004.274] (-1995.387) (-2007.105) (-2015.383) * (-2005.166) (-2006.993) [-2003.584] (-2008.721) -- 0:02:29
      631000 -- (-2008.667) (-2006.164) [-1996.226] (-2012.113) * (-2005.283) (-2011.213) (-2016.984) [-1999.436] -- 0:02:29
      631500 -- [-1997.786] (-1999.092) (-2001.995) (-2002.849) * [-2003.754] (-2012.160) (-2010.248) (-1999.598) -- 0:02:29
      632000 -- (-1999.964) (-2011.594) [-1998.608] (-2013.154) * (-2005.245) [-2005.081] (-2000.296) (-2002.678) -- 0:02:29
      632500 -- (-2013.512) (-2009.041) (-1999.314) [-1996.939] * (-2011.478) (-2010.061) (-2006.244) [-2002.017] -- 0:02:28
      633000 -- [-2006.695] (-1994.073) (-2012.997) (-1997.128) * [-2000.452] (-2014.079) (-2004.656) (-2015.791) -- 0:02:28
      633500 -- (-2006.524) [-1995.239] (-2010.494) (-1999.193) * [-2000.182] (-2010.705) (-2008.874) (-2026.435) -- 0:02:28
      634000 -- (-2015.102) (-2007.684) (-2004.914) [-2002.031] * (-2008.667) (-2008.307) (-2010.499) [-1998.724] -- 0:02:28
      634500 -- (-2018.750) (-1999.611) [-2003.370] (-2004.017) * (-2000.755) [-2008.100] (-1995.747) (-2003.029) -- 0:02:28
      635000 -- (-2006.581) [-2009.585] (-2011.795) (-1998.992) * (-2005.342) [-2015.027] (-2012.090) (-2005.323) -- 0:02:27

      Average standard deviation of split frequencies: 0.011952

      635500 -- (-2006.732) [-1994.916] (-2002.105) (-2011.659) * [-2007.955] (-2020.313) (-2020.575) (-2011.618) -- 0:02:27
      636000 -- (-2018.921) [-1999.425] (-1999.346) (-2005.913) * [-2000.599] (-2016.545) (-2009.069) (-2015.462) -- 0:02:27
      636500 -- (-2008.963) (-2009.512) [-1995.846] (-1998.693) * (-2002.109) (-2007.583) [-2001.124] (-2012.555) -- 0:02:27
      637000 -- (-1997.924) [-1995.505] (-1995.968) (-1997.418) * [-2005.652] (-2010.767) (-2007.757) (-2016.344) -- 0:02:27
      637500 -- [-1999.478] (-1996.260) (-2005.951) (-2010.368) * (-2006.541) [-2004.412] (-2006.415) (-2009.530) -- 0:02:26
      638000 -- (-1999.642) (-2004.954) (-2009.683) [-2000.312] * (-2005.167) (-2018.097) (-2001.908) [-2003.645] -- 0:02:26
      638500 -- (-2005.956) (-2006.104) (-2003.204) [-1999.106] * (-2007.318) (-2009.768) [-1995.188] (-2019.019) -- 0:02:26
      639000 -- [-2000.731] (-1997.950) (-2015.128) (-2020.920) * (-2006.610) (-2013.555) [-2000.376] (-2004.415) -- 0:02:26
      639500 -- (-2014.098) [-2006.045] (-2009.386) (-2021.829) * (-2003.153) [-2000.262] (-2011.406) (-2010.094) -- 0:02:26
      640000 -- (-2032.807) [-2004.602] (-2001.596) (-2002.457) * (-2005.174) [-2005.304] (-2016.493) (-2005.886) -- 0:02:25

      Average standard deviation of split frequencies: 0.011635

      640500 -- (-2012.041) [-2016.690] (-1997.171) (-2009.212) * (-2004.828) (-2001.379) (-2008.164) [-1998.721] -- 0:02:25
      641000 -- [-2007.694] (-1996.814) (-2008.400) (-2004.102) * (-2020.741) (-2006.002) (-1999.360) [-2004.566] -- 0:02:25
      641500 -- [-2005.798] (-2012.362) (-2013.258) (-1995.332) * (-2014.958) (-2008.992) (-2006.792) [-2008.504] -- 0:02:25
      642000 -- (-2012.091) (-2017.133) (-2006.312) [-1996.434] * (-2017.937) [-2011.406] (-1999.520) (-2010.222) -- 0:02:24
      642500 -- (-2006.281) [-1999.573] (-2005.350) (-2012.288) * (-2011.012) (-2010.997) [-2011.760] (-2009.204) -- 0:02:24
      643000 -- [-2002.127] (-2013.530) (-2020.457) (-2000.863) * (-2006.792) [-1998.737] (-2006.196) (-2007.153) -- 0:02:24
      643500 -- (-2010.977) (-2005.321) [-2007.317] (-2009.455) * [-2006.384] (-2013.516) (-2006.551) (-2005.276) -- 0:02:24
      644000 -- [-1997.753] (-2004.473) (-2010.400) (-2014.987) * [-2008.351] (-2020.601) (-2011.282) (-2010.194) -- 0:02:24
      644500 -- [-2001.988] (-2006.097) (-2001.672) (-2003.402) * (-2010.865) (-2006.736) [-2000.819] (-2020.037) -- 0:02:23
      645000 -- (-2008.088) [-1999.936] (-2006.998) (-2001.501) * (-2004.302) [-2012.763] (-2002.265) (-2004.535) -- 0:02:23

      Average standard deviation of split frequencies: 0.011812

      645500 -- [-2003.623] (-2001.484) (-2000.724) (-2012.159) * (-2019.695) [-2004.383] (-2009.255) (-2009.875) -- 0:02:23
      646000 -- (-2006.629) (-2009.630) (-2006.265) [-1998.424] * (-2011.216) (-2003.039) [-2002.911] (-2007.988) -- 0:02:23
      646500 -- (-2001.391) (-2003.718) (-2007.809) [-1995.799] * [-2001.102] (-2004.822) (-2003.009) (-2008.390) -- 0:02:23
      647000 -- [-1995.532] (-2011.213) (-2006.308) (-2002.591) * (-2006.025) (-2005.974) [-1994.512] (-2011.952) -- 0:02:22
      647500 -- [-1998.474] (-2009.288) (-2000.699) (-2004.179) * (-2001.562) (-2009.471) [-1998.184] (-2017.224) -- 0:02:22
      648000 -- [-2002.155] (-2004.117) (-2004.775) (-2019.710) * [-2007.159] (-2010.574) (-2010.430) (-2004.230) -- 0:02:22
      648500 -- [-2014.113] (-1999.534) (-2011.011) (-2009.994) * (-2001.379) (-2007.006) (-2001.529) [-2002.630] -- 0:02:22
      649000 -- (-2003.452) [-2001.046] (-2014.436) (-2001.420) * (-2001.180) [-2005.204] (-2008.233) (-2008.193) -- 0:02:21
      649500 -- [-2000.034] (-2003.060) (-2014.567) (-2012.556) * [-2003.550] (-2010.933) (-2006.778) (-2012.403) -- 0:02:21
      650000 -- [-1998.878] (-2001.482) (-2010.541) (-2004.177) * (-2004.708) (-2009.318) [-1995.635] (-2023.788) -- 0:02:21

      Average standard deviation of split frequencies: 0.011592

      650500 -- [-2003.627] (-2015.140) (-2020.776) (-2004.523) * (-2019.934) [-1996.403] (-2008.145) (-2009.120) -- 0:02:21
      651000 -- (-2006.297) [-2005.821] (-2014.502) (-2011.225) * [-2003.205] (-2006.830) (-2005.125) (-2014.721) -- 0:02:20
      651500 -- (-2002.101) (-2001.348) (-2006.776) [-2001.458] * (-2004.471) [-2001.748] (-2018.157) (-2008.833) -- 0:02:20
      652000 -- (-2000.999) [-1998.044] (-2015.577) (-2009.595) * (-2009.668) (-1998.578) (-2011.427) [-1998.004] -- 0:02:20
      652500 -- (-1999.892) [-2001.962] (-1999.312) (-2009.110) * [-2002.674] (-2005.829) (-2000.075) (-2007.547) -- 0:02:20
      653000 -- (-2009.804) (-2006.461) [-2001.634] (-2011.980) * (-2004.792) [-2002.007] (-1999.545) (-2001.136) -- 0:02:20
      653500 -- [-1998.304] (-2005.440) (-2006.501) (-2016.433) * [-2002.240] (-2017.665) (-2003.580) (-2007.377) -- 0:02:19
      654000 -- (-2014.091) (-2014.388) (-2002.004) [-2016.305] * (-2002.596) (-2004.680) (-1995.075) [-2003.286] -- 0:02:19
      654500 -- (-2002.423) [-1998.925] (-2000.764) (-2011.544) * (-2007.173) (-2002.317) [-1997.542] (-2013.066) -- 0:02:19
      655000 -- (-1998.351) (-2005.656) (-2010.398) [-2008.816] * [-2000.161] (-2018.896) (-2004.066) (-2023.365) -- 0:02:19

      Average standard deviation of split frequencies: 0.011767

      655500 -- (-2007.601) [-2001.599] (-1997.410) (-2008.187) * (-2002.858) (-2008.155) [-1996.740] (-2000.973) -- 0:02:19
      656000 -- (-2009.888) [-1997.312] (-2001.029) (-2006.166) * (-2003.513) [-2004.366] (-2006.793) (-2015.269) -- 0:02:18
      656500 -- (-2010.950) [-1997.849] (-1997.716) (-1998.762) * (-2004.653) (-2021.586) (-2004.145) [-2002.751] -- 0:02:18
      657000 -- (-2012.017) (-2008.234) [-2010.222] (-2000.828) * [-2001.273] (-2001.664) (-2004.517) (-2009.426) -- 0:02:18
      657500 -- (-2011.530) [-1999.942] (-2011.098) (-2008.300) * (-2002.517) (-2011.644) [-2004.853] (-2014.612) -- 0:02:18
      658000 -- (-1998.497) (-2005.829) [-2002.289] (-2008.149) * (-2010.167) (-2009.672) (-2007.460) [-2001.070] -- 0:02:18
      658500 -- [-2005.908] (-1999.051) (-2012.990) (-2014.043) * [-2013.678] (-2011.461) (-2001.015) (-2002.046) -- 0:02:17
      659000 -- [-2007.327] (-2003.898) (-2001.102) (-2008.643) * (-2015.765) (-2007.455) [-2001.143] (-2003.557) -- 0:02:17
      659500 -- (-2002.542) (-2022.290) (-2013.277) [-2004.591] * (-2010.742) (-2015.408) (-1995.700) [-2009.637] -- 0:02:17
      660000 -- (-2009.212) (-2011.381) [-1999.764] (-2014.790) * (-2006.787) (-2006.763) [-1998.057] (-2009.508) -- 0:02:17

      Average standard deviation of split frequencies: 0.012398

      660500 -- (-1995.473) (-2003.211) [-1995.077] (-2008.790) * (-2000.379) (-2010.564) (-2005.802) [-1996.969] -- 0:02:17
      661000 -- [-1999.903] (-1998.897) (-2014.110) (-2003.416) * (-2005.178) (-2006.313) (-2011.398) [-2009.953] -- 0:02:16
      661500 -- (-1999.976) (-2010.077) [-1999.852] (-2018.527) * (-1997.809) (-2009.524) [-2010.985] (-2007.311) -- 0:02:16
      662000 -- [-2000.925] (-2006.081) (-2004.421) (-2002.823) * (-2007.041) [-1997.843] (-2013.670) (-2001.618) -- 0:02:16
      662500 -- (-1995.726) [-2000.295] (-2005.311) (-2013.176) * (-2008.469) (-1997.850) [-1998.298] (-2002.190) -- 0:02:16
      663000 -- (-2017.922) [-2010.858] (-2007.101) (-2005.280) * (-2002.576) [-2006.021] (-2003.607) (-2008.393) -- 0:02:16
      663500 -- (-2010.866) (-2017.455) (-2007.804) [-2006.247] * (-2007.634) (-2011.539) [-2007.520] (-2008.832) -- 0:02:15
      664000 -- (-2010.660) (-2000.956) [-1991.113] (-2015.568) * [-2007.193] (-2004.382) (-2002.931) (-2009.322) -- 0:02:15
      664500 -- (-2011.964) (-2004.860) [-1990.329] (-2015.117) * (-2003.031) [-2005.475] (-2006.448) (-2012.707) -- 0:02:15
      665000 -- (-2011.369) (-2004.589) [-1995.208] (-2003.004) * (-1999.512) [-1996.421] (-2001.771) (-2008.809) -- 0:02:15

      Average standard deviation of split frequencies: 0.012254

      665500 -- (-2012.489) (-2003.087) [-1996.744] (-1998.301) * [-2000.854] (-2009.603) (-2004.474) (-2010.731) -- 0:02:15
      666000 -- (-1997.517) (-2002.443) (-2001.611) [-2006.261] * (-2008.843) (-2010.671) (-2005.639) [-2008.304] -- 0:02:14
      666500 -- (-1998.160) [-1999.385] (-2005.989) (-2008.942) * (-2016.012) [-2014.687] (-2004.246) (-2006.994) -- 0:02:14
      667000 -- (-2004.906) (-1995.490) [-2003.982] (-2012.275) * (-2013.739) [-1999.737] (-1999.677) (-2009.904) -- 0:02:14
      667500 -- (-2010.521) (-2007.646) (-1999.204) [-1999.316] * [-2008.847] (-2007.329) (-2009.478) (-2006.465) -- 0:02:14
      668000 -- (-2002.911) (-2009.986) (-2006.973) [-2013.954] * (-2004.543) (-2001.974) [-1999.010] (-2005.870) -- 0:02:14
      668500 -- [-2007.189] (-2019.539) (-1999.840) (-2003.055) * [-2006.151] (-2005.326) (-2004.500) (-2007.112) -- 0:02:13
      669000 -- (-2005.991) (-2011.543) [-1996.687] (-2003.871) * (-2008.109) (-2007.340) (-2009.811) [-2001.772] -- 0:02:13
      669500 -- (-2002.792) (-2023.880) (-2001.104) [-2007.453] * (-2004.121) (-1998.841) [-1998.503] (-2012.153) -- 0:02:13
      670000 -- (-1995.639) (-2006.069) (-2002.410) [-2006.981] * [-2007.442] (-2007.022) (-2018.774) (-2010.931) -- 0:02:13

      Average standard deviation of split frequencies: 0.012257

      670500 -- (-2007.810) (-2012.071) [-1993.070] (-2006.029) * (-2009.529) (-2005.650) [-2000.106] (-2009.123) -- 0:02:13
      671000 -- (-1996.298) (-2000.790) [-2002.316] (-2003.758) * (-2001.866) (-2003.146) (-2014.528) [-2005.137] -- 0:02:12
      671500 -- [-1997.439] (-2018.898) (-2004.684) (-2015.660) * (-2004.537) [-2004.237] (-2014.457) (-1998.853) -- 0:02:13
      672000 -- (-2002.557) (-2000.586) (-2004.662) [-2001.947] * (-2006.055) (-2006.573) (-2009.552) [-2004.276] -- 0:02:12
      672500 -- (-2008.869) [-2003.175] (-2009.641) (-2009.614) * (-1996.543) [-1995.591] (-2008.278) (-2008.845) -- 0:02:12
      673000 -- (-2010.555) [-1997.398] (-2002.119) (-1994.216) * (-2006.980) (-2005.445) (-2028.059) [-2017.068] -- 0:02:12
      673500 -- (-2000.361) (-2006.196) (-2006.356) [-1996.915] * (-2007.763) (-2003.435) [-2017.028] (-2013.144) -- 0:02:11
      674000 -- [-1999.716] (-2003.549) (-2004.816) (-2013.282) * (-2008.537) [-1999.904] (-2004.173) (-2010.863) -- 0:02:11
      674500 -- (-2005.848) (-2003.197) (-2010.408) [-1993.613] * (-2003.644) (-2003.877) [-2009.646] (-2008.534) -- 0:02:11
      675000 -- (-1996.245) [-2002.204] (-2011.276) (-2003.799) * [-2009.725] (-2000.293) (-2011.985) (-2005.665) -- 0:02:11

      Average standard deviation of split frequencies: 0.011898

      675500 -- (-2009.624) (-1997.729) (-2014.901) [-2004.069] * (-2002.749) [-1994.206] (-2006.550) (-1994.233) -- 0:02:11
      676000 -- [-2004.488] (-1999.724) (-2000.135) (-2009.379) * (-1999.077) [-1999.125] (-2006.487) (-2000.885) -- 0:02:10
      676500 -- [-2010.010] (-2003.284) (-2010.385) (-2004.018) * (-2010.721) [-1996.809] (-2011.433) (-2004.450) -- 0:02:10
      677000 -- (-2010.531) [-2001.239] (-2006.375) (-2011.063) * (-1999.957) [-1997.300] (-2006.792) (-2009.716) -- 0:02:10
      677500 -- [-2009.841] (-2000.343) (-2005.155) (-2013.867) * [-2007.633] (-2007.001) (-2001.702) (-2005.839) -- 0:02:10
      678000 -- (-2009.032) (-2002.930) [-2001.628] (-2008.323) * (-2007.828) [-1992.437] (-2015.868) (-2002.850) -- 0:02:10
      678500 -- [-2006.034] (-2004.096) (-1999.068) (-2008.169) * (-2011.987) [-2006.547] (-2012.161) (-1999.616) -- 0:02:09
      679000 -- (-2002.649) (-2008.617) [-1997.980] (-2011.539) * (-2009.202) [-1999.144] (-2008.239) (-2004.996) -- 0:02:09
      679500 -- [-2008.350] (-2003.937) (-2002.661) (-2009.949) * (-2013.714) [-1997.383] (-2011.164) (-2000.089) -- 0:02:09
      680000 -- [-2001.578] (-2006.165) (-2010.488) (-2008.613) * (-2011.396) [-2005.537] (-2007.941) (-2001.183) -- 0:02:09

      Average standard deviation of split frequencies: 0.012726

      680500 -- (-2014.942) (-2006.210) [-2010.021] (-1998.897) * (-2014.784) [-1996.433] (-2014.239) (-2008.632) -- 0:02:09
      681000 -- (-2002.021) (-2005.621) (-2012.330) [-2005.348] * (-2013.843) [-1999.256] (-2004.318) (-2013.753) -- 0:02:08
      681500 -- (-2010.334) (-2006.444) (-2005.733) [-2002.189] * (-2013.778) [-1998.733] (-2005.307) (-2005.255) -- 0:02:08
      682000 -- (-2001.267) [-2001.214] (-2014.128) (-2007.863) * [-1998.073] (-2013.461) (-2002.401) (-1999.065) -- 0:02:08
      682500 -- [-2000.235] (-1996.186) (-2013.743) (-2007.289) * (-2020.985) [-2001.333] (-2000.875) (-2005.212) -- 0:02:08
      683000 -- (-2000.782) [-1997.455] (-2002.647) (-2015.216) * (-2010.075) [-1995.548] (-2000.932) (-2004.791) -- 0:02:08
      683500 -- (-2008.410) [-2006.734] (-2007.366) (-2015.185) * (-2014.821) [-2002.104] (-2009.819) (-2005.538) -- 0:02:07
      684000 -- (-2010.477) (-2002.779) (-2010.143) [-2002.554] * (-2003.065) (-2006.945) [-2004.216] (-2007.570) -- 0:02:07
      684500 -- (-2002.211) (-2006.888) (-2011.549) [-1996.121] * (-2000.495) (-2009.699) [-1998.974] (-2015.239) -- 0:02:07
      685000 -- (-2006.230) [-1995.333] (-2009.225) (-2007.856) * (-2011.553) (-2006.711) (-1994.647) [-2005.765] -- 0:02:07

      Average standard deviation of split frequencies: 0.012799

      685500 -- (-2002.471) [-1999.579] (-2002.215) (-2008.414) * (-2004.463) [-2001.174] (-2010.351) (-2008.992) -- 0:02:07
      686000 -- [-1999.467] (-2015.128) (-2001.666) (-2008.389) * (-2006.278) (-2003.657) [-2006.280] (-1997.646) -- 0:02:06
      686500 -- [-1999.407] (-1999.905) (-2013.361) (-2000.205) * (-2007.840) (-2004.801) (-2014.142) [-2000.378] -- 0:02:06
      687000 -- (-1996.924) [-2003.403] (-1996.332) (-2002.513) * [-1999.569] (-2002.036) (-2008.372) (-2020.488) -- 0:02:06
      687500 -- (-2010.849) [-2003.910] (-1999.913) (-2013.536) * [-2010.553] (-2010.234) (-2004.009) (-2015.563) -- 0:02:06
      688000 -- (-2001.033) (-2009.610) [-2008.056] (-2013.279) * [-2007.940] (-2003.049) (-2002.968) (-2016.549) -- 0:02:06
      688500 -- [-2001.482] (-2009.763) (-2004.128) (-2006.667) * (-2009.531) (-2013.864) [-1994.564] (-2010.144) -- 0:02:05
      689000 -- (-1997.350) (-1999.796) [-1996.500] (-2020.064) * (-2022.992) (-2006.446) [-1996.787] (-2009.637) -- 0:02:05
      689500 -- (-2004.098) [-1998.694] (-2007.830) (-2007.656) * (-2016.867) [-1997.706] (-2001.644) (-2013.189) -- 0:02:05
      690000 -- (-2005.128) (-1997.155) [-1997.897] (-1998.272) * [-2002.086] (-2011.142) (-2003.889) (-2015.175) -- 0:02:05

      Average standard deviation of split frequencies: 0.012926

      690500 -- [-2011.828] (-2020.448) (-1998.277) (-2000.125) * (-2009.099) (-2005.775) (-2004.546) [-2011.144] -- 0:02:05
      691000 -- (-2007.229) (-2008.310) (-2019.396) [-2003.291] * [-2002.990] (-2012.367) (-1996.693) (-2005.001) -- 0:02:04
      691500 -- [-2000.648] (-2006.351) (-2009.760) (-1997.431) * [-2002.848] (-2002.477) (-2009.534) (-2017.558) -- 0:02:04
      692000 -- (-2003.420) (-2019.704) (-2011.191) [-1995.971] * (-2010.607) [-2010.933] (-2016.119) (-2007.627) -- 0:02:04
      692500 -- (-2002.920) (-2016.893) (-1998.058) [-2008.675] * [-2005.168] (-2001.376) (-1999.618) (-2004.282) -- 0:02:04
      693000 -- (-2007.628) (-2009.949) (-2002.890) [-1997.329] * (-2006.740) [-1997.372] (-2005.627) (-2012.583) -- 0:02:04
      693500 -- (-2004.392) (-2020.676) (-2011.824) [-1996.407] * [-2002.675] (-2004.948) (-2010.468) (-2014.612) -- 0:02:03
      694000 -- (-2030.581) (-2005.938) (-2002.388) [-2001.562] * (-2008.706) (-1997.751) (-2009.713) [-2006.359] -- 0:02:03
      694500 -- (-2030.247) [-2007.674] (-2010.816) (-2003.957) * [-2004.129] (-2004.596) (-2007.148) (-2004.446) -- 0:02:03
      695000 -- (-2024.549) (-2008.787) (-2004.304) [-1998.293] * [-2012.794] (-2006.479) (-2006.496) (-2007.483) -- 0:02:03

      Average standard deviation of split frequencies: 0.013207

      695500 -- (-2012.638) [-2003.453] (-2010.279) (-2000.819) * (-2001.790) (-2006.767) (-2007.492) [-1996.484] -- 0:02:03
      696000 -- (-2002.499) (-2005.857) (-2012.938) [-1999.802] * (-2002.327) (-2007.724) (-2010.332) [-2006.696] -- 0:02:02
      696500 -- (-2002.834) (-2010.377) [-1999.730] (-2004.698) * [-1996.079] (-2018.496) (-2008.648) (-2002.979) -- 0:02:02
      697000 -- (-2015.683) (-2004.607) (-2010.709) [-2013.902] * [-1999.578] (-2012.256) (-2001.512) (-2010.057) -- 0:02:02
      697500 -- [-2001.142] (-2002.983) (-2008.384) (-2010.944) * [-1993.787] (-2002.243) (-1999.650) (-2016.648) -- 0:02:02
      698000 -- (-2003.443) (-1999.683) (-2004.211) [-1999.573] * [-1999.340] (-2011.867) (-2008.958) (-2008.787) -- 0:02:02
      698500 -- (-2003.124) (-2004.223) [-2001.447] (-2000.758) * [-1995.066] (-2005.187) (-2003.237) (-2008.582) -- 0:02:01
      699000 -- [-2014.700] (-2007.769) (-2009.337) (-1996.714) * (-1999.520) [-2003.191] (-2006.271) (-2003.484) -- 0:02:01
      699500 -- (-2016.455) (-1998.388) [-2005.283] (-2004.459) * [-2001.635] (-2008.221) (-2001.432) (-2012.414) -- 0:02:01
      700000 -- (-2003.984) (-2002.072) [-1999.922] (-1996.026) * [-2006.951] (-2007.432) (-2003.517) (-1998.168) -- 0:02:01

      Average standard deviation of split frequencies: 0.012699

      700500 -- (-2004.140) (-2001.611) [-2003.562] (-2002.412) * [-2001.687] (-2001.580) (-2008.255) (-2011.134) -- 0:02:00
      701000 -- (-1997.857) (-2002.952) [-1998.437] (-2003.815) * (-2032.866) (-2009.314) [-1999.429] (-2021.326) -- 0:02:00
      701500 -- (-2000.938) [-2002.345] (-2012.048) (-2006.953) * (-2011.126) [-2001.433] (-1995.264) (-2010.840) -- 0:02:00
      702000 -- [-2001.963] (-2002.467) (-2024.714) (-2011.041) * (-2002.721) (-2010.206) [-1999.971] (-2008.100) -- 0:02:00
      702500 -- (-2000.976) (-1996.811) (-2012.129) [-1998.609] * (-2004.976) (-2006.619) (-2011.785) [-2005.360] -- 0:02:00
      703000 -- [-2003.582] (-2005.701) (-2002.413) (-2005.283) * (-2011.114) [-2007.848] (-2002.305) (-2000.711) -- 0:01:59
      703500 -- (-2000.157) [-1999.763] (-2027.426) (-1999.440) * (-2011.613) [-2007.450] (-2001.552) (-2002.500) -- 0:01:59
      704000 -- (-2004.470) [-2000.438] (-2011.486) (-2003.441) * (-2018.285) (-2002.740) [-2001.536] (-2006.249) -- 0:01:59
      704500 -- (-2018.294) (-2005.669) [-2000.680] (-2001.256) * (-2001.128) (-2020.003) [-1998.487] (-2013.710) -- 0:01:59
      705000 -- (-2023.406) (-2004.303) (-1992.519) [-1995.690] * (-1998.184) [-2002.088] (-2009.896) (-2004.988) -- 0:01:59

      Average standard deviation of split frequencies: 0.012478

      705500 -- (-2022.011) (-2006.566) (-1998.198) [-1997.642] * [-2001.103] (-2012.555) (-2011.759) (-2001.909) -- 0:01:58
      706000 -- (-2008.036) (-2000.210) [-1999.086] (-2013.812) * (-1996.427) (-2012.503) [-2004.735] (-1999.486) -- 0:01:58
      706500 -- (-2005.533) (-2008.329) [-1998.950] (-2000.106) * (-2009.915) (-2012.246) (-2005.509) [-1997.945] -- 0:01:58
      707000 -- (-2002.771) [-2004.696] (-2000.546) (-1996.873) * [-2008.373] (-2002.218) (-2019.525) (-2009.578) -- 0:01:58
      707500 -- (-2016.075) (-1998.629) (-2002.048) [-1999.207] * (-2013.611) (-2022.811) [-1999.703] (-2007.820) -- 0:01:58
      708000 -- (-2010.405) (-2005.774) [-2007.162] (-2010.551) * (-2003.180) [-1997.594] (-2000.964) (-2014.382) -- 0:01:57
      708500 -- (-2012.186) (-2003.850) (-2009.562) [-1995.760] * [-1998.550] (-2001.367) (-2003.291) (-2016.565) -- 0:01:57
      709000 -- (-2006.062) [-1996.639] (-2018.959) (-2003.583) * [-2006.142] (-1997.714) (-1998.971) (-2009.659) -- 0:01:57
      709500 -- [-1999.578] (-2002.681) (-2000.157) (-2003.851) * [-2007.442] (-2005.426) (-2020.562) (-1999.924) -- 0:01:57
      710000 -- (-2006.127) (-1999.308) [-1996.561] (-2005.804) * (-2003.314) (-2008.396) [-1993.298] (-2014.381) -- 0:01:57

      Average standard deviation of split frequencies: 0.012769

      710500 -- [-2007.758] (-2008.766) (-1997.474) (-2011.331) * (-2003.952) (-1997.691) (-1992.473) [-1994.151] -- 0:01:56
      711000 -- [-2005.300] (-2023.062) (-2021.831) (-2011.642) * (-2008.288) (-2002.792) (-2003.604) [-1994.377] -- 0:01:56
      711500 -- (-2015.704) [-1999.539] (-2009.673) (-2007.483) * (-2007.043) (-2002.849) (-2000.681) [-1999.330] -- 0:01:56
      712000 -- (-2019.093) (-2002.111) [-1994.818] (-2010.161) * (-2001.435) (-2006.088) (-2005.038) [-2010.332] -- 0:01:56
      712500 -- (-2007.944) (-2006.283) (-1999.555) [-2010.022] * (-2006.110) (-2013.221) (-2020.912) [-2004.812] -- 0:01:56
      713000 -- [-1997.914] (-2008.631) (-2007.613) (-2002.443) * [-2009.970] (-2002.293) (-2012.954) (-2006.402) -- 0:01:55
      713500 -- (-2000.744) [-1996.313] (-2003.784) (-2004.118) * (-2011.219) (-2012.577) (-2007.059) [-2002.214] -- 0:01:55
      714000 -- (-2004.641) (-2004.568) (-1992.387) [-2004.485] * (-2006.226) [-2003.929] (-2016.122) (-1997.421) -- 0:01:55
      714500 -- (-2008.059) (-2004.455) [-2001.691] (-2005.253) * (-2007.836) (-2013.001) (-2010.313) [-2007.388] -- 0:01:55
      715000 -- (-2026.401) [-2005.790] (-2005.074) (-2004.566) * [-2006.486] (-2005.832) (-2012.876) (-2001.660) -- 0:01:55

      Average standard deviation of split frequencies: 0.012221

      715500 -- (-2007.217) (-1999.275) [-2001.063] (-2022.286) * [-1996.170] (-2012.633) (-2004.663) (-2007.187) -- 0:01:54
      716000 -- (-2002.379) (-2005.670) [-1998.686] (-2008.537) * [-1996.251] (-2010.547) (-2007.270) (-2007.330) -- 0:01:54
      716500 -- (-2002.841) [-2005.035] (-1998.334) (-2005.493) * [-1992.839] (-2002.845) (-2003.149) (-2004.976) -- 0:01:54
      717000 -- [-2006.583] (-2007.807) (-1999.500) (-2005.301) * (-1999.601) [-1995.668] (-2000.612) (-2009.500) -- 0:01:54
      717500 -- [-2001.240] (-2007.383) (-2014.952) (-2018.691) * [-2000.791] (-1994.903) (-2004.314) (-2009.282) -- 0:01:54
      718000 -- (-2014.724) [-1998.509] (-2006.656) (-1999.074) * (-2010.781) [-2008.327] (-2007.694) (-2008.149) -- 0:01:53
      718500 -- (-2023.122) (-1996.914) [-1999.161] (-2008.136) * [-2001.757] (-1996.492) (-2007.499) (-2005.817) -- 0:01:53
      719000 -- (-2006.823) (-1999.463) [-2004.521] (-2012.884) * [-1998.192] (-2010.732) (-2013.564) (-2009.457) -- 0:01:53
      719500 -- (-2008.031) (-2006.521) (-1994.752) [-2000.491] * (-2002.641) (-1998.059) (-2006.410) [-1996.917] -- 0:01:53
      720000 -- [-2006.185] (-2002.741) (-1999.491) (-2010.730) * [-1999.466] (-2003.231) (-2007.352) (-2009.170) -- 0:01:53

      Average standard deviation of split frequencies: 0.012101

      720500 -- (-2002.672) (-2005.457) [-1999.387] (-2003.360) * (-1998.407) (-2003.463) [-1999.989] (-2010.974) -- 0:01:52
      721000 -- (-2001.082) [-2002.465] (-1999.796) (-1999.150) * (-2000.285) (-2004.667) [-1999.615] (-2002.735) -- 0:01:52
      721500 -- [-1998.056] (-2005.761) (-2005.125) (-2001.628) * (-2011.370) (-2011.001) [-2011.946] (-1993.348) -- 0:01:52
      722000 -- (-1998.818) [-2006.987] (-2012.209) (-2008.522) * [-1999.925] (-2001.297) (-2001.060) (-2011.593) -- 0:01:52
      722500 -- [-1996.226] (-2012.663) (-2002.569) (-2002.610) * (-2014.554) [-1997.726] (-1997.505) (-2010.295) -- 0:01:52
      723000 -- (-2003.327) (-2011.455) [-2006.225] (-2009.093) * (-2020.172) [-2000.411] (-2002.248) (-2002.379) -- 0:01:51
      723500 -- (-2005.024) [-2004.647] (-2002.911) (-2004.040) * [-2003.276] (-2008.783) (-2008.946) (-2003.833) -- 0:01:51
      724000 -- (-2001.657) [-1996.661] (-2003.793) (-2003.484) * (-2014.433) [-2000.905] (-2010.100) (-2001.264) -- 0:01:51
      724500 -- (-2000.232) (-2004.517) [-1998.214] (-2008.321) * (-2013.687) [-2001.892] (-2002.608) (-2006.165) -- 0:01:51
      725000 -- (-2007.755) (-2015.703) [-2007.141] (-2012.410) * (-2010.191) [-2005.227] (-2009.763) (-2003.139) -- 0:01:51

      Average standard deviation of split frequencies: 0.012337

      725500 -- (-2003.706) (-2006.690) [-2008.522] (-1995.231) * (-2009.433) (-2008.147) [-2009.109] (-2003.730) -- 0:01:50
      726000 -- (-2012.600) [-1996.716] (-2016.614) (-1994.818) * (-2004.645) [-1998.259] (-2014.311) (-2008.963) -- 0:01:50
      726500 -- (-2005.444) (-1999.885) (-2017.342) [-2003.512] * (-2006.235) (-2009.223) (-2003.947) [-1996.286] -- 0:01:50
      727000 -- (-2014.958) (-2007.662) [-1999.064] (-2005.047) * (-2011.023) (-1999.787) (-2014.206) [-1997.771] -- 0:01:50
      727500 -- (-2003.378) [-2004.405] (-2004.323) (-2009.529) * (-2006.928) [-1995.047] (-2001.162) (-1999.582) -- 0:01:50
      728000 -- (-1998.354) (-2007.083) (-2009.375) [-2009.951] * [-2010.524] (-2003.255) (-2001.032) (-2008.967) -- 0:01:49
      728500 -- (-2005.657) (-2009.023) [-2004.819] (-2013.693) * (-2014.705) (-2015.049) [-1996.081] (-2002.770) -- 0:01:49
      729000 -- (-2009.536) [-2009.139] (-2003.361) (-2013.140) * (-2014.927) (-2013.045) (-1999.216) [-2002.572] -- 0:01:49
      729500 -- (-2014.718) (-2001.904) [-2001.114] (-2015.002) * (-2010.499) (-2005.996) (-2001.756) [-2005.351] -- 0:01:49
      730000 -- (-2008.554) (-2001.971) [-2004.453] (-2007.324) * [-2010.243] (-2013.304) (-1993.472) (-1998.544) -- 0:01:49

      Average standard deviation of split frequencies: 0.012299

      730500 -- (-2003.086) [-2005.046] (-2012.563) (-2003.810) * (-2012.639) (-2004.576) (-2002.132) [-2010.429] -- 0:01:48
      731000 -- (-2008.783) (-2003.057) (-1999.494) [-1995.765] * (-2007.006) [-1998.474] (-2014.533) (-2001.676) -- 0:01:48
      731500 -- (-2013.642) (-2012.799) (-2008.933) [-2007.219] * (-2005.588) (-2015.568) [-2005.695] (-2002.908) -- 0:01:48
      732000 -- [-2012.247] (-2000.915) (-2002.862) (-2002.342) * (-2005.856) (-1999.058) (-2003.972) [-2000.281] -- 0:01:48
      732500 -- [-2000.289] (-2005.921) (-2005.397) (-2011.165) * (-2014.062) [-2008.567] (-2003.020) (-2010.638) -- 0:01:48
      733000 -- (-2002.468) [-2003.620] (-2014.595) (-2016.779) * (-2013.406) (-2009.644) (-1998.430) [-2002.328] -- 0:01:47
      733500 -- (-2006.524) (-2013.572) [-2011.941] (-2005.077) * (-2009.563) (-2005.062) (-2006.885) [-1998.241] -- 0:01:47
      734000 -- (-2002.656) (-2017.119) (-2003.109) [-2005.610] * (-2008.420) (-1997.656) (-2000.531) [-2003.964] -- 0:01:47
      734500 -- (-2009.774) [-2002.485] (-2002.205) (-2003.252) * (-2017.398) (-2002.676) [-2003.371] (-2004.895) -- 0:01:47
      735000 -- (-2017.605) (-2003.223) [-1997.560] (-1994.850) * (-2000.619) [-2005.230] (-2006.020) (-1999.658) -- 0:01:47

      Average standard deviation of split frequencies: 0.011489

      735500 -- (-2005.944) (-2001.186) [-2002.723] (-2002.407) * (-2009.810) (-2005.535) (-2003.680) [-1996.109] -- 0:01:46
      736000 -- (-2007.137) [-1997.538] (-2006.042) (-2012.391) * (-2007.768) (-2001.907) (-2010.600) [-1996.123] -- 0:01:46
      736500 -- (-2004.813) (-2010.611) (-2007.851) [-2008.361] * (-2003.554) [-2005.100] (-1998.932) (-2007.110) -- 0:01:46
      737000 -- (-2001.116) (-1997.928) (-2002.344) [-1995.329] * [-1998.146] (-2001.637) (-2008.137) (-2006.593) -- 0:01:46
      737500 -- [-2005.924] (-2001.559) (-2005.447) (-2007.209) * (-2015.792) [-2010.454] (-2003.088) (-1996.193) -- 0:01:46
      738000 -- (-2005.024) [-1999.570] (-2004.160) (-2001.555) * (-2011.195) (-2011.280) (-2003.260) [-1992.944] -- 0:01:45
      738500 -- (-2011.895) (-2002.186) [-1999.909] (-2007.304) * (-2004.643) [-2006.441] (-2004.491) (-1997.320) -- 0:01:45
      739000 -- (-2018.206) (-2004.139) [-2005.051] (-2004.204) * (-2003.132) (-2013.499) [-2007.004] (-2007.587) -- 0:01:45
      739500 -- (-2009.989) (-2004.517) [-2000.133] (-2003.780) * [-2013.506] (-2019.095) (-2005.948) (-2007.821) -- 0:01:45
      740000 -- (-2015.881) (-2006.904) [-1999.198] (-2010.489) * (-2009.550) (-2013.905) (-2009.095) [-2006.443] -- 0:01:45

      Average standard deviation of split frequencies: 0.011695

      740500 -- [-2002.909] (-2010.763) (-2001.900) (-2005.634) * (-2001.988) (-2008.689) (-2005.904) [-2002.235] -- 0:01:44
      741000 -- [-1997.235] (-2012.999) (-2005.911) (-2013.146) * [-1999.998] (-2006.316) (-2000.258) (-2003.694) -- 0:01:44
      741500 -- (-2009.631) (-2002.436) [-2004.459] (-2002.599) * (-1996.606) [-2000.578] (-2011.842) (-2000.512) -- 0:01:44
      742000 -- (-2012.835) [-2000.499] (-2007.197) (-2007.453) * (-2002.046) [-2002.849] (-2008.341) (-2007.363) -- 0:01:44
      742500 -- (-2013.640) [-2000.627] (-2014.477) (-2007.455) * (-1992.795) (-1999.509) [-2005.785] (-2013.951) -- 0:01:44
      743000 -- (-2009.354) [-2002.164] (-2004.962) (-2007.160) * [-2005.720] (-2005.469) (-2010.167) (-2002.692) -- 0:01:43
      743500 -- [-1997.972] (-2006.574) (-2004.338) (-1998.544) * (-2004.209) (-2006.325) (-2010.191) [-2006.953] -- 0:01:43
      744000 -- (-2002.977) (-2011.894) (-2004.272) [-2002.729] * [-2003.404] (-2009.418) (-2016.137) (-2000.111) -- 0:01:43
      744500 -- (-2000.886) [-1999.408] (-2005.040) (-2015.810) * (-2002.496) (-2005.609) (-2006.974) [-1998.196] -- 0:01:43
      745000 -- [-2000.687] (-2007.443) (-2014.270) (-2014.638) * (-2000.942) (-2004.200) (-2015.028) [-1999.659] -- 0:01:43

      Average standard deviation of split frequencies: 0.011611

      745500 -- [-2005.655] (-1995.024) (-2011.950) (-2014.066) * (-2012.458) (-2015.641) (-2007.553) [-2006.560] -- 0:01:42
      746000 -- (-2011.112) [-2001.066] (-2003.749) (-2021.505) * (-2014.521) [-1995.545] (-2001.101) (-2016.035) -- 0:01:42
      746500 -- (-1998.892) (-2004.596) [-2000.949] (-2010.689) * (-2015.491) [-1994.601] (-2007.810) (-2003.483) -- 0:01:42
      747000 -- (-2011.452) (-2001.371) (-2012.829) [-2001.635] * (-2004.086) (-1999.741) (-2008.910) [-2005.237] -- 0:01:42
      747500 -- (-2004.808) (-2006.105) (-2015.471) [-1996.209] * (-2012.039) [-2002.538] (-2002.164) (-2008.661) -- 0:01:42
      748000 -- [-1997.776] (-2016.916) (-2011.915) (-2007.197) * [-2007.540] (-2014.351) (-2013.522) (-2020.194) -- 0:01:41
      748500 -- [-2000.963] (-2006.430) (-2013.959) (-2000.106) * [-2006.224] (-2005.213) (-2015.706) (-2024.774) -- 0:01:41
      749000 -- (-2006.585) (-1998.995) (-2009.620) [-1998.471] * (-2008.189) [-2004.314] (-2005.471) (-2010.936) -- 0:01:41
      749500 -- (-2008.948) (-2002.409) (-2001.182) [-1999.649] * (-2009.074) (-2003.415) [-2005.500] (-2003.338) -- 0:01:41
      750000 -- (-2002.717) [-2007.462] (-2005.911) (-2009.686) * [-2008.121] (-1997.013) (-2009.387) (-2013.635) -- 0:01:41

      Average standard deviation of split frequencies: 0.011147

      750500 -- (-2008.275) [-2001.828] (-2022.800) (-1997.339) * (-2012.309) [-1999.245] (-2001.011) (-2010.169) -- 0:01:40
      751000 -- (-2009.486) (-2000.718) (-2010.697) [-2007.084] * (-2005.995) [-2004.643] (-2012.721) (-2006.701) -- 0:01:40
      751500 -- (-2008.849) [-2007.302] (-2015.874) (-2004.840) * (-2007.370) [-2001.832] (-2007.286) (-2001.524) -- 0:01:40
      752000 -- (-2004.363) [-2009.070] (-2004.404) (-2000.642) * (-2015.462) (-2001.073) [-2009.268] (-1999.748) -- 0:01:40
      752500 -- (-2010.976) (-2006.470) (-2006.720) [-2008.139] * (-1994.840) [-2001.943] (-2006.020) (-2003.919) -- 0:01:39
      753000 -- (-2024.833) [-1996.141] (-2006.459) (-2006.457) * [-2002.919] (-2002.556) (-2000.468) (-2003.500) -- 0:01:39
      753500 -- (-2002.967) (-2012.859) (-2003.795) [-2009.242] * (-2005.910) (-2004.390) (-2001.961) [-2002.178] -- 0:01:39
      754000 -- (-2011.187) (-2015.239) (-2002.267) [-1999.650] * (-2013.969) (-1998.231) (-2011.740) [-2001.563] -- 0:01:39
      754500 -- (-2015.406) (-2014.047) [-2007.873] (-2003.820) * [-2002.701] (-2003.687) (-2012.809) (-2002.852) -- 0:01:39
      755000 -- (-2011.493) (-2004.294) [-2001.021] (-2003.408) * [-2001.669] (-2011.900) (-1999.262) (-2006.405) -- 0:01:38

      Average standard deviation of split frequencies: 0.011692

      755500 -- (-2004.266) [-2007.181] (-2009.318) (-2007.047) * (-2002.742) (-2007.636) (-2011.658) [-2002.900] -- 0:01:38
      756000 -- [-2000.974] (-2013.811) (-2015.453) (-2002.960) * (-2015.133) (-2004.930) [-1997.981] (-2001.802) -- 0:01:38
      756500 -- (-2008.564) (-1999.860) (-2006.050) [-1998.048] * (-2004.699) (-2006.815) [-2001.946] (-2002.332) -- 0:01:38
      757000 -- (-2013.057) (-2006.047) (-2009.538) [-2003.251] * (-2007.736) [-2004.354] (-2007.594) (-2011.196) -- 0:01:38
      757500 -- (-2009.684) [-2005.631] (-2004.468) (-2003.981) * (-2020.303) (-2006.930) [-2006.270] (-2006.061) -- 0:01:37
      758000 -- (-2001.767) (-2003.906) [-2003.195] (-2001.553) * (-2003.535) [-1994.708] (-2005.919) (-2001.755) -- 0:01:37
      758500 -- (-2009.227) (-2005.307) [-1996.754] (-2004.723) * (-2008.453) (-2001.043) [-1992.950] (-2022.542) -- 0:01:37
      759000 -- (-2019.101) (-1993.585) [-2002.612] (-1999.663) * (-2009.095) (-2012.891) [-1995.448] (-2004.304) -- 0:01:37
      759500 -- (-2012.285) (-2009.204) [-2002.080] (-2007.435) * (-2012.679) (-2020.412) (-1997.417) [-2005.205] -- 0:01:37
      760000 -- (-2003.260) [-2002.538] (-2001.993) (-2017.782) * (-2014.514) (-2008.200) (-2013.604) [-2011.599] -- 0:01:36

      Average standard deviation of split frequencies: 0.012395

      760500 -- (-2010.106) [-2008.295] (-2008.097) (-2028.818) * (-2020.511) (-2012.599) [-2007.687] (-2004.955) -- 0:01:36
      761000 -- (-2007.452) [-2001.514] (-1999.780) (-2011.900) * (-2011.568) [-2004.242] (-2011.366) (-2002.490) -- 0:01:36
      761500 -- [-2003.338] (-2009.240) (-2003.138) (-2013.653) * (-2011.836) [-2002.657] (-2007.521) (-2008.806) -- 0:01:36
      762000 -- [-1998.266] (-2007.834) (-2011.771) (-2013.097) * (-2007.006) [-2008.027] (-2000.709) (-1997.081) -- 0:01:36
      762500 -- (-2007.708) [-1999.431] (-2007.079) (-2002.018) * (-2009.519) (-1999.116) [-2002.188] (-2004.568) -- 0:01:35
      763000 -- [-2003.879] (-2000.565) (-2008.536) (-2006.571) * [-2001.928] (-2011.990) (-1999.368) (-2009.550) -- 0:01:35
      763500 -- (-2002.998) [-1997.301] (-2012.951) (-2008.242) * (-2001.281) (-2011.540) [-1999.028] (-2009.807) -- 0:01:35
      764000 -- (-2001.147) [-1997.485] (-2005.185) (-2006.024) * (-2010.487) (-2002.943) (-2021.584) [-2004.346] -- 0:01:35
      764500 -- [-2009.430] (-1999.815) (-2001.347) (-2001.908) * (-2008.002) [-1997.870] (-2010.729) (-2009.855) -- 0:01:35
      765000 -- (-2012.020) [-1994.174] (-2006.799) (-2001.619) * (-1997.130) (-2009.817) (-2000.923) [-2000.704] -- 0:01:34

      Average standard deviation of split frequencies: 0.012770

      765500 -- (-2004.355) (-1996.786) [-2005.246] (-2005.979) * (-2002.402) (-2001.672) [-1998.117] (-2003.004) -- 0:01:34
      766000 -- (-2004.477) (-2005.262) [-2014.294] (-2017.114) * [-2002.261] (-2009.642) (-2013.265) (-2011.080) -- 0:01:34
      766500 -- (-2003.303) (-2001.291) [-2011.868] (-2007.043) * [-1998.700] (-1996.993) (-1995.286) (-2006.767) -- 0:01:34
      767000 -- (-1999.490) (-2000.707) [-2002.046] (-2008.053) * (-1997.602) [-1994.947] (-2002.514) (-1999.230) -- 0:01:34
      767500 -- (-2003.219) (-2001.275) [-1998.636] (-2012.938) * (-2004.988) [-1998.310] (-2006.045) (-2014.188) -- 0:01:33
      768000 -- (-2016.960) (-2007.338) [-2000.283] (-2020.601) * (-2003.805) [-1999.557] (-2021.855) (-2018.153) -- 0:01:33
      768500 -- (-2015.090) [-2004.795] (-2000.166) (-2010.347) * [-2006.050] (-2006.922) (-2004.178) (-2008.485) -- 0:01:33
      769000 -- (-2012.643) (-2006.222) (-2008.950) [-1998.551] * [-1994.983] (-1999.395) (-2010.163) (-2008.437) -- 0:01:33
      769500 -- (-2022.824) (-2006.989) (-2003.803) [-2001.940] * [-2001.832] (-2006.388) (-2004.701) (-2015.060) -- 0:01:33
      770000 -- (-2007.143) (-2001.699) (-2002.528) [-2017.008] * (-2000.164) (-2010.850) [-2004.661] (-2005.086) -- 0:01:32

      Average standard deviation of split frequencies: 0.013572

      770500 -- (-2015.926) [-2005.392] (-2016.919) (-2009.258) * (-2005.298) (-2012.812) [-2005.270] (-2001.112) -- 0:01:32
      771000 -- [-1998.374] (-2013.972) (-2001.550) (-2011.607) * (-2007.402) (-2009.596) [-2001.300] (-2007.279) -- 0:01:32
      771500 -- (-2004.749) [-2000.474] (-1995.992) (-2010.993) * (-2013.357) [-1998.157] (-1995.377) (-1997.723) -- 0:01:32
      772000 -- (-2001.770) [-2000.765] (-2021.514) (-2005.602) * [-2003.747] (-2010.358) (-2009.048) (-2003.264) -- 0:01:32
      772500 -- (-2012.517) [-2000.184] (-2004.547) (-2021.025) * (-2009.106) (-2009.403) (-2011.093) [-1996.528] -- 0:01:31
      773000 -- (-2005.191) (-2001.592) [-1999.786] (-2014.585) * (-2002.134) (-1999.419) [-2004.804] (-1997.167) -- 0:01:31
      773500 -- (-2007.893) (-2008.245) [-2001.811] (-2004.183) * (-2014.011) (-1996.799) [-2003.579] (-1999.490) -- 0:01:31
      774000 -- (-2002.910) [-2001.299] (-2010.576) (-1997.520) * (-2011.071) (-2008.569) [-2011.589] (-2001.787) -- 0:01:31
      774500 -- (-2001.787) (-2007.225) [-2005.917] (-2001.320) * [-2004.936] (-2002.450) (-2004.930) (-2005.755) -- 0:01:31
      775000 -- (-2002.958) (-2016.542) (-1991.582) [-1997.135] * (-2011.149) (-2004.786) (-2000.059) [-1999.318] -- 0:01:30

      Average standard deviation of split frequencies: 0.013668

      775500 -- [-1999.689] (-2003.055) (-2004.284) (-2001.530) * (-2002.923) (-1995.644) [-1991.638] (-2010.194) -- 0:01:30
      776000 -- (-2009.990) (-2009.989) [-2009.553] (-2006.355) * (-2009.472) [-1993.363] (-1999.775) (-2031.009) -- 0:01:30
      776500 -- [-1997.816] (-2017.332) (-2010.166) (-2017.043) * [-2007.634] (-2012.634) (-1995.931) (-2006.655) -- 0:01:30
      777000 -- (-2002.486) [-1999.294] (-2012.039) (-2010.180) * (-2000.300) (-2010.646) (-2012.666) [-2005.599] -- 0:01:30
      777500 -- [-2006.169] (-2006.067) (-2011.323) (-2009.278) * [-2007.567] (-2015.127) (-2004.285) (-2021.395) -- 0:01:29
      778000 -- (-2011.413) (-2005.069) [-2002.174] (-2010.121) * (-2006.019) (-2013.484) [-1999.587] (-2011.865) -- 0:01:29
      778500 -- (-2022.451) [-2007.226] (-2006.496) (-2020.241) * (-2000.466) (-2013.580) (-2004.547) [-2003.398] -- 0:01:29
      779000 -- (-2012.191) [-1993.262] (-2009.483) (-2001.688) * (-2003.309) [-2002.902] (-2002.646) (-2008.813) -- 0:01:29
      779500 -- [-1997.528] (-2004.114) (-2007.415) (-2001.725) * [-1998.093] (-2002.222) (-2007.206) (-2004.358) -- 0:01:29
      780000 -- [-1998.290] (-2008.151) (-2005.790) (-2000.483) * (-2000.468) (-2009.318) [-2005.115] (-2010.981) -- 0:01:28

      Average standard deviation of split frequencies: 0.013926

      780500 -- [-2002.459] (-2006.882) (-2006.275) (-2005.923) * (-1996.745) [-2003.477] (-2009.119) (-2010.080) -- 0:01:28
      781000 -- (-2012.698) (-2004.823) [-2003.509] (-1998.517) * [-2008.392] (-2012.961) (-1999.220) (-2015.108) -- 0:01:28
      781500 -- (-2005.202) (-1997.805) (-2007.849) [-1999.556] * (-2013.212) (-2012.082) [-2007.084] (-2000.982) -- 0:01:28
      782000 -- [-2002.035] (-1998.137) (-2014.101) (-2008.860) * (-2012.541) (-2002.555) (-2000.198) [-2004.829] -- 0:01:27
      782500 -- (-2005.586) [-2003.452] (-2008.564) (-2013.634) * (-2001.570) (-2011.655) [-2005.348] (-2004.822) -- 0:01:27
      783000 -- (-2001.969) [-2004.078] (-2008.164) (-2010.417) * [-1998.250] (-2004.833) (-2001.896) (-2004.244) -- 0:01:27
      783500 -- (-2008.345) [-1999.256] (-2022.640) (-1997.529) * (-2000.640) (-2008.096) [-2010.844] (-2006.949) -- 0:01:27
      784000 -- (-2012.213) [-1995.346] (-2006.303) (-2000.324) * (-1996.760) (-2011.109) [-1997.790] (-2012.258) -- 0:01:27
      784500 -- (-2001.209) (-2013.208) (-1997.639) [-1995.816] * (-2004.254) [-2009.853] (-2008.139) (-2015.309) -- 0:01:26
      785000 -- (-1996.987) (-2004.823) [-2004.442] (-2001.990) * [-2002.081] (-2019.524) (-1994.670) (-2002.483) -- 0:01:26

      Average standard deviation of split frequencies: 0.013682

      785500 -- [-1997.259] (-2023.383) (-2012.680) (-2013.377) * (-2003.574) [-2001.570] (-2007.045) (-2008.876) -- 0:01:26
      786000 -- (-2002.609) [-1999.104] (-2001.197) (-2003.107) * (-2001.738) (-2008.432) (-1999.644) [-2005.968] -- 0:01:26
      786500 -- (-2005.755) (-2003.606) (-2004.016) [-2004.853] * (-2012.556) (-2007.461) [-2006.721] (-2005.016) -- 0:01:26
      787000 -- (-2007.666) (-2005.638) (-2004.178) [-2001.350] * [-1995.188] (-2006.003) (-2014.926) (-2005.309) -- 0:01:25
      787500 -- (-2001.254) (-2007.782) (-2004.891) [-2003.677] * (-2012.135) (-2001.148) [-2008.654] (-2010.185) -- 0:01:25
      788000 -- [-1997.828] (-1996.211) (-2014.957) (-2000.803) * [-2000.714] (-2007.257) (-2008.340) (-2006.236) -- 0:01:25
      788500 -- [-2003.342] (-2002.194) (-2027.892) (-1998.633) * (-1999.929) (-2013.446) [-1999.939] (-2001.756) -- 0:01:25
      789000 -- (-2006.272) [-1999.989] (-2014.701) (-1999.582) * (-2005.388) (-2021.091) [-2000.084] (-1997.787) -- 0:01:25
      789500 -- (-2020.948) (-1999.482) [-1993.185] (-2010.460) * (-2001.120) [-1996.672] (-2009.881) (-1999.162) -- 0:01:24
      790000 -- (-2019.135) (-2005.926) [-1997.929] (-2003.024) * (-2005.182) [-1997.478] (-2005.659) (-2007.874) -- 0:01:24

      Average standard deviation of split frequencies: 0.014607

      790500 -- [-2005.281] (-2002.352) (-2005.151) (-2007.580) * (-2022.199) (-2000.689) (-2015.839) [-2003.477] -- 0:01:24
      791000 -- (-2010.817) (-2008.509) (-2013.700) [-2004.297] * (-2021.771) (-2007.310) (-2009.917) [-2005.257] -- 0:01:24
      791500 -- (-2004.728) [-2015.438] (-2008.799) (-2000.215) * (-2006.145) (-2001.800) (-2019.787) [-2005.022] -- 0:01:24
      792000 -- (-2005.331) [-1996.215] (-2006.225) (-2011.073) * (-2006.811) (-2018.575) (-2000.370) [-2004.886] -- 0:01:23
      792500 -- [-2008.614] (-2003.052) (-1995.477) (-2014.653) * (-2020.606) (-1996.689) (-2004.536) [-2004.261] -- 0:01:23
      793000 -- (-2003.222) [-1999.906] (-2004.745) (-2003.993) * [-2001.116] (-2014.229) (-2010.749) (-2020.494) -- 0:01:23
      793500 -- (-2015.353) (-2000.981) [-1998.099] (-2000.265) * (-2004.946) (-2013.642) (-2015.349) [-2006.984] -- 0:01:23
      794000 -- (-2011.424) (-2006.426) [-2000.640] (-2009.822) * (-2010.508) (-2010.080) (-2005.720) [-2011.048] -- 0:01:23
      794500 -- (-2023.073) [-2003.203] (-2002.455) (-2007.096) * (-2011.131) (-2008.871) (-2005.348) [-2005.019] -- 0:01:22
      795000 -- (-2005.019) (-1995.964) [-2001.552] (-1995.099) * [-2000.636] (-2012.858) (-2006.070) (-2016.995) -- 0:01:22

      Average standard deviation of split frequencies: 0.014657

      795500 -- (-2000.211) (-1995.400) (-2008.562) [-2003.586] * (-2012.053) [-2000.090] (-2014.891) (-2017.697) -- 0:01:22
      796000 -- (-2009.965) [-1997.185] (-2012.730) (-2001.265) * (-2006.478) (-2002.840) [-2004.732] (-2005.281) -- 0:01:22
      796500 -- [-1994.245] (-2002.525) (-2009.809) (-2004.878) * (-2010.055) [-1992.782] (-2004.556) (-2001.287) -- 0:01:22
      797000 -- (-2002.140) (-2011.338) [-2006.999] (-1999.436) * (-1997.181) (-2007.628) [-1994.656] (-2013.974) -- 0:01:21
      797500 -- (-2000.394) (-2021.838) (-2004.896) [-1999.112] * (-1995.438) (-2003.181) [-2001.761] (-2010.435) -- 0:01:21
      798000 -- (-2011.209) (-2013.792) (-1993.894) [-2002.528] * (-2000.841) (-2016.164) (-2007.198) [-2002.627] -- 0:01:21
      798500 -- [-2004.106] (-2005.105) (-2022.168) (-2006.044) * (-2000.676) (-2005.470) [-2004.765] (-2004.444) -- 0:01:21
      799000 -- (-2010.579) (-2015.390) [-1992.969] (-2004.625) * (-2010.758) (-2014.098) [-2001.230] (-2007.093) -- 0:01:21
      799500 -- (-2007.153) (-1999.232) (-2006.306) [-2000.821] * (-2006.226) [-2005.657] (-2003.176) (-2005.284) -- 0:01:20
      800000 -- (-2000.819) (-2000.437) (-2008.630) [-2001.066] * [-2003.978] (-2019.486) (-2008.114) (-2006.736) -- 0:01:20

      Average standard deviation of split frequencies: 0.014682

      800500 -- (-1999.309) (-2008.491) [-2010.969] (-2012.392) * [-2002.411] (-2005.008) (-2006.551) (-2000.691) -- 0:01:20
      801000 -- (-2005.741) [-2010.216] (-1995.633) (-2014.812) * (-2014.689) (-2010.227) (-2000.842) [-2000.926] -- 0:01:20
      801500 -- (-2003.678) (-2000.758) [-1996.266] (-2020.017) * (-2004.403) (-2012.066) (-2009.058) [-2001.185] -- 0:01:19
      802000 -- [-2003.743] (-2002.570) (-2013.594) (-2004.127) * (-2015.362) (-2008.974) (-1999.614) [-2000.932] -- 0:01:19
      802500 -- (-1996.664) [-1996.270] (-2004.315) (-2007.577) * (-2014.566) (-2008.637) [-1999.707] (-2008.242) -- 0:01:19
      803000 -- (-2002.326) (-2011.187) (-2003.504) [-2004.277] * (-2001.515) (-2003.341) [-2002.976] (-2010.282) -- 0:01:19
      803500 -- [-1994.618] (-1999.634) (-2012.172) (-2014.388) * (-2003.473) (-2004.708) [-1998.639] (-2003.875) -- 0:01:19
      804000 -- [-1997.139] (-2001.040) (-2004.584) (-2009.258) * (-2008.923) (-2000.546) [-1999.832] (-2002.982) -- 0:01:18
      804500 -- [-2000.851] (-2016.436) (-2003.872) (-2001.663) * [-2012.332] (-2001.159) (-1999.184) (-2007.123) -- 0:01:18
      805000 -- [-1999.567] (-2001.825) (-2012.101) (-2015.984) * (-2025.480) (-2006.748) (-1999.948) [-2007.633] -- 0:01:18

      Average standard deviation of split frequencies: 0.014878

      805500 -- [-2004.235] (-2002.498) (-2006.032) (-2000.429) * (-2016.828) (-2021.233) (-2010.443) [-2004.017] -- 0:01:18
      806000 -- (-2015.706) (-2004.565) [-1995.525] (-2008.612) * (-1999.719) (-2025.346) [-2005.283] (-2001.095) -- 0:01:18
      806500 -- (-2002.545) (-2005.923) [-1994.684] (-2003.357) * [-2001.793] (-2011.978) (-2005.022) (-2006.293) -- 0:01:17
      807000 -- (-2002.556) (-1993.683) (-2004.983) [-2003.604] * (-2010.184) (-2010.621) [-2003.417] (-2007.024) -- 0:01:17
      807500 -- [-2003.772] (-2004.607) (-2004.056) (-2002.849) * (-2014.719) (-2007.712) [-2004.224] (-2006.832) -- 0:01:17
      808000 -- (-2014.142) [-2003.410] (-2003.188) (-2004.173) * (-2014.079) (-2007.557) (-2019.880) [-2000.829] -- 0:01:17
      808500 -- (-2008.706) (-2004.949) [-2007.829] (-2008.405) * (-2008.990) [-1997.503] (-2005.378) (-1994.725) -- 0:01:17
      809000 -- (-2003.778) (-2003.598) (-2014.876) [-2011.232] * [-2006.908] (-2006.766) (-2014.281) (-2001.379) -- 0:01:16
      809500 -- [-2001.221] (-2005.354) (-2004.837) (-2013.371) * (-2001.798) (-2005.261) (-2033.559) [-1996.537] -- 0:01:16
      810000 -- (-2003.572) (-2002.855) [-1999.238] (-2010.304) * (-2006.087) [-2007.874] (-2017.655) (-2007.194) -- 0:01:16

      Average standard deviation of split frequencies: 0.014683

      810500 -- [-2002.280] (-2006.246) (-2007.894) (-2010.112) * (-2002.201) (-2014.447) (-2001.683) [-2004.326] -- 0:01:16
      811000 -- (-2011.616) (-2011.380) [-2005.837] (-1999.798) * (-2006.757) (-2016.423) [-1998.081] (-2009.561) -- 0:01:16
      811500 -- (-2017.936) (-2011.828) [-1991.148] (-2003.156) * (-2000.355) (-2010.725) (-2006.759) [-2001.502] -- 0:01:15
      812000 -- (-2005.571) (-2007.724) [-2001.323] (-2012.560) * (-2014.889) (-1999.940) [-2005.093] (-2011.945) -- 0:01:15
      812500 -- [-2005.784] (-2003.105) (-2000.739) (-2019.858) * (-2013.974) [-2001.249] (-2007.484) (-2006.708) -- 0:01:15
      813000 -- [-2001.510] (-2003.600) (-2013.204) (-2012.791) * (-2017.560) (-2002.290) [-2002.653] (-2001.877) -- 0:01:15
      813500 -- [-2004.492] (-1997.494) (-2004.507) (-2008.421) * [-2002.822] (-1996.549) (-2014.738) (-2012.040) -- 0:01:15
      814000 -- [-1994.240] (-2003.610) (-2005.166) (-2007.433) * (-2010.528) [-1994.559] (-2010.758) (-2007.949) -- 0:01:14
      814500 -- (-2002.369) (-2001.968) [-2005.401] (-2011.331) * (-2006.487) (-2006.331) (-2003.170) [-2001.448] -- 0:01:14
      815000 -- (-2004.492) (-2003.607) [-1996.709] (-2000.029) * (-2002.049) [-2001.526] (-2010.629) (-2003.819) -- 0:01:14

      Average standard deviation of split frequencies: 0.015417

      815500 -- (-2002.362) (-2018.179) (-1997.241) [-1997.569] * [-1998.330] (-2001.196) (-2008.617) (-2021.333) -- 0:01:14
      816000 -- (-2001.694) (-2008.544) [-2003.442] (-1999.878) * (-1998.832) (-2012.775) [-2000.259] (-2018.234) -- 0:01:14
      816500 -- (-2006.388) (-2022.488) (-2006.757) [-2002.853] * (-1993.918) (-2005.546) [-2001.778] (-2011.690) -- 0:01:13
      817000 -- (-1995.790) (-2009.952) [-1997.480] (-2005.206) * [-1997.100] (-2001.968) (-2010.528) (-2010.105) -- 0:01:13
      817500 -- (-2012.335) (-2013.330) [-2011.341] (-2006.608) * [-2009.462] (-2016.149) (-1998.544) (-2009.829) -- 0:01:13
      818000 -- [-2010.947] (-2006.043) (-2008.284) (-2003.675) * (-2009.044) (-2005.524) (-2009.825) [-2014.313] -- 0:01:13
      818500 -- [-1996.298] (-2002.182) (-2017.311) (-2014.715) * (-2003.076) [-2012.546] (-2001.301) (-1999.490) -- 0:01:13
      819000 -- [-2001.279] (-2021.497) (-2018.092) (-2008.457) * (-2002.741) (-1998.532) [-2006.928] (-2006.962) -- 0:01:12
      819500 -- (-1998.968) [-2007.560] (-2008.127) (-2010.104) * (-2014.380) [-2006.220] (-2010.804) (-2008.817) -- 0:01:12
      820000 -- (-2008.518) (-2010.839) [-2002.945] (-2006.889) * [-1999.831] (-2000.104) (-2018.235) (-2016.392) -- 0:01:12

      Average standard deviation of split frequencies: 0.015150

      820500 -- (-2002.126) [-2006.734] (-2008.703) (-2003.320) * (-1997.461) [-2002.510] (-2006.923) (-2014.439) -- 0:01:12
      821000 -- [-2000.013] (-2010.750) (-2008.478) (-2009.397) * [-1998.675] (-2000.137) (-2006.779) (-2000.658) -- 0:01:12
      821500 -- (-2002.616) (-2022.387) (-2008.089) [-2006.254] * (-2006.211) (-1999.744) (-2003.669) [-2008.402] -- 0:01:11
      822000 -- (-2005.481) (-2002.466) [-1999.392] (-2003.406) * (-2003.380) (-2006.330) (-2009.779) [-1998.792] -- 0:01:11
      822500 -- [-2001.419] (-1999.789) (-2004.813) (-2003.965) * [-1995.664] (-2008.515) (-2011.198) (-2002.111) -- 0:01:11
      823000 -- (-2004.874) [-2006.051] (-2008.075) (-2009.107) * [-1998.667] (-2010.267) (-2014.075) (-2010.414) -- 0:01:11
      823500 -- (-1996.853) (-2009.260) (-2010.043) [-2012.578] * (-2001.756) (-2006.737) [-2004.541] (-2009.981) -- 0:01:11
      824000 -- [-1995.128] (-2005.423) (-2001.057) (-2002.426) * [-1999.176] (-2014.725) (-2002.148) (-2002.421) -- 0:01:10
      824500 -- [-1994.822] (-2012.933) (-2007.355) (-2000.651) * (-1999.453) (-2011.463) [-2009.481] (-2012.452) -- 0:01:10
      825000 -- [-1998.018] (-2011.488) (-2006.732) (-2008.716) * (-1999.512) (-2011.480) [-2001.417] (-1995.261) -- 0:01:10

      Average standard deviation of split frequencies: 0.015088

      825500 -- (-2007.197) (-1998.759) [-1997.017] (-2017.520) * [-2003.847] (-2012.864) (-2014.194) (-2008.483) -- 0:01:10
      826000 -- (-2018.175) (-2004.306) [-2001.298] (-2017.805) * [-1996.876] (-1999.616) (-2010.564) (-2007.888) -- 0:01:10
      826500 -- [-2006.750] (-1999.107) (-2006.853) (-2007.231) * (-2016.521) [-2000.934] (-1999.848) (-2013.905) -- 0:01:09
      827000 -- [-1995.689] (-2005.051) (-1994.860) (-1996.752) * (-2011.139) (-2011.144) (-2008.919) [-2009.554] -- 0:01:09
      827500 -- [-2003.132] (-2016.193) (-2002.974) (-2012.050) * (-2008.663) (-2001.382) [-1998.568] (-2005.654) -- 0:01:09
      828000 -- (-2013.905) (-1998.415) (-2005.777) [-2002.848] * (-2012.701) (-2004.010) [-1998.475] (-2004.160) -- 0:01:09
      828500 -- (-2019.393) (-2004.504) (-2001.818) [-1998.429] * (-2008.787) (-2002.053) [-1998.931] (-2003.692) -- 0:01:09
      829000 -- (-2011.585) (-1997.765) (-1999.656) [-1997.204] * [-2001.538] (-2005.727) (-2003.896) (-2004.535) -- 0:01:08
      829500 -- (-2005.124) [-2002.238] (-1999.958) (-2012.559) * (-2006.500) (-2007.294) (-2007.879) [-2005.499] -- 0:01:08
      830000 -- (-2006.416) (-1996.081) [-2005.462] (-2009.513) * (-1998.792) (-2008.503) (-2005.962) [-2009.111] -- 0:01:08

      Average standard deviation of split frequencies: 0.014861

      830500 -- (-2014.959) [-1997.053] (-1999.855) (-2012.785) * (-1996.404) (-2014.073) (-2007.909) [-2011.160] -- 0:01:08
      831000 -- (-2017.518) (-1999.410) [-1996.768] (-2021.116) * (-2004.669) [-2005.000] (-2000.737) (-2015.336) -- 0:01:08
      831500 -- [-2010.236] (-1998.635) (-1998.884) (-2012.526) * (-2006.483) (-1995.583) [-2001.917] (-2019.411) -- 0:01:07
      832000 -- (-2009.434) (-2002.175) (-1999.949) [-2009.023] * (-2005.135) (-2004.284) (-2004.888) [-2003.322] -- 0:01:07
      832500 -- (-2008.195) (-2006.999) (-2019.025) [-2006.371] * (-2004.879) (-2002.235) [-2000.330] (-2016.003) -- 0:01:07
      833000 -- (-2008.320) [-2005.739] (-2001.536) (-1993.499) * (-2009.581) [-2003.487] (-2012.156) (-2006.791) -- 0:01:07
      833500 -- (-2010.197) (-2006.394) (-2002.202) [-1996.738] * (-1996.329) [-1999.811] (-2018.115) (-2011.160) -- 0:01:07
      834000 -- (-2005.806) (-2000.042) (-2000.643) [-1999.032] * (-2005.062) (-2006.442) (-2003.409) [-2009.455] -- 0:01:06
      834500 -- (-2008.453) (-2000.545) (-2003.488) [-2008.313] * (-2001.096) [-1999.285] (-2003.307) (-2001.757) -- 0:01:06
      835000 -- [-1993.688] (-2013.357) (-2004.617) (-2020.452) * (-2005.806) (-2002.415) (-2006.556) [-2000.941] -- 0:01:06

      Average standard deviation of split frequencies: 0.014520

      835500 -- (-2008.886) (-2013.811) [-2002.305] (-2025.473) * (-2006.721) (-2003.905) [-2005.690] (-2004.579) -- 0:01:06
      836000 -- (-2006.938) (-2007.696) (-2002.129) [-2003.556] * (-2000.899) [-2001.657] (-2003.792) (-1997.446) -- 0:01:06
      836500 -- (-2002.122) [-2008.273] (-2010.646) (-2015.900) * (-2009.457) (-2003.668) (-2007.871) [-1994.694] -- 0:01:05
      837000 -- [-2005.978] (-2008.323) (-2005.770) (-2003.982) * (-2021.144) [-1996.592] (-2015.157) (-1997.571) -- 0:01:05
      837500 -- [-2003.380] (-2003.452) (-2004.987) (-2006.570) * (-2007.715) (-1998.328) (-2012.679) [-2005.310] -- 0:01:05
      838000 -- [-2007.896] (-2006.688) (-2001.638) (-2008.614) * (-2015.851) (-1999.575) (-2009.862) [-2000.937] -- 0:01:05
      838500 -- [-2001.377] (-2001.229) (-2003.976) (-2005.022) * [-2000.627] (-2021.656) (-2007.882) (-2015.736) -- 0:01:05
      839000 -- (-1999.259) [-2004.930] (-1998.505) (-2017.170) * (-2006.198) (-2012.399) (-1995.815) [-1998.526] -- 0:01:04
      839500 -- (-2008.898) (-2006.155) [-1997.805] (-2005.234) * (-2002.361) (-2003.042) (-1999.208) [-2005.430] -- 0:01:04
      840000 -- (-2008.879) [-2000.467] (-2000.960) (-2014.018) * (-1998.890) (-1999.510) [-2000.317] (-2013.243) -- 0:01:04

      Average standard deviation of split frequencies: 0.014790

      840500 -- [-1996.560] (-2004.213) (-2012.434) (-2011.655) * [-2001.197] (-2007.210) (-2009.503) (-2003.387) -- 0:01:04
      841000 -- (-2005.605) (-2005.752) [-2004.097] (-2013.412) * (-2006.889) (-2001.664) [-2008.223] (-2006.499) -- 0:01:04
      841500 -- (-1997.723) (-2003.387) (-2004.904) [-2013.789] * [-2003.509] (-2011.765) (-2005.451) (-2007.997) -- 0:01:03
      842000 -- [-1998.247] (-2006.704) (-2019.568) (-2012.759) * (-2009.786) (-2006.315) [-1997.341] (-2000.197) -- 0:01:03
      842500 -- (-1998.660) (-2021.251) (-2009.710) [-2008.484] * (-1999.240) (-2014.284) (-2015.480) [-1998.023] -- 0:01:03
      843000 -- (-2002.304) (-2010.134) [-2006.583] (-2022.201) * [-2001.902] (-2021.804) (-2002.587) (-2002.435) -- 0:01:03
      843500 -- (-2015.670) [-1996.570] (-2001.113) (-2008.672) * (-1996.283) (-2008.271) (-2004.300) [-2011.621] -- 0:01:03
      844000 -- (-2011.732) [-2013.677] (-2000.727) (-2015.093) * (-1996.192) [-2004.535] (-2011.484) (-2011.064) -- 0:01:02
      844500 -- (-2014.989) (-2007.475) [-2003.699] (-2011.486) * (-2001.465) (-2007.234) [-2002.903] (-2008.940) -- 0:01:02
      845000 -- (-2007.958) [-2005.905] (-2013.261) (-2001.889) * (-2013.216) (-2001.897) (-2014.725) [-2000.208] -- 0:01:02

      Average standard deviation of split frequencies: 0.015254

      845500 -- (-2009.231) [-2009.432] (-2005.591) (-1999.992) * (-2015.259) (-1999.687) [-2007.582] (-2006.500) -- 0:01:02
      846000 -- (-2010.571) (-2012.736) [-1996.689] (-2010.502) * (-2001.772) [-2001.170] (-2008.416) (-2004.998) -- 0:01:02
      846500 -- (-2003.766) [-2000.422] (-2003.186) (-2007.212) * (-2009.702) (-2008.841) [-1998.997] (-2012.321) -- 0:01:01
      847000 -- [-2003.125] (-2001.124) (-1995.821) (-2010.389) * [-2001.503] (-2005.737) (-2011.060) (-2006.962) -- 0:01:01
      847500 -- (-1999.698) [-2006.827] (-2004.366) (-2007.785) * (-2004.946) (-2014.052) [-2002.701] (-2009.626) -- 0:01:01
      848000 -- [-2003.063] (-2012.212) (-2002.985) (-2011.264) * (-2011.388) (-2013.619) (-2010.088) [-2003.161] -- 0:01:01
      848500 -- (-2023.719) (-2005.697) [-2002.424] (-2001.241) * [-2000.003] (-2007.196) (-2000.832) (-2004.748) -- 0:01:01
      849000 -- (-2011.835) [-2009.063] (-2004.560) (-2006.564) * (-2013.849) (-2011.709) (-1999.540) [-1996.587] -- 0:01:00
      849500 -- [-1998.045] (-2017.366) (-2005.206) (-1999.026) * (-2007.942) [-2006.514] (-1996.464) (-1998.045) -- 0:01:00
      850000 -- (-2001.593) (-2013.539) (-2002.157) [-2007.898] * (-2010.079) (-2009.517) [-1997.428] (-2006.596) -- 0:01:00

      Average standard deviation of split frequencies: 0.015101

      850500 -- [-1999.017] (-2000.130) (-2016.053) (-2002.216) * [-1999.889] (-2008.652) (-2012.890) (-2005.976) -- 0:01:00
      851000 -- (-2001.955) [-1997.562] (-2002.920) (-2008.776) * (-2004.516) (-2012.651) [-2008.971] (-2019.804) -- 0:01:00
      851500 -- [-2001.692] (-2006.239) (-1998.139) (-2016.957) * (-2001.503) (-2013.272) [-2001.134] (-2002.484) -- 0:00:59
      852000 -- [-1996.265] (-2001.504) (-2002.289) (-2010.181) * (-2000.229) [-2003.629] (-2012.264) (-2003.709) -- 0:00:59
      852500 -- (-2000.939) [-1997.567] (-2008.388) (-2005.085) * (-2003.954) (-2007.543) (-2007.064) [-2003.787] -- 0:00:59
      853000 -- (-2018.809) [-1992.048] (-2012.493) (-2004.035) * [-2008.679] (-2003.387) (-2006.029) (-1996.528) -- 0:00:59
      853500 -- (-2023.679) [-2007.568] (-2018.916) (-2006.860) * (-2023.093) [-1998.626] (-2001.218) (-2010.190) -- 0:00:59
      854000 -- (-2011.820) (-2010.008) (-2000.820) [-2005.752] * [-2006.303] (-2003.889) (-2004.256) (-2007.800) -- 0:00:58
      854500 -- [-2005.291] (-2004.394) (-2007.205) (-2014.153) * (-2002.374) (-2005.753) [-2005.927] (-2016.115) -- 0:00:58
      855000 -- [-2012.046] (-2006.467) (-2000.444) (-2011.256) * [-2007.664] (-2006.190) (-2013.119) (-1998.784) -- 0:00:58

      Average standard deviation of split frequencies: 0.014456

      855500 -- [-2000.840] (-2000.110) (-2009.489) (-2015.486) * [-2007.438] (-2007.881) (-2010.901) (-2015.201) -- 0:00:58
      856000 -- (-2003.136) (-2005.738) [-2004.780] (-2012.973) * (-2002.982) [-2001.043] (-2010.390) (-2007.308) -- 0:00:58
      856500 -- [-2013.224] (-1999.153) (-2005.388) (-2005.620) * (-2016.359) (-2008.335) [-2007.208] (-2002.232) -- 0:00:57
      857000 -- (-2009.866) (-2008.799) [-2004.412] (-2015.982) * (-2007.778) [-2004.566] (-2015.337) (-2007.661) -- 0:00:57
      857500 -- [-2008.603] (-2011.010) (-2000.521) (-2008.679) * (-2015.282) (-2005.792) (-2008.418) [-1996.503] -- 0:00:57
      858000 -- (-2011.856) (-2015.093) [-2006.599] (-2021.905) * (-2010.673) (-1998.991) [-2003.920] (-2004.519) -- 0:00:57
      858500 -- (-2010.440) (-2004.468) [-2004.484] (-2005.796) * (-2012.248) [-2010.721] (-1999.269) (-1997.740) -- 0:00:57
      859000 -- (-2006.951) (-2012.693) (-2004.827) [-2000.322] * (-2000.932) (-2005.596) [-2003.153] (-2014.758) -- 0:00:56
      859500 -- [-1999.440] (-2012.769) (-2002.679) (-2000.807) * [-2007.228] (-1999.907) (-2001.142) (-2009.264) -- 0:00:56
      860000 -- (-2005.230) (-2012.411) (-2012.709) [-1998.727] * (-2003.183) (-2000.326) (-2009.097) [-2000.807] -- 0:00:56

      Average standard deviation of split frequencies: 0.013214

      860500 -- [-2005.884] (-2018.875) (-2000.760) (-2010.637) * (-2002.957) (-2007.951) (-2007.232) [-2004.308] -- 0:00:56
      861000 -- (-2008.478) (-2000.042) [-2008.760] (-2008.905) * (-1995.882) [-2003.851] (-2007.616) (-2012.082) -- 0:00:56
      861500 -- [-2018.062] (-2025.429) (-2009.846) (-2007.286) * [-1995.660] (-2004.018) (-2002.475) (-2012.903) -- 0:00:55
      862000 -- (-2009.360) [-2000.308] (-2007.193) (-2001.857) * (-1997.557) (-2008.953) [-1999.838] (-2015.547) -- 0:00:55
      862500 -- (-2017.380) (-2023.848) (-2011.044) [-2009.972] * (-2005.221) (-2003.197) [-2001.733] (-2009.130) -- 0:00:55
      863000 -- [-2003.682] (-2003.911) (-2011.690) (-2013.888) * [-1997.849] (-1999.621) (-2012.984) (-2009.600) -- 0:00:55
      863500 -- [-2002.486] (-2006.055) (-2012.146) (-2004.036) * [-2003.172] (-2013.204) (-1996.871) (-2009.983) -- 0:00:55
      864000 -- (-2006.980) (-2000.594) (-2004.026) [-2001.070] * (-2005.235) [-2009.303] (-2010.233) (-1997.242) -- 0:00:54
      864500 -- (-2014.152) (-2012.428) [-2000.876] (-2011.346) * (-2000.352) [-2011.521] (-2013.093) (-2006.872) -- 0:00:54
      865000 -- (-2013.994) (-2024.181) [-1997.540] (-2003.198) * (-2003.930) (-2008.530) [-2007.191] (-2007.244) -- 0:00:54

      Average standard deviation of split frequencies: 0.013643

      865500 -- (-2029.481) (-2003.668) [-2016.297] (-2001.012) * (-2010.589) [-1997.644] (-2011.756) (-2012.833) -- 0:00:54
      866000 -- (-2016.453) (-2005.268) [-2003.708] (-2005.400) * [-1999.290] (-2018.499) (-2002.086) (-2001.659) -- 0:00:54
      866500 -- [-2007.329] (-2003.834) (-2001.787) (-2022.875) * (-2007.954) [-1998.368] (-2006.197) (-2018.151) -- 0:00:53
      867000 -- [-1999.017] (-1996.535) (-2013.843) (-2006.355) * (-2023.010) [-1999.952] (-2010.200) (-1999.334) -- 0:00:53
      867500 -- (-2008.092) [-1999.636] (-2011.014) (-2010.339) * (-2011.495) (-2000.415) (-2011.248) [-1993.813] -- 0:00:53
      868000 -- (-2014.552) (-2007.329) (-2009.179) [-1999.194] * (-2018.866) (-2000.479) (-2006.800) [-2005.289] -- 0:00:53
      868500 -- [-2003.221] (-2002.020) (-2009.856) (-2009.327) * (-2017.236) (-1997.576) [-2004.466] (-1998.335) -- 0:00:52
      869000 -- (-2000.124) [-1999.659] (-2014.250) (-2001.222) * (-2012.687) (-2000.128) [-2001.965] (-2000.765) -- 0:00:52
      869500 -- (-2004.112) (-2003.495) (-2004.749) [-1994.374] * (-2002.358) (-2004.599) [-1998.917] (-2009.963) -- 0:00:52
      870000 -- [-1999.901] (-2007.261) (-2006.397) (-2005.758) * (-2014.243) [-2003.765] (-2009.720) (-2008.477) -- 0:00:52

      Average standard deviation of split frequencies: 0.013367

      870500 -- (-2008.737) [-2003.798] (-1999.853) (-2004.235) * (-2002.775) (-2010.705) (-1996.578) [-1999.755] -- 0:00:52
      871000 -- (-2009.067) [-1999.672] (-2002.106) (-1999.670) * (-2003.188) (-2007.074) [-1996.398] (-2003.811) -- 0:00:51
      871500 -- (-2013.018) [-2003.041] (-2016.682) (-2001.256) * (-2002.861) [-2000.689] (-2001.943) (-2007.424) -- 0:00:51
      872000 -- (-2011.830) (-2007.254) [-2006.192] (-2006.961) * [-2003.082] (-2004.221) (-2014.483) (-1995.243) -- 0:00:51
      872500 -- (-2025.890) (-2010.799) (-2002.732) [-1996.409] * (-2001.845) (-2012.714) [-2007.450] (-1998.514) -- 0:00:51
      873000 -- [-2004.940] (-2009.103) (-2015.633) (-2000.907) * (-2003.086) (-2008.479) [-2005.331] (-2011.027) -- 0:00:51
      873500 -- (-2013.984) (-2007.449) (-2003.251) [-2002.716] * (-2002.659) (-2009.326) (-2018.253) [-2011.801] -- 0:00:50
      874000 -- (-2002.321) (-2008.919) (-2001.586) [-2009.452] * (-2010.691) (-2007.431) [-2003.473] (-2007.644) -- 0:00:50
      874500 -- (-2002.460) (-2007.427) [-2011.405] (-2003.348) * [-2008.529] (-2005.544) (-2011.977) (-2010.472) -- 0:00:50
      875000 -- (-2009.950) (-2017.053) (-2008.702) [-2011.319] * (-2012.468) (-2017.394) (-2000.304) [-2004.203] -- 0:00:50

      Average standard deviation of split frequencies: 0.014429

      875500 -- (-2005.845) (-2006.707) [-2003.232] (-2010.346) * [-2002.380] (-1997.098) (-2006.634) (-2016.006) -- 0:00:50
      876000 -- (-2014.924) (-2014.681) [-2000.927] (-1996.959) * (-2003.615) [-2007.484] (-2008.706) (-2019.821) -- 0:00:49
      876500 -- [-2008.686] (-2007.845) (-2008.313) (-2003.198) * (-2004.849) [-1999.497] (-2010.166) (-2010.628) -- 0:00:49
      877000 -- (-2012.064) (-2002.262) [-2004.157] (-2003.457) * (-1998.886) (-2010.476) [-2000.610] (-2001.108) -- 0:00:49
      877500 -- (-2012.617) (-1994.606) (-2006.232) [-1999.322] * [-2013.143] (-1997.520) (-2000.658) (-2013.403) -- 0:00:49
      878000 -- [-1997.721] (-2011.284) (-2003.685) (-2003.743) * (-2001.870) [-2003.998] (-1998.703) (-1998.332) -- 0:00:49
      878500 -- (-2000.648) [-1998.378] (-2009.965) (-2002.795) * (-2017.380) [-2000.799] (-2012.920) (-2010.346) -- 0:00:48
      879000 -- (-2001.113) [-2008.043] (-2009.630) (-2004.184) * (-2005.611) [-2000.661] (-2017.733) (-2012.129) -- 0:00:48
      879500 -- (-2007.060) [-2006.571] (-1999.720) (-2008.987) * (-1995.900) (-2002.948) (-2005.102) [-2003.525] -- 0:00:48
      880000 -- [-1999.467] (-2006.554) (-1995.681) (-1999.511) * (-2005.281) [-1998.642] (-2004.722) (-2002.441) -- 0:00:48

      Average standard deviation of split frequencies: 0.014954

      880500 -- (-2003.639) (-2005.524) (-2000.003) [-2004.150] * (-1999.226) (-2013.759) [-1998.104] (-2006.227) -- 0:00:48
      881000 -- (-2005.898) (-2007.822) [-1998.264] (-2002.278) * (-1996.961) (-2005.307) [-1998.582] (-2007.179) -- 0:00:47
      881500 -- (-2008.035) (-2005.702) [-2003.065] (-2010.954) * (-1998.604) [-2008.625] (-2000.151) (-2010.321) -- 0:00:47
      882000 -- (-1993.145) (-2005.524) [-1996.769] (-2008.775) * [-1997.659] (-2008.560) (-2005.269) (-2001.526) -- 0:00:47
      882500 -- (-2009.572) (-2018.311) (-2001.652) [-1998.249] * (-2017.055) [-2005.028] (-1998.096) (-2004.115) -- 0:00:47
      883000 -- [-2003.179] (-2015.587) (-2001.517) (-2003.919) * (-2005.844) [-2003.092] (-2014.040) (-1998.624) -- 0:00:47
      883500 -- [-2000.680] (-2004.001) (-2002.311) (-2012.841) * (-1999.972) (-2001.579) (-2007.295) [-1999.393] -- 0:00:46
      884000 -- [-2000.700] (-2013.744) (-2006.592) (-1997.200) * (-2007.170) (-2002.784) [-1995.992] (-2013.473) -- 0:00:46
      884500 -- (-2000.532) (-2000.984) [-2005.798] (-2010.218) * (-2011.224) (-2015.514) (-2008.798) [-1998.885] -- 0:00:46
      885000 -- (-2002.634) (-2006.700) [-2002.390] (-2017.095) * (-1994.795) [-1995.830] (-2003.758) (-2004.846) -- 0:00:46

      Average standard deviation of split frequencies: 0.014964

      885500 -- (-2001.509) [-2012.000] (-2009.093) (-2007.730) * (-2004.879) (-2005.253) [-2006.761] (-2007.179) -- 0:00:46
      886000 -- (-2010.213) (-1995.896) [-1996.703] (-2017.063) * [-2008.789] (-2010.871) (-2010.648) (-2003.551) -- 0:00:45
      886500 -- (-2005.002) (-2003.309) [-2008.423] (-2004.098) * (-2005.035) (-2012.122) [-2012.883] (-2003.389) -- 0:00:45
      887000 -- (-1994.223) (-2014.094) (-2013.155) [-1994.084] * (-1998.941) [-2003.898] (-2007.355) (-2014.335) -- 0:00:45
      887500 -- [-2000.169] (-2005.240) (-1998.802) (-2001.039) * (-1998.842) (-2007.848) (-2000.777) [-2015.176] -- 0:00:45
      888000 -- [-2006.450] (-2012.049) (-2006.118) (-2004.409) * (-2002.469) (-2008.607) [-2004.967] (-2005.131) -- 0:00:45
      888500 -- [-2008.125] (-2002.450) (-2011.337) (-2007.204) * [-2004.094] (-2009.581) (-2010.478) (-2002.470) -- 0:00:44
      889000 -- (-2015.466) (-2006.558) [-2003.030] (-2008.020) * (-2007.612) [-2006.803] (-1996.818) (-2003.666) -- 0:00:44
      889500 -- (-2000.811) (-2007.918) [-1995.418] (-2006.027) * (-2007.731) [-2003.606] (-1995.950) (-2002.415) -- 0:00:44
      890000 -- (-2010.542) [-2007.725] (-2005.821) (-2002.057) * [-2005.610] (-2005.875) (-2013.937) (-2002.133) -- 0:00:44

      Average standard deviation of split frequencies: 0.014588

      890500 -- [-1999.626] (-1998.502) (-2010.185) (-2000.567) * [-2008.347] (-2003.976) (-2004.116) (-2005.784) -- 0:00:44
      891000 -- [-2004.149] (-2009.510) (-2006.284) (-2001.238) * (-2011.541) (-2009.769) (-2002.343) [-2007.303] -- 0:00:43
      891500 -- (-2012.215) (-2007.712) (-2011.785) [-2000.748] * (-1997.207) (-2014.139) [-2003.481] (-2004.815) -- 0:00:43
      892000 -- (-2003.577) [-1996.435] (-2006.406) (-2004.439) * (-2006.515) (-2004.895) (-2012.345) [-2004.383] -- 0:00:43
      892500 -- (-1996.011) (-2002.599) [-2003.728] (-2014.309) * (-2006.562) (-2015.524) (-2001.699) [-1997.083] -- 0:00:43
      893000 -- (-2011.627) [-1997.205] (-2008.248) (-2005.739) * (-2014.018) [-2011.285] (-2005.694) (-2006.165) -- 0:00:43
      893500 -- (-2000.199) [-2000.483] (-2004.687) (-2004.619) * [-1998.560] (-2013.900) (-2011.564) (-2000.427) -- 0:00:42
      894000 -- (-2014.053) (-2003.785) [-2002.972] (-2004.655) * (-2003.101) [-1996.214] (-2012.246) (-2000.598) -- 0:00:42
      894500 -- [-2004.606] (-2005.587) (-2008.953) (-2006.878) * (-1998.183) [-2000.679] (-2010.672) (-2003.632) -- 0:00:42
      895000 -- (-2008.773) [-2002.414] (-2010.994) (-1996.275) * (-2007.890) [-2005.369] (-1998.850) (-1999.248) -- 0:00:42

      Average standard deviation of split frequencies: 0.014994

      895500 -- (-2012.543) (-2011.816) (-2001.133) [-2001.107] * (-2000.712) [-1998.423] (-2003.780) (-2006.338) -- 0:00:42
      896000 -- (-2008.465) (-2004.371) (-2005.923) [-2006.724] * (-2002.551) [-2000.249] (-2002.232) (-2009.021) -- 0:00:41
      896500 -- [-2002.729] (-2021.344) (-1999.094) (-2005.441) * (-2013.345) (-2005.845) [-1993.646] (-2010.857) -- 0:00:41
      897000 -- (-2003.340) (-2021.153) (-2006.606) [-2003.375] * (-2007.936) [-2005.909] (-2008.162) (-2002.176) -- 0:00:41
      897500 -- (-2005.628) (-2010.421) [-2005.697] (-2010.981) * (-2002.008) (-2019.250) (-2005.320) [-1991.997] -- 0:00:41
      898000 -- [-1996.280] (-2005.558) (-2015.129) (-2002.896) * (-2006.741) (-2000.744) [-2000.463] (-2003.391) -- 0:00:41
      898500 -- [-1999.848] (-1996.117) (-2010.790) (-2003.877) * [-1995.141] (-2006.524) (-2000.752) (-2009.706) -- 0:00:40
      899000 -- (-1993.918) (-2007.041) (-2008.731) [-2002.264] * (-2016.144) [-2006.063] (-2004.310) (-2002.518) -- 0:00:40
      899500 -- [-2000.623] (-1999.750) (-2011.699) (-2000.534) * (-2005.335) [-2003.048] (-2015.591) (-2003.022) -- 0:00:40
      900000 -- (-2007.885) (-2000.639) (-2001.810) [-1999.976] * (-2006.945) (-2006.873) [-2006.402] (-2000.508) -- 0:00:40

      Average standard deviation of split frequencies: 0.015538

      900500 -- (-2009.677) (-2003.825) (-2031.433) [-2002.648] * (-2001.747) (-2007.652) [-1998.306] (-2002.657) -- 0:00:40
      901000 -- [-2008.618] (-1997.023) (-2003.677) (-2014.340) * [-2000.094] (-2006.232) (-1998.022) (-2005.101) -- 0:00:39
      901500 -- [-2002.231] (-2001.136) (-2015.045) (-2012.180) * (-2006.191) (-2006.767) (-1997.551) [-2003.253] -- 0:00:39
      902000 -- (-2004.881) (-2008.451) (-2000.697) [-2009.556] * (-1999.199) (-2006.013) (-2005.169) [-1998.964] -- 0:00:39
      902500 -- (-2012.473) (-2005.025) [-2006.654] (-2007.689) * (-2004.018) (-2004.184) [-2000.306] (-1997.686) -- 0:00:39
      903000 -- (-2001.811) (-1999.739) (-2001.507) [-2003.201] * (-2012.187) (-2000.293) (-2005.441) [-2000.790] -- 0:00:39
      903500 -- (-2013.910) (-2005.344) [-1997.052] (-2008.986) * (-2011.364) [-2008.067] (-2017.178) (-2006.524) -- 0:00:38
      904000 -- (-1998.224) [-2002.425] (-2013.212) (-2011.628) * (-2005.397) [-2006.376] (-2006.415) (-2008.050) -- 0:00:38
      904500 -- (-2016.991) [-2000.264] (-2003.519) (-1999.541) * (-2001.982) (-2011.491) [-2013.142] (-2006.551) -- 0:00:38
      905000 -- (-2005.034) (-2007.212) (-2011.034) [-2001.215] * (-2007.195) (-2006.688) (-2005.499) [-1999.641] -- 0:00:38

      Average standard deviation of split frequencies: 0.014894

      905500 -- (-2014.861) [-1998.575] (-2011.136) (-2007.092) * (-2007.448) (-2004.967) [-2003.443] (-2001.471) -- 0:00:38
      906000 -- (-2002.456) (-2000.932) (-2001.106) [-2000.174] * [-1995.745] (-2011.843) (-2015.507) (-2005.852) -- 0:00:37
      906500 -- (-2003.795) (-2009.802) (-2002.494) [-2005.575] * (-2006.980) [-1999.139] (-2005.222) (-2006.719) -- 0:00:37
      907000 -- (-2008.698) (-1998.637) [-2000.255] (-2008.163) * (-2011.015) (-1998.543) (-2001.540) [-2003.575] -- 0:00:37
      907500 -- [-2003.151] (-2018.274) (-2010.805) (-2005.776) * (-2009.024) [-1994.192] (-2010.840) (-2004.863) -- 0:00:37
      908000 -- (-2001.933) (-2010.742) (-2000.903) [-2007.707] * (-2007.186) [-2000.595] (-2007.210) (-2003.249) -- 0:00:37
      908500 -- (-1998.398) [-2002.631] (-2003.586) (-2018.610) * (-2008.391) (-2003.425) [-2008.602] (-2000.124) -- 0:00:36
      909000 -- (-2002.649) [-2001.542] (-2012.930) (-2007.521) * (-2001.916) (-2013.892) [-1999.914] (-2006.225) -- 0:00:36
      909500 -- [-2007.518] (-2003.854) (-2010.455) (-2019.500) * [-2007.990] (-2004.855) (-2005.046) (-2010.689) -- 0:00:36
      910000 -- (-1998.448) (-2007.778) [-2008.482] (-2016.196) * [-1994.906] (-2022.635) (-2001.983) (-2019.189) -- 0:00:36

      Average standard deviation of split frequencies: 0.015303

      910500 -- (-2010.831) (-2005.730) [-2011.128] (-2013.281) * [-2001.665] (-2009.235) (-1999.821) (-2001.983) -- 0:00:36
      911000 -- (-2009.903) (-2003.448) [-2013.310] (-2012.409) * (-2011.794) (-2008.144) (-2012.581) [-2002.020] -- 0:00:35
      911500 -- [-2002.485] (-1999.953) (-2015.665) (-2009.186) * (-2006.330) (-2006.966) [-1999.890] (-2001.483) -- 0:00:35
      912000 -- (-2004.218) [-2001.548] (-2004.464) (-2017.055) * [-1994.335] (-1999.093) (-2006.775) (-2028.048) -- 0:00:35
      912500 -- (-2004.336) (-1999.713) (-2023.769) [-2005.379] * (-2008.977) (-1997.438) [-2003.203] (-2011.762) -- 0:00:35
      913000 -- (-2008.447) (-1997.211) [-2006.485] (-2015.864) * (-2009.862) [-2003.239] (-2005.834) (-2006.979) -- 0:00:35
      913500 -- [-2004.301] (-1998.582) (-2004.253) (-2004.367) * (-2003.839) (-2015.690) (-2000.116) [-2018.480] -- 0:00:34
      914000 -- (-2008.740) [-1997.224] (-2002.679) (-2009.833) * (-2011.775) (-2002.371) [-2004.746] (-2001.763) -- 0:00:34
      914500 -- (-2009.401) (-2015.182) [-2001.984] (-2009.412) * (-2018.764) (-1997.757) [-2004.461] (-2012.177) -- 0:00:34
      915000 -- [-2002.775] (-2013.886) (-2008.151) (-2005.386) * [-2004.461] (-1992.801) (-2003.974) (-2001.403) -- 0:00:34

      Average standard deviation of split frequencies: 0.014989

      915500 -- (-2005.714) (-1997.588) (-2006.672) [-2008.566] * (-1997.622) (-1996.111) [-2000.160] (-2010.877) -- 0:00:34
      916000 -- (-2025.320) [-2002.587] (-2009.584) (-2001.489) * (-2008.859) [-1997.590] (-1998.254) (-2015.866) -- 0:00:33
      916500 -- (-2013.636) (-2010.340) [-1996.541] (-2004.167) * (-2007.212) [-2009.339] (-2019.942) (-2003.651) -- 0:00:33
      917000 -- (-2004.148) (-2007.465) (-1999.594) [-2000.974] * (-2002.553) [-2010.706] (-2007.903) (-2001.841) -- 0:00:33
      917500 -- (-2001.460) (-2005.000) [-2004.910] (-2001.952) * [-2003.199] (-2006.470) (-2006.698) (-2005.738) -- 0:00:33
      918000 -- (-2000.551) (-2003.589) [-2002.459] (-2000.406) * (-2003.705) [-2013.367] (-2002.901) (-2017.213) -- 0:00:33
      918500 -- (-1999.258) (-2011.284) (-1999.384) [-2001.206] * (-2006.703) [-2001.627] (-2000.801) (-2020.379) -- 0:00:32
      919000 -- [-1998.587] (-1998.817) (-2010.363) (-2002.341) * [-2002.979] (-2001.599) (-2011.702) (-2001.784) -- 0:00:32
      919500 -- (-2009.242) [-2000.356] (-2004.870) (-1998.789) * [-1996.324] (-1998.414) (-2011.972) (-2013.807) -- 0:00:32
      920000 -- (-2009.468) [-2009.798] (-2015.470) (-2000.993) * (-1999.288) [-1996.500] (-2012.692) (-2018.652) -- 0:00:32

      Average standard deviation of split frequencies: 0.015841

      920500 -- [-1999.888] (-2024.522) (-2008.838) (-2001.866) * (-2004.901) (-2006.866) (-2001.118) [-2000.568] -- 0:00:32
      921000 -- (-2013.368) [-2005.329] (-2006.505) (-1994.282) * [-1999.005] (-2004.678) (-2005.740) (-2010.512) -- 0:00:31
      921500 -- (-2013.988) (-2003.853) (-1998.310) [-1995.991] * (-2014.740) [-2006.293] (-2004.127) (-2004.672) -- 0:00:31
      922000 -- (-2012.491) (-2014.211) [-1999.329] (-2005.791) * (-2007.180) (-2001.705) [-1998.136] (-2018.260) -- 0:00:31
      922500 -- [-2009.839] (-2007.977) (-2008.315) (-2000.319) * (-2005.342) [-1996.177] (-2004.362) (-2023.109) -- 0:00:31
      923000 -- (-2016.422) (-2008.731) (-1996.396) [-2006.672] * (-1993.737) (-2004.980) (-2000.956) [-2011.814] -- 0:00:31
      923500 -- (-1999.591) [-2003.201] (-1999.193) (-2001.116) * (-2007.336) [-2003.267] (-2005.073) (-2014.202) -- 0:00:30
      924000 -- (-2010.912) (-2003.846) (-2001.005) [-2011.314] * (-2003.186) (-1999.598) (-1998.488) [-1996.318] -- 0:00:30
      924500 -- (-2016.339) (-2004.687) [-2004.400] (-2010.611) * [-2000.763] (-1999.938) (-2008.853) (-2001.803) -- 0:00:30
      925000 -- (-2010.686) (-2002.835) [-2002.327] (-2009.112) * [-2001.829] (-1997.640) (-2001.552) (-2014.415) -- 0:00:30

      Average standard deviation of split frequencies: 0.015972

      925500 -- (-2006.894) (-2020.079) (-2011.025) [-2002.934] * (-1999.702) [-2004.114] (-2012.281) (-2013.191) -- 0:00:30
      926000 -- (-2006.473) [-2017.507] (-2006.837) (-2006.478) * (-1999.795) [-2006.796] (-2005.495) (-2013.443) -- 0:00:29
      926500 -- (-2006.099) (-2010.997) [-2001.072] (-2006.145) * [-2001.652] (-2012.945) (-2006.735) (-2011.856) -- 0:00:29
      927000 -- (-2003.682) [-2005.776] (-2013.010) (-2010.770) * [-2006.063] (-2006.914) (-2010.632) (-1996.875) -- 0:00:29
      927500 -- (-2006.793) (-1992.420) [-2002.489] (-2006.228) * (-2010.929) (-2009.897) (-2008.010) [-2004.863] -- 0:00:29
      928000 -- [-2012.391] (-1999.520) (-2005.330) (-2002.867) * (-2025.166) (-2008.616) (-2005.557) [-2006.800] -- 0:00:29
      928500 -- (-2011.465) [-2010.564] (-2005.455) (-2000.848) * (-2012.888) (-1996.766) [-2007.809] (-2007.969) -- 0:00:28
      929000 -- (-2015.652) (-1999.698) [-2013.987] (-2011.338) * (-2010.556) [-2001.924] (-2005.079) (-2005.622) -- 0:00:28
      929500 -- (-2014.856) [-1998.238] (-2012.817) (-2003.174) * (-2010.108) (-2011.293) [-1997.803] (-2008.351) -- 0:00:28
      930000 -- (-2018.956) [-1998.603] (-2010.835) (-2010.505) * (-2001.024) [-1991.469] (-2002.957) (-2021.969) -- 0:00:28

      Average standard deviation of split frequencies: 0.015797

      930500 -- (-1998.147) (-2014.728) (-2018.167) [-2006.099] * (-2011.845) [-2001.704] (-1997.590) (-2027.917) -- 0:00:28
      931000 -- [-2008.822] (-2010.061) (-2014.313) (-2010.707) * (-2005.697) (-2003.738) (-2003.505) [-1999.644] -- 0:00:27
      931500 -- (-2007.392) (-2009.727) (-2004.073) [-2005.062] * (-2013.498) [-1996.791] (-1998.277) (-2010.156) -- 0:00:27
      932000 -- (-2023.358) (-2019.034) [-1995.954] (-2017.579) * (-2013.125) [-2002.670] (-2004.837) (-2013.739) -- 0:00:27
      932500 -- (-2006.057) (-2005.597) (-2003.711) [-2001.723] * (-2006.643) (-2003.200) [-1999.028] (-2020.830) -- 0:00:27
      933000 -- (-2002.898) (-2001.860) (-2014.475) [-2003.058] * (-2000.001) [-2002.767] (-2006.637) (-2010.953) -- 0:00:27
      933500 -- [-2006.303] (-2006.338) (-2005.966) (-2007.127) * [-2003.335] (-2013.783) (-2008.159) (-2027.604) -- 0:00:26
      934000 -- (-2001.385) (-2002.716) (-2010.963) [-2007.376] * (-2008.059) (-2007.788) [-2012.500] (-2018.656) -- 0:00:26
      934500 -- (-2015.652) [-2001.873] (-2001.023) (-2004.828) * [-2001.849] (-2011.363) (-2008.066) (-2009.735) -- 0:00:26
      935000 -- (-2004.836) [-1997.902] (-2016.607) (-2007.166) * (-2007.166) (-2023.805) [-1997.342] (-2010.607) -- 0:00:26

      Average standard deviation of split frequencies: 0.015676

      935500 -- (-2008.759) (-2008.291) [-2000.140] (-2003.466) * [-2002.183] (-2014.956) (-2019.756) (-2014.825) -- 0:00:25
      936000 -- [-2003.058] (-2006.676) (-2010.844) (-2003.230) * (-2011.626) (-2017.054) (-1999.521) [-2000.036] -- 0:00:25
      936500 -- (-2009.229) (-2000.787) (-2006.188) [-2002.115] * (-1999.156) [-2004.970] (-2011.457) (-2002.883) -- 0:00:25
      937000 -- (-2012.289) (-2005.231) (-2003.639) [-2008.123] * [-2008.406] (-2003.887) (-1999.127) (-2017.343) -- 0:00:25
      937500 -- (-2014.983) [-2009.216] (-2004.625) (-2005.129) * (-2003.400) [-2001.486] (-2001.521) (-2012.354) -- 0:00:25
      938000 -- [-2001.145] (-2005.064) (-2006.209) (-2006.463) * [-2011.247] (-2014.903) (-2003.127) (-2010.965) -- 0:00:24
      938500 -- (-2012.329) (-2013.148) [-2009.111] (-2007.892) * (-1998.368) (-2002.019) [-2009.205] (-2004.366) -- 0:00:24
      939000 -- (-2005.891) (-2003.067) (-2016.363) [-2003.864] * (-1993.630) (-2020.653) (-2013.424) [-1997.155] -- 0:00:24
      939500 -- (-1996.767) [-2001.311] (-2002.980) (-2001.098) * (-2004.825) [-2009.339] (-1995.821) (-2009.068) -- 0:00:24
      940000 -- (-2002.088) (-2006.365) (-2012.070) [-2001.678] * (-2003.337) (-2004.159) (-2009.916) [-2002.274] -- 0:00:24

      Average standard deviation of split frequencies: 0.016256

      940500 -- (-2012.870) (-2000.546) (-2018.002) [-2003.712] * (-2003.947) (-1999.235) (-2007.042) [-1999.637] -- 0:00:23
      941000 -- (-2002.475) [-2004.802] (-2011.735) (-2005.838) * [-2002.599] (-2004.959) (-2005.683) (-1991.632) -- 0:00:23
      941500 -- (-2003.095) [-2006.031] (-2021.466) (-2008.040) * (-2011.976) (-2002.030) [-1998.996] (-2000.767) -- 0:00:23
      942000 -- (-2009.601) [-1998.710] (-2003.724) (-2015.155) * (-2008.520) (-2001.361) (-2007.119) [-1996.946] -- 0:00:23
      942500 -- (-2006.719) (-2010.627) (-2000.200) [-2010.804] * (-1997.488) (-2007.881) (-2018.191) [-1998.649] -- 0:00:23
      943000 -- (-1997.836) [-2002.900] (-1998.015) (-2002.190) * [-1998.969] (-2005.627) (-2012.414) (-2003.395) -- 0:00:22
      943500 -- [-2006.144] (-2007.483) (-2002.916) (-2009.995) * (-1997.316) (-2010.513) (-1998.970) [-1996.860] -- 0:00:22
      944000 -- (-2006.826) (-2004.559) [-1998.756] (-2011.923) * [-2006.533] (-1994.109) (-2007.509) (-2003.825) -- 0:00:22
      944500 -- (-1997.572) (-2003.813) (-2011.842) [-2007.292] * [-1996.509] (-2000.600) (-2005.157) (-2003.922) -- 0:00:22
      945000 -- (-2003.370) [-1995.592] (-2012.967) (-2006.104) * (-2000.122) [-2013.475] (-2006.974) (-1999.637) -- 0:00:22

      Average standard deviation of split frequencies: 0.017192

      945500 -- (-2005.677) (-2007.171) (-2015.619) [-2001.313] * (-1999.630) (-2022.443) (-2012.610) [-2005.802] -- 0:00:21
      946000 -- (-2017.337) (-2002.068) (-2008.914) [-1997.211] * (-2006.743) [-2008.697] (-1996.116) (-2004.425) -- 0:00:21
      946500 -- (-2021.090) [-2008.791] (-2015.609) (-2000.885) * (-2001.435) (-2005.155) (-2001.948) [-1999.055] -- 0:00:21
      947000 -- (-2004.440) [-2015.992] (-2007.174) (-1999.910) * (-2006.763) (-2018.554) (-2021.023) [-1998.713] -- 0:00:21
      947500 -- (-2006.445) [-2008.084] (-2005.625) (-2008.121) * (-2003.670) (-2012.274) (-2018.841) [-2001.622] -- 0:00:21
      948000 -- (-2012.658) (-2014.433) [-1999.845] (-1995.611) * (-1999.028) (-2002.921) (-2017.648) [-2007.715] -- 0:00:20
      948500 -- (-2012.414) (-2016.060) (-2007.925) [-2003.023] * (-1997.033) (-2000.773) [-2009.454] (-2006.770) -- 0:00:20
      949000 -- (-1999.802) (-2013.460) (-1999.058) [-2004.588] * (-2009.893) [-2003.782] (-2011.681) (-2010.409) -- 0:00:20
      949500 -- (-2017.393) (-2009.759) (-2002.302) [-2003.158] * [-1997.942] (-1996.261) (-2008.963) (-2005.250) -- 0:00:20
      950000 -- (-2010.946) (-2003.818) [-1999.268] (-2016.987) * (-2004.704) (-2016.083) (-2015.551) [-2009.188] -- 0:00:20

      Average standard deviation of split frequencies: 0.017479

      950500 -- (-2014.304) [-2000.904] (-2006.500) (-2017.887) * [-2010.659] (-2002.619) (-2012.424) (-2007.133) -- 0:00:19
      951000 -- [-2008.941] (-2002.332) (-2019.375) (-2004.117) * (-2012.565) (-2003.872) (-2008.742) [-2002.571] -- 0:00:19
      951500 -- (-2013.094) (-2011.457) (-2004.455) [-2009.835] * (-2015.218) (-1999.042) (-2004.280) [-2005.008] -- 0:00:19
      952000 -- (-2002.433) (-2006.198) [-2006.857] (-2010.902) * (-2008.660) [-1998.642] (-2000.446) (-2012.637) -- 0:00:19
      952500 -- (-2000.488) (-1995.037) [-2013.241] (-2018.623) * [-2008.193] (-2004.563) (-2006.500) (-2001.163) -- 0:00:19
      953000 -- (-1995.850) [-2001.442] (-2011.142) (-2014.474) * (-2008.440) (-2003.919) (-2006.330) [-1996.751] -- 0:00:18
      953500 -- (-2007.728) (-2007.032) (-2006.870) [-2003.843] * (-2016.313) (-2000.806) (-1999.706) [-1995.866] -- 0:00:18
      954000 -- (-2009.159) [-2001.237] (-2012.390) (-2003.858) * (-2005.740) [-2001.594] (-2008.006) (-1996.752) -- 0:00:18
      954500 -- (-2011.542) (-2010.032) (-2012.660) [-2002.271] * (-2007.479) [-2002.251] (-2009.796) (-2014.486) -- 0:00:18
      955000 -- [-2009.751] (-2006.300) (-2010.041) (-2011.213) * (-2001.097) (-2003.076) (-2004.324) [-2007.029] -- 0:00:18

      Average standard deviation of split frequencies: 0.018152

      955500 -- (-2002.612) (-2005.553) (-2004.323) [-2003.758] * (-2014.134) (-2000.429) (-2017.439) [-2011.983] -- 0:00:17
      956000 -- (-2002.052) (-1999.627) [-1997.489] (-2005.061) * (-2005.784) (-2016.083) (-2030.743) [-2003.765] -- 0:00:17
      956500 -- (-2003.024) [-2003.142] (-1999.023) (-2004.037) * [-1996.222] (-2011.567) (-1999.929) (-2005.996) -- 0:00:17
      957000 -- [-2006.110] (-2008.938) (-2004.685) (-2008.644) * (-2014.356) (-2009.089) [-2005.524] (-2003.626) -- 0:00:17
      957500 -- (-2010.775) (-2012.437) (-2011.580) [-2010.441] * (-2010.068) (-2005.168) (-2005.545) [-1993.781] -- 0:00:17
      958000 -- [-2012.781] (-2001.671) (-2011.705) (-2001.380) * (-2016.305) (-2021.547) [-1999.176] (-1998.501) -- 0:00:16
      958500 -- (-2009.598) (-2001.601) [-1996.504] (-2010.053) * (-2002.070) [-2007.228] (-2003.575) (-2016.090) -- 0:00:16
      959000 -- [-1998.691] (-1999.413) (-2014.438) (-2006.635) * [-2003.294] (-2004.386) (-2000.873) (-2020.441) -- 0:00:16
      959500 -- (-1998.911) (-2014.168) (-2010.529) [-2002.962] * (-2004.654) (-2012.849) (-2018.042) [-2005.513] -- 0:00:16
      960000 -- (-2005.630) [-1999.778] (-2013.459) (-1997.186) * (-2003.187) [-2005.892] (-2014.826) (-2013.973) -- 0:00:16

      Average standard deviation of split frequencies: 0.017635

      960500 -- [-2007.921] (-1997.161) (-2008.531) (-2000.369) * (-2001.708) [-2006.556] (-2003.897) (-2014.448) -- 0:00:15
      961000 -- (-1997.644) (-2008.220) (-2003.440) [-2012.115] * (-2004.938) [-1997.456] (-1996.113) (-2012.396) -- 0:00:15
      961500 -- (-2001.246) [-1998.026] (-2012.704) (-2005.043) * (-2006.976) (-2006.990) (-2000.888) [-2001.560] -- 0:00:15
      962000 -- (-2006.885) [-2001.867] (-2009.559) (-2009.161) * (-2010.552) (-2004.021) (-2004.986) [-2005.102] -- 0:00:15
      962500 -- (-2006.743) (-2022.476) (-2010.343) [-2008.868] * (-2012.671) [-2004.754] (-2012.661) (-2006.181) -- 0:00:15
      963000 -- [-1999.244] (-2005.384) (-2007.648) (-2003.030) * (-2012.488) (-2000.634) [-2002.514] (-1997.757) -- 0:00:14
      963500 -- (-2005.458) (-1996.502) [-2002.076] (-1997.760) * [-2003.630] (-1997.218) (-1991.118) (-2004.910) -- 0:00:14
      964000 -- (-2020.056) (-1996.235) [-1993.915] (-1997.494) * [-1997.529] (-2010.708) (-2000.034) (-2004.522) -- 0:00:14
      964500 -- [-2006.728] (-2003.707) (-1997.925) (-2007.710) * (-2002.017) [-2002.760] (-1999.741) (-2013.425) -- 0:00:14
      965000 -- [-2001.351] (-2004.146) (-2011.773) (-1998.456) * (-2004.363) (-2007.781) (-2009.768) [-2013.728] -- 0:00:14

      Average standard deviation of split frequencies: 0.017232

      965500 -- (-2017.351) (-2017.350) [-2014.182] (-1996.363) * (-2001.392) (-2011.251) [-2002.272] (-1999.722) -- 0:00:13
      966000 -- (-2010.674) (-2017.535) [-1998.012] (-2002.263) * (-1997.630) (-2011.444) (-2001.167) [-1998.662] -- 0:00:13
      966500 -- (-2001.826) (-2003.721) [-2010.079] (-2003.014) * [-1999.141] (-2010.316) (-1997.195) (-2004.520) -- 0:00:13
      967000 -- (-2009.547) (-2000.715) (-2009.292) [-2002.928] * [-2001.831] (-2010.072) (-2006.192) (-2007.729) -- 0:00:13
      967500 -- (-2011.118) (-1998.793) (-2014.367) [-2003.681] * [-1998.205] (-2013.833) (-2004.941) (-2009.412) -- 0:00:13
      968000 -- (-2002.219) (-2004.967) [-2004.434] (-2012.054) * (-2001.708) [-1998.662] (-1999.636) (-2005.755) -- 0:00:12
      968500 -- (-2019.803) (-1997.916) [-2006.766] (-2003.904) * (-2009.512) [-1994.393] (-2002.215) (-2006.880) -- 0:00:12
      969000 -- (-2009.632) (-2002.701) (-2013.700) [-2008.032] * (-2009.602) (-2010.940) (-1995.784) [-1999.158] -- 0:00:12
      969500 -- (-2002.310) (-2010.074) (-2004.838) [-2006.530] * [-2001.999] (-1998.768) (-2003.545) (-1998.459) -- 0:00:12
      970000 -- (-2009.690) [-2001.548] (-2005.591) (-2006.240) * [-2000.230] (-1998.507) (-1999.575) (-2014.520) -- 0:00:12

      Average standard deviation of split frequencies: 0.016937

      970500 -- (-2001.391) [-2009.253] (-2007.362) (-2019.085) * (-2001.118) (-2021.625) [-2000.598] (-2015.539) -- 0:00:11
      971000 -- [-2001.811] (-2002.494) (-2015.462) (-2003.571) * (-2007.813) (-2014.390) (-2009.878) [-2000.904] -- 0:00:11
      971500 -- (-2003.880) [-2000.239] (-2007.302) (-2001.814) * [-1998.737] (-2012.451) (-2011.827) (-2004.612) -- 0:00:11
      972000 -- (-2015.962) (-1999.657) (-2014.888) [-1997.828] * (-2004.389) (-2004.490) [-2001.164] (-2004.943) -- 0:00:11
      972500 -- (-2017.348) [-2002.460] (-2001.783) (-2001.031) * (-2004.121) (-2004.848) (-2003.036) [-2007.608] -- 0:00:11
      973000 -- (-2006.208) (-1999.983) (-1999.442) [-1997.982] * [-2003.358] (-2004.974) (-2009.840) (-2012.778) -- 0:00:10
      973500 -- (-2010.593) (-2008.110) [-1998.680] (-2003.380) * (-2012.607) [-2012.985] (-2002.011) (-2006.653) -- 0:00:10
      974000 -- (-2001.420) (-2003.529) [-2005.875] (-2004.684) * (-2021.469) (-2002.325) [-1998.491] (-2009.516) -- 0:00:10
      974500 -- [-1995.922] (-2014.836) (-2003.135) (-2002.877) * [-2001.566] (-2013.119) (-2013.921) (-2009.833) -- 0:00:10
      975000 -- (-1996.871) [-2011.250] (-2010.139) (-2001.847) * (-1996.266) (-2015.779) [-2011.573] (-2004.495) -- 0:00:10

      Average standard deviation of split frequencies: 0.016633

      975500 -- [-2000.700] (-2019.759) (-2008.687) (-2002.788) * (-2005.372) [-2002.870] (-2005.688) (-2001.112) -- 0:00:09
      976000 -- (-2000.043) (-2017.504) [-2012.973] (-1996.904) * (-1996.705) (-2004.686) (-2011.240) [-2001.224] -- 0:00:09
      976500 -- [-2004.597] (-1998.341) (-2009.683) (-2007.388) * [-2012.704] (-2001.223) (-2003.200) (-2012.284) -- 0:00:09
      977000 -- [-1998.144] (-2003.788) (-2001.597) (-2008.470) * (-1997.937) (-2009.790) (-1996.451) [-2008.950] -- 0:00:09
      977500 -- (-2002.069) [-2007.317] (-2012.338) (-2018.126) * [-1999.374] (-2008.994) (-2005.898) (-2007.282) -- 0:00:09
      978000 -- (-2012.308) (-2001.881) (-2009.889) [-2005.500] * (-2016.838) (-2015.286) (-2008.286) [-1997.303] -- 0:00:08
      978500 -- (-2001.784) (-1999.034) [-2002.940] (-1997.675) * (-2018.708) (-2021.330) (-2022.973) [-2004.304] -- 0:00:08
      979000 -- (-2005.578) (-1995.001) [-1999.930] (-2010.755) * (-2009.417) (-1998.743) [-2007.330] (-2004.994) -- 0:00:08
      979500 -- [-1995.371] (-2003.637) (-2015.396) (-2008.769) * (-2011.825) (-1999.214) (-2009.330) [-2008.273] -- 0:00:08
      980000 -- [-1996.658] (-1995.463) (-2018.237) (-2008.729) * (-2002.594) [-1998.899] (-2013.184) (-2018.120) -- 0:00:08

      Average standard deviation of split frequencies: 0.016254

      980500 -- (-2003.360) [-1997.077] (-2007.916) (-2011.659) * [-2010.511] (-2003.736) (-2003.190) (-2010.072) -- 0:00:07
      981000 -- (-2008.238) [-2004.326] (-2012.206) (-2004.192) * (-2004.947) [-2001.903] (-2010.292) (-2012.603) -- 0:00:07
      981500 -- (-2017.460) (-1999.406) [-2006.071] (-2007.509) * (-2006.398) (-2003.359) (-2013.999) [-2005.918] -- 0:00:07
      982000 -- (-2013.142) [-2005.377] (-2005.475) (-2010.923) * (-2008.826) (-2008.157) [-2004.838] (-2001.316) -- 0:00:07
      982500 -- (-2006.252) (-2023.855) [-2000.294] (-2006.549) * (-2006.736) (-2010.334) (-2005.560) [-2006.873] -- 0:00:07
      983000 -- (-2001.460) [-2003.823] (-2018.495) (-2004.287) * (-2008.739) (-1999.767) (-2009.732) [-1993.234] -- 0:00:06
      983500 -- (-2002.246) [-1998.157] (-2007.733) (-2005.357) * (-2002.160) [-1999.079] (-2018.059) (-2010.530) -- 0:00:06
      984000 -- (-2006.158) (-2009.495) [-1995.039] (-2000.543) * [-2010.683] (-2001.447) (-2006.938) (-2008.931) -- 0:00:06
      984500 -- (-2013.590) (-2009.655) [-2005.405] (-2003.486) * (-2009.644) [-1997.334] (-2008.372) (-2000.548) -- 0:00:06
      985000 -- (-2013.917) (-2005.812) [-2000.465] (-2010.251) * (-2022.516) (-1996.932) (-2007.619) [-2005.148] -- 0:00:06

      Average standard deviation of split frequencies: 0.017032

      985500 -- [-2000.301] (-2007.248) (-2011.819) (-2014.638) * (-2020.906) (-2008.177) [-1999.378] (-2002.897) -- 0:00:05
      986000 -- [-2006.201] (-1996.147) (-2016.333) (-2010.276) * (-2021.626) [-2001.808] (-2004.713) (-2003.474) -- 0:00:05
      986500 -- (-2010.434) [-2001.095] (-2014.624) (-2004.160) * (-2023.092) [-1999.992] (-2000.171) (-2008.183) -- 0:00:05
      987000 -- (-2011.441) [-2006.858] (-2012.971) (-2007.722) * [-1998.840] (-1999.396) (-2003.358) (-1998.497) -- 0:00:05
      987500 -- (-2000.522) (-2008.932) [-2001.622] (-2000.910) * (-2006.527) (-2007.643) [-1996.944] (-2008.195) -- 0:00:05
      988000 -- (-2008.592) [-2003.246] (-1997.750) (-1997.814) * (-1996.998) [-1997.336] (-2002.095) (-2007.541) -- 0:00:04
      988500 -- (-1997.261) (-2022.805) (-2002.663) [-2003.692] * [-1999.169] (-2010.754) (-2008.183) (-2004.326) -- 0:00:04
      989000 -- (-2012.409) (-2013.603) [-1994.319] (-1995.729) * (-2010.992) [-1999.392] (-1997.726) (-2006.871) -- 0:00:04
      989500 -- [-2002.725] (-2009.642) (-2004.110) (-2001.194) * (-2003.747) (-2012.133) [-2004.905] (-1995.732) -- 0:00:04
      990000 -- (-2005.705) (-2010.253) (-2002.003) [-2003.504] * (-2011.485) (-2007.920) (-2000.538) [-1993.900] -- 0:00:04

      Average standard deviation of split frequencies: 0.017190

      990500 -- (-2012.813) (-2001.879) [-2003.276] (-2002.392) * (-2010.572) [-2003.371] (-2001.110) (-2003.409) -- 0:00:03
      991000 -- (-2005.011) [-2007.998] (-2005.805) (-2009.769) * (-1997.118) (-1994.819) (-2014.565) [-1994.680] -- 0:00:03
      991500 -- (-2007.506) [-1994.481] (-1997.167) (-2015.150) * (-2004.704) (-2000.603) (-2015.677) [-2002.604] -- 0:00:03
      992000 -- (-2006.726) (-2006.163) [-2001.533] (-2007.982) * (-2018.837) (-1999.815) [-2007.233] (-2006.749) -- 0:00:03
      992500 -- (-2000.141) (-2000.754) [-2004.069] (-2016.163) * (-2010.568) [-2006.804] (-2019.584) (-2012.191) -- 0:00:03
      993000 -- (-2014.415) (-1995.340) [-1996.313] (-2001.947) * (-2012.781) [-1997.755] (-2006.663) (-2006.338) -- 0:00:02
      993500 -- (-2020.573) (-2003.396) [-1995.268] (-2001.696) * (-2011.507) [-2002.088] (-2011.047) (-2001.080) -- 0:00:02
      994000 -- (-2005.071) (-2006.331) (-2003.693) [-2006.055] * (-2004.770) (-2010.571) (-2014.961) [-1999.291] -- 0:00:02
      994500 -- (-2011.608) (-2007.887) [-2002.065] (-2002.146) * (-2013.323) [-2006.556] (-2007.607) (-2010.964) -- 0:00:02
      995000 -- [-1998.771] (-2001.622) (-2010.293) (-2008.428) * (-1998.950) [-2008.578] (-2009.096) (-2012.309) -- 0:00:02

      Average standard deviation of split frequencies: 0.017867

      995500 -- (-2005.743) [-1999.663] (-2005.404) (-2001.480) * [-2004.206] (-2012.984) (-2007.695) (-1998.307) -- 0:00:01
      996000 -- (-2007.722) [-2011.567] (-2012.300) (-2004.662) * (-2010.926) (-2013.083) [-2002.342] (-1998.381) -- 0:00:01
      996500 -- (-2011.709) (-2006.785) [-2001.768] (-2010.336) * (-1999.205) (-2007.379) (-2008.089) [-2000.306] -- 0:00:01
      997000 -- (-2015.893) (-2013.440) [-2012.657] (-2002.623) * (-2006.442) (-2009.105) [-1999.704] (-2004.109) -- 0:00:01
      997500 -- (-2009.627) [-2008.210] (-2007.010) (-2005.897) * (-2001.322) (-2005.255) (-2017.773) [-1996.498] -- 0:00:01
      998000 -- (-2009.470) (-2004.577) [-2006.702] (-2006.740) * (-1998.061) [-2008.270] (-2015.548) (-1999.510) -- 0:00:00
      998500 -- (-2007.159) [-1996.775] (-2013.988) (-2005.836) * (-2002.799) (-2006.625) (-2011.832) [-2008.152] -- 0:00:00
      999000 -- (-2020.439) (-2003.577) [-2000.717] (-2001.461) * (-2001.484) (-2003.757) [-2011.357] (-2010.568) -- 0:00:00
      999500 -- (-2014.551) (-2008.395) (-2008.651) [-1994.881] * (-2013.561) [-2002.811] (-2001.882) (-2004.054) -- 0:00:00
      1000000 -- [-2002.316] (-2013.786) (-2008.340) (-1996.898) * (-2005.812) [-1996.160] (-2011.175) (-2000.580) -- 0:00:00

      Average standard deviation of split frequencies: 0.017872
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -2002.316274 -- 27.072658
         Chain 1 -- -2002.316291 -- 27.072658
         Chain 2 -- -2013.785675 -- 20.222264
         Chain 2 -- -2013.785675 -- 20.222264
         Chain 3 -- -2008.339702 -- 21.667173
         Chain 3 -- -2008.339712 -- 21.667173
         Chain 4 -- -1996.898077 -- 22.862874
         Chain 4 -- -1996.898077 -- 22.862874
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -2005.811848 -- 21.244856
         Chain 1 -- -2005.811852 -- 21.244856
         Chain 2 -- -1996.160494 -- 23.177774
         Chain 2 -- -1996.160495 -- 23.177774
         Chain 3 -- -2011.174815 -- 21.567277
         Chain 3 -- -2011.174796 -- 21.567277
         Chain 4 -- -2000.580381 -- 22.812447
         Chain 4 -- -2000.580381 -- 22.812447

      Analysis completed in 6 mins 43 seconds
      Analysis used 402.28 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -1987.66
      Likelihood of best state for "cold" chain of run 2 was -1988.40

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            42.1 %     ( 34 %)     Dirichlet(Revmat{all})
            62.5 %     ( 49 %)     Slider(Revmat{all})
            26.4 %     ( 25 %)     Dirichlet(Pi{all})
            27.8 %     ( 24 %)     Slider(Pi{all})
            31.6 %     ( 25 %)     Multiplier(Alpha{1,2})
            42.1 %     ( 26 %)     Multiplier(Alpha{3})
            40.6 %     ( 36 %)     Slider(Pinvar{all})
            16.3 %     (  9 %)     ExtSPR(Tau{all},V{all})
             6.3 %     (  3 %)     ExtTBR(Tau{all},V{all})
            21.4 %     ( 23 %)     NNI(Tau{all},V{all})
            17.8 %     ( 17 %)     ParsSPR(Tau{all},V{all})
            26.6 %     ( 27 %)     Multiplier(V{all})
            44.8 %     ( 41 %)     Nodeslider(V{all})
            25.6 %     ( 30 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            43.7 %     ( 32 %)     Dirichlet(Revmat{all})
            62.4 %     ( 57 %)     Slider(Revmat{all})
            25.9 %     ( 22 %)     Dirichlet(Pi{all})
            28.0 %     ( 32 %)     Slider(Pi{all})
            31.2 %     ( 25 %)     Multiplier(Alpha{1,2})
            42.3 %     ( 15 %)     Multiplier(Alpha{3})
            40.5 %     ( 25 %)     Slider(Pinvar{all})
            16.2 %     ( 15 %)     ExtSPR(Tau{all},V{all})
             6.2 %     ( 11 %)     ExtTBR(Tau{all},V{all})
            21.1 %     ( 32 %)     NNI(Tau{all},V{all})
            17.8 %     ( 14 %)     ParsSPR(Tau{all},V{all})
            26.5 %     ( 19 %)     Multiplier(V{all})
            44.7 %     ( 49 %)     Nodeslider(V{all})
            25.7 %     ( 28 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.73    0.51    0.34 
         2 |  166505            0.75    0.54 
         3 |  166749  166068            0.77 
         4 |  166725  167071  166882         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.73    0.50    0.34 
         2 |  166216            0.75    0.54 
         3 |  165987  167165            0.77 
         4 |  167546  166051  167035         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -2000.19
      |                    1         1   2 1                       |
      |                                 1     1  1                 |
      |           2       2   222                 1                |
      | 2 2          2   1        1         2   2  1               |
      | 1                     11    1      21              2    2 2|
      |   1  21 2    12         1     1*  2  2       *2   1       1|
      |           1*2  12  221   2 2     11       22*    12  2   1 |
      |  1 11   1                              212      *2    2    |
      |        1 *  1  21    2   1                          *  21  |
      |* 2 22 2             1      1222      121      12         2 |
      |        2                  2                    1   1  1    |
      |               1   1                                    1   |
      |                                 2                    1     |
      |                                                            |
      |      1           2                                         |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2005.62
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -1995.72         -2013.26
        2      -1995.78         -2016.93
      --------------------------------------
      TOTAL    -1995.75         -2016.26
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.834238    0.012002    0.627644    1.051122    0.825141   1419.53   1460.27    1.000
      r(A<->C){all}   0.080960    0.000492    0.040268    0.124935    0.079031    985.86   1102.20    1.000
      r(A<->G){all}   0.220212    0.002522    0.128312    0.320676    0.217389    539.12    646.88    1.000
      r(A<->T){all}   0.010102    0.000094    0.000005    0.029522    0.007173    761.61    928.49    1.000
      r(C<->G){all}   0.097730    0.000470    0.057155    0.140022    0.095920    773.93    880.28    1.000
      r(C<->T){all}   0.562495    0.003140    0.458799    0.674044    0.562662    660.73    706.22    1.000
      r(G<->T){all}   0.028500    0.000275    0.000097    0.060267    0.026316    950.92   1043.47    1.000
      pi(A){all}      0.225826    0.000218    0.196206    0.253302    0.225463   1225.58   1339.66    1.000
      pi(C){all}      0.311483    0.000271    0.278221    0.341525    0.311604   1254.54   1261.33    1.000
      pi(G){all}      0.275871    0.000265    0.245869    0.308100    0.275597   1196.40   1260.28    1.000
      pi(T){all}      0.186820    0.000176    0.162500    0.214740    0.186298   1094.16   1181.14    1.000
      alpha{1,2}      0.085992    0.000275    0.057500    0.119788    0.085828    877.60   1024.87    1.000
      alpha{3}        2.224142    0.488473    1.061426    3.648855    2.111553   1329.23   1376.04    1.000
      pinvar{all}     0.600376    0.001409    0.527285    0.669611    0.602321   1256.34   1372.71    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7
      8 -- C8
      9 -- C9
     10 -- C10
     11 -- C11
     12 -- C12

   Key to taxon bipartitions (saved to file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ------------------
    1 -- .***********
    2 -- .*..........
    3 -- ..*.........
    4 -- ...*........
    5 -- ....*.......
    6 -- .....*......
    7 -- ......*.....
    8 -- .......*....
    9 -- ........*...
   10 -- .........*..
   11 -- ..........*.
   12 -- ...........*
   13 -- ...*********
   14 -- .....*******
   15 -- .**.........
   16 -- ......**....
   17 -- ...*.*******
   18 -- ......**..*.
   19 -- .....***..*.
   20 -- .....******.
   21 -- .....***....
   22 -- ........**..
   23 -- ..........**
   24 -- .....***.**.
   25 -- .....***.***
   26 -- ....********
   27 -- .....***..**
   28 -- .....****.*.
   ------------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
   13  2997    0.998334    0.000471    0.998001    0.998668    2
   14  2979    0.992338    0.004240    0.989340    0.995336    2
   15  2764    0.920720    0.004711    0.917388    0.924051    2
   16  2742    0.913391    0.005653    0.909394    0.917388    2
   17  2088    0.695536    0.005653    0.691539    0.699534    2
   18  1908    0.635576    0.041456    0.606262    0.664890    2
   19  1519    0.505996    0.040043    0.477682    0.534310    2
   20  1472    0.490340    0.017901    0.477682    0.502998    2
   21  1005    0.334777    0.038158    0.307795    0.361759    2
   22   961    0.320120    0.021199    0.305130    0.335110    2
   23   838    0.279147    0.038629    0.251832    0.306462    2
   24   816    0.271819    0.021670    0.256496    0.287142    2
   25   720    0.239840    0.019786    0.225849    0.253831    2
   26   645    0.214857    0.005182    0.211193    0.218521    2
   27   359    0.119587    0.013662    0.109927    0.129247    2
   28   346    0.115256    0.007537    0.109927    0.120586    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.068425    0.000373    0.033181    0.103804    0.066786    1.000    2
   length{all}[2]     0.017118    0.000056    0.003457    0.031215    0.015775    1.000    2
   length{all}[3]     0.006090    0.000022    0.000013    0.015524    0.004978    1.000    2
   length{all}[4]     0.034713    0.000189    0.011531    0.062299    0.032893    1.000    2
   length{all}[5]     0.017320    0.000085    0.001472    0.035963    0.016148    1.000    2
   length{all}[6]     0.044654    0.000289    0.015442    0.079490    0.042745    1.000    2
   length{all}[7]     0.056996    0.000322    0.024470    0.091313    0.054900    1.000    2
   length{all}[8]     0.023923    0.000151    0.003075    0.048215    0.021867    1.000    2
   length{all}[9]     0.101844    0.000722    0.052278    0.153619    0.099339    1.000    2
   length{all}[10]    0.145968    0.001296    0.082321    0.219509    0.142071    1.000    2
   length{all}[11]    0.080393    0.000574    0.038345    0.128173    0.077147    1.000    2
   length{all}[12]    0.048622    0.000341    0.017140    0.086061    0.046484    1.000    2
   length{all}[13]    0.025846    0.000148    0.005587    0.049983    0.024192    1.000    2
   length{all}[14]    0.045303    0.000325    0.012146    0.080692    0.042802    1.000    2
   length{all}[15]    0.012905    0.000069    0.000020    0.028178    0.011443    1.001    2
   length{all}[16]    0.025210    0.000227    0.000055    0.053147    0.023034    1.000    2
   length{all}[17]    0.012697    0.000073    0.000146    0.028848    0.010978    1.000    2
   length{all}[18]    0.024417    0.000176    0.002773    0.051170    0.021934    1.000    2
   length{all}[19]    0.018879    0.000160    0.000025    0.041608    0.016884    0.999    2
   length{all}[20]    0.015901    0.000118    0.000662    0.038432    0.013769    0.999    2
   length{all}[21]    0.023074    0.000186    0.003135    0.051012    0.020897    0.999    2
   length{all}[22]    0.015671    0.000151    0.000049    0.039778    0.012703    1.002    2
   length{all}[23]    0.028603    0.000207    0.002432    0.056514    0.026531    0.999    2
   length{all}[24]    0.014309    0.000116    0.000038    0.035559    0.011649    1.000    2
   length{all}[25]    0.016473    0.000169    0.000045    0.039218    0.013952    1.003    2
   length{all}[26]    0.009759    0.000057    0.000418    0.023878    0.008112    1.005    2
   length{all}[27]    0.008036    0.000060    0.000008    0.024192    0.005710    0.997    2
   length{all}[28]    0.011052    0.000096    0.000021    0.030846    0.008156    0.999    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.017872
       Maximum standard deviation of split frequencies = 0.041456
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.005


   Clade credibility values:

   /---------------------------------------------------------------------- C1 (1)
   |                                                                               
   |                   /-------------------------------------------------- C4 (4)
   |                   |                                                           
   |                   |                   /------------------------------ C6 (6)
   |                   |                   |                                       
   |                   |                   |                   /---------- C7 (7)
   |         /----70---+         /----51---+         /----91---+                   
   |         |         |         |         |         |         \---------- C8 (8)
   |         |         |         |         \----64---+                             
   |         |         |         |                   \-------------------- C11 (11)
   +         |         |         |                                                 
   |         |         \----99---+---------------------------------------- C9 (9)
   |---100---+                   |                                                 
   |         |                   |---------------------------------------- C10 (10)
   |         |                   |                                                 
   |         |                   \---------------------------------------- C12 (12)
   |         |                                                                     
   |         \------------------------------------------------------------ C5 (5)
   |                                                                               
   |                                                           /---------- C2 (2)
   \-----------------------------92----------------------------+                   
                                                               \---------- C3 (3)
                                                                                   

   Phylogram (based on average branch lengths):

   /--------------------- C1 (1)
   |                                                                               
   |          /----------- C4 (4)
   |          |                                                                    
   |          |                  /-------------- C6 (6)
   |          |                  |                                                 
   |          |                  |             /------------------ C7 (7)
   |       /--+             /----+      /------+                                   
   |       |  |             |    |      |      \------- C8 (8)
   |       |  |             |    \------+                                          
   |       |  |             |           \------------------------- C11 (11)
   +       |  |             |                                                      
   |       |  \-------------+------------------------------- C9 (9)
   |-------+                |                                                      
   |       |                |--------------------------------------------- C10 (10)
   |       |                |                                                      
   |       |                \--------------- C12 (12)
   |       |                                                                       
   |       \----- C5 (5)
   |                                                                               
   |   /----- C2 (2)
   \---+                                                                           
       \- C3 (3)
                                                                                   
   |--------------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (515 trees sampled):
      50 % credible set contains 26 trees
      90 % credible set contains 233 trees
      95 % credible set contains 365 trees
      99 % credible set contains 485 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 12  	ls = 735
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Reading seq # 8: C8     
Reading seq # 9: C9     
Reading seq #10: C10     
Reading seq #11: C11     
Reading seq #12: C12     
Sequences read..
Counting site patterns..  0:00

         137 patterns at      245 /      245 sites (100.0%),  0:00
Counting codons..
NG distances for seqs.:
   1   2   3   4   5   6   7   8   9  10  11  12

      528 bytes for distance
   133712 bytes for conP
    18632 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
   534848 bytes for conP, adjusted

    0.083181    0.025741    0.008950    0.037139    0.042280    0.016784    0.049040    0.001367    0.024406    0.057061    0.036997    0.086024    0.110568    0.151591    0.068699    0.021902    0.013463    0.019642    0.005469    0.300000    1.300000

ntime & nrate & np:    19     2    21

Bounds (np=21):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    21
lnL0 = -2415.318862

Iterating by ming2
Initial: fx=  2415.318862
x=  0.08318  0.02574  0.00895  0.03714  0.04228  0.01678  0.04904  0.00137  0.02441  0.05706  0.03700  0.08602  0.11057  0.15159  0.06870  0.02190  0.01346  0.01964  0.00547  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 2602.6242 YYYCCC  2405.956344  5 0.0000    33 | 0/21
  2 h-m-p  0.0000 0.0001 454.4827 +YYCCYYC  2385.607106  6 0.0001    67 | 0/21
  3 h-m-p  0.0000 0.0000 36119.4007 +YYYYCC  2362.670099  5 0.0000    98 | 0/21
  4 h-m-p  0.0001 0.0005 2391.3489 +CCCCC  2321.797622  4 0.0002   131 | 0/21
  5 h-m-p  0.0000 0.0002 718.5625 ++     2290.179239  m 0.0002   155 | 0/21
  6 h-m-p  0.0000 0.0000 4041.8616 +YYYYCC  2280.913510  5 0.0000   186 | 0/21
  7 h-m-p  0.0000 0.0001 2033.1319 +YYCYCCC  2260.138225  6 0.0001   220 | 0/21
  8 h-m-p  0.0000 0.0001 6708.8183 +YYYC  2221.905196  3 0.0000   248 | 0/21
  9 h-m-p  0.0000 0.0000 7241.8506 +YYCYCCC  2188.436373  6 0.0000   282 | 0/21
 10 h-m-p  0.0000 0.0000 2310.9978 +YYCCCC  2184.720683  5 0.0000   315 | 0/21
 11 h-m-p  0.0000 0.0009 745.5599 +++    1896.201387  m 0.0009   340 | 1/21
 12 h-m-p  0.0002 0.0009 414.7450 +YYCCCC  1876.855413  5 0.0006   373 | 1/21
 13 h-m-p  0.0000 0.0001 2435.3701 +YCYCCC  1858.620902  5 0.0001   406 | 1/21
 14 h-m-p  0.0001 0.0004 681.7868 YCCCC  1850.938474  4 0.0001   437 | 1/21
 15 h-m-p  0.0001 0.0003 277.9041 +YYCYCC  1843.214073  5 0.0002   469 | 1/21
 16 h-m-p  0.0001 0.0006 137.9105 YCCC   1840.846751  3 0.0003   498 | 1/21
 17 h-m-p  0.0009 0.0043  32.2281 YCC    1840.680374  2 0.0004   525 | 1/21
 18 h-m-p  0.0008 0.0084  14.3837 YC     1840.642686  1 0.0004   550 | 1/21
 19 h-m-p  0.0041 0.1021   1.5142 YC     1840.633899  1 0.0023   575 | 1/21
 20 h-m-p  0.0069 0.4975   0.4945 +YCCC  1840.090075  3 0.0596   605 | 1/21
 21 h-m-p  0.0009 0.0096  32.3891 +CYCCC  1835.257186  4 0.0049   657 | 1/21
 22 h-m-p  0.0012 0.0058  24.8286 YCC    1835.047786  2 0.0007   684 | 1/21
 23 h-m-p  0.0759 2.0071   0.2389 ++YYCCC  1826.922253  4 1.0082   716 | 1/21
 24 h-m-p  0.5677 2.8384   0.0456 +YYCCCC  1822.991286  5 1.7283   769 | 1/21
 25 h-m-p  0.1492 0.7459   0.0798 YCCCC  1822.037327  4 0.3138   820 | 1/21
 26 h-m-p  0.4770 3.0491   0.0525 YCCC   1821.260479  3 0.8791   869 | 1/21
 27 h-m-p  0.7682 8.0000   0.0601 YCCC   1820.589534  3 1.5280   918 | 1/21
 28 h-m-p  0.8330 8.0000   0.1103 +YCCC  1819.694323  3 2.2948   968 | 1/21
 29 h-m-p  1.6000 8.0000   0.0471 CCC    1819.414368  2 1.2615  1016 | 1/21
 30 h-m-p  1.6000 8.0000   0.0267 YCC    1819.261796  2 2.6911  1063 | 1/21
 31 h-m-p  1.6000 8.0000   0.0143 YCCC   1819.132357  3 2.9064  1112 | 1/21
 32 h-m-p  1.6000 8.0000   0.0089 CC     1819.088169  1 2.0477  1158 | 1/21
 33 h-m-p  1.6000 8.0000   0.0011 +YC    1819.041148  1 5.3522  1204 | 1/21
 34 h-m-p  0.5497 8.0000   0.0106 +YC    1819.016006  1 1.8857  1250 | 1/21
 35 h-m-p  1.6000 8.0000   0.0018 YC     1818.998800  1 2.9788  1295 | 1/21
 36 h-m-p  1.6000 8.0000   0.0025 C      1818.993726  0 1.5677  1339 | 1/21
 37 h-m-p  0.8477 8.0000   0.0047 +YC    1818.992545  1 2.2360  1385 | 1/21
 38 h-m-p  1.6000 8.0000   0.0002 +C     1818.989905  0 5.9948  1430 | 1/21
 39 h-m-p  0.3927 8.0000   0.0033 +C     1818.988760  0 1.4846  1475 | 1/21
 40 h-m-p  1.6000 8.0000   0.0007 C      1818.988617  0 1.8464  1519 | 1/21
 41 h-m-p  1.6000 8.0000   0.0007 +C     1818.988214  0 6.5969  1564 | 1/21
 42 h-m-p  1.6000 8.0000   0.0006 C      1818.988111  0 1.4804  1608 | 1/21
 43 h-m-p  1.6000 8.0000   0.0001 Y      1818.988087  0 3.9812  1652 | 1/21
 44 h-m-p  1.6000 8.0000   0.0001 C      1818.988069  0 2.1211  1696 | 1/21
 45 h-m-p  1.6000 8.0000   0.0001 Y      1818.988068  0 1.2756  1740 | 1/21
 46 h-m-p  1.6000 8.0000   0.0000 +Y     1818.988067  0 5.3797  1785 | 1/21
 47 h-m-p  0.7798 8.0000   0.0000 +Y     1818.988066  0 2.3050  1830 | 1/21
 48 h-m-p  1.6000 8.0000   0.0000 C      1818.988065  0 1.5443  1874 | 1/21
 49 h-m-p  1.6000 8.0000   0.0000 ++     1818.988065  m 8.0000  1918 | 1/21
 50 h-m-p  0.6415 8.0000   0.0000 Y      1818.988065  0 1.2521  1962 | 1/21
 51 h-m-p  1.6000 8.0000   0.0000 C      1818.988065  0 1.3454  2006 | 1/21
 52 h-m-p  1.6000 8.0000   0.0000 --C    1818.988065  0 0.0250  2052
Out..
lnL  = -1818.988065
2053 lfun, 2053 eigenQcodon, 39007 P(t)

Time used:  0:14


Model 1: NearlyNeutral

TREE #  1
(1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
    0.083181    0.025741    0.008950    0.037139    0.042280    0.016784    0.049040    0.001367    0.024406    0.057061    0.036997    0.086024    0.110568    0.151591    0.068699    0.021902    0.013463    0.019642    0.005469    2.165680    0.822315    0.590611

ntime & nrate & np:    19     2    22

Bounds (np=22):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 5.623943

np =    22
lnL0 = -2139.484358

Iterating by ming2
Initial: fx=  2139.484358
x=  0.08318  0.02574  0.00895  0.03714  0.04228  0.01678  0.04904  0.00137  0.02441  0.05706  0.03700  0.08602  0.11057  0.15159  0.06870  0.02190  0.01346  0.01964  0.00547  2.16568  0.82232  0.59061

  1 h-m-p  0.0000 0.0001 2176.4440 YYYCCC  2130.614430  5 0.0000    34 | 0/22
  2 h-m-p  0.0000 0.0002 305.6524 +CYCCC  2119.960134  4 0.0002    68 | 0/22
  3 h-m-p  0.0000 0.0000 15667.5004 +YYYYC  2107.656636  4 0.0000    98 | 0/22
  4 h-m-p  0.0000 0.0002 1977.8316 ++     1991.326711  m 0.0002   123 | 0/22
  5 h-m-p  0.0000 0.0000 8578.9105 
h-m-p:      0.00000000e+00      0.00000000e+00      8.57891055e+03  1991.326711
..  | 0/22
  6 h-m-p  0.0000 0.0001 773.2611 ++     1930.475069  m 0.0001   170 | 0/22
  7 h-m-p  0.0000 0.0000 18805.3116 
h-m-p:      1.96296367e-22      9.81481833e-22      1.88053116e+04  1930.475069
..  | 0/22
  8 h-m-p  0.0000 0.0001 2918.1326 ++     1913.792595  m 0.0001   217 | 0/22
  9 h-m-p  0.0000 0.0000 1172.7192 ++     1869.902317  m 0.0000   242 | 1/22
 10 h-m-p  0.0000 0.0008 209.5068 +YCCC  1865.545514  3 0.0004   273 | 1/22
 11 h-m-p  0.0003 0.0013 207.0638 YCCCC  1859.503730  4 0.0006   305 | 1/22
 12 h-m-p  0.0001 0.0006 116.1259 +YYCCC  1857.308151  4 0.0004   337 | 1/22
 13 h-m-p  0.0001 0.0007 146.9862 CCCC   1856.372082  3 0.0002   368 | 1/22
 14 h-m-p  0.0007 0.0069  41.8554 +YYC   1853.368827  2 0.0020   396 | 1/22
 15 h-m-p  0.0003 0.0016 128.5242 +YYYCCC  1844.471133  5 0.0012   429 | 1/22
 16 h-m-p  0.0000 0.0001 617.3244 +YYYYYYY  1842.080016  6 0.0001   461 | 1/22
 17 h-m-p  0.0001 0.0003  63.5637 CCCC   1841.945476  3 0.0001   492 | 1/22
 18 h-m-p  0.0003 0.0022  19.6698 CCC    1841.892590  2 0.0003   521 | 1/22
 19 h-m-p  0.0002 0.0312  25.1263 ++YCC  1841.367802  2 0.0032   551 | 1/22
 20 h-m-p  0.0003 0.0014 171.9026 +CCC   1840.246234  2 0.0010   581 | 1/22
 21 h-m-p  0.0002 0.0010 105.7074 ++     1839.529586  m 0.0010   606 | 1/22
 22 h-m-p  0.0000 0.0000 127.9537 
h-m-p:      0.00000000e+00      0.00000000e+00      1.27953733e+02  1839.529586
..  | 1/22
 23 h-m-p  0.0000 0.0003 246.7473 ++CCCC  1834.649505  3 0.0002   661 | 1/22
 24 h-m-p  0.0000 0.0000 227.1499 ++     1833.363320  m 0.0000   686 | 2/22
 25 h-m-p  0.0000 0.0002 474.7656 +CCCC  1830.820583  3 0.0001   718 | 2/22
 26 h-m-p  0.0000 0.0002 275.5059 +YCYCC  1828.998989  4 0.0001   750 | 2/22
 27 h-m-p  0.0001 0.0012 228.4333 +YCCC  1825.657673  3 0.0004   781 | 2/22
 28 h-m-p  0.0002 0.0011 260.4319 CYCCCC  1821.934910  5 0.0004   815 | 2/22
 29 h-m-p  0.0001 0.0006 115.6705 CCCC   1821.512142  3 0.0001   846 | 2/22
 30 h-m-p  0.0004 0.0018  32.2411 YCC    1821.419113  2 0.0002   874 | 2/22
 31 h-m-p  0.0004 0.0095  17.0797 CC     1821.371657  1 0.0004   901 | 2/22
 32 h-m-p  0.0003 0.0063  21.4887 CCC    1821.317084  2 0.0004   930 | 2/22
 33 h-m-p  0.0004 0.0057  21.5269 YC     1821.228490  1 0.0006   956 | 2/22
 34 h-m-p  0.0004 0.0046  37.5752 CCC    1821.117101  2 0.0005   985 | 2/22
 35 h-m-p  0.0007 0.0033  24.4616 YCC    1821.086221  2 0.0003  1013 | 2/22
 36 h-m-p  0.0003 0.0105  27.2340 YC     1821.028534  1 0.0006  1039 | 2/22
 37 h-m-p  0.0005 0.0108  34.5264 +YCC   1820.876148  2 0.0014  1068 | 2/22
 38 h-m-p  0.0003 0.0124 193.5228 +YCCC  1819.962304  3 0.0017  1099 | 2/22
 39 h-m-p  0.0010 0.0049 102.8244 CYC    1819.874900  2 0.0003  1127 | 2/22
 40 h-m-p  0.0019 0.0221  16.0347 CC     1819.853597  1 0.0005  1154 | 2/22
 41 h-m-p  0.0082 0.1126   1.0368 YC     1819.851717  1 0.0010  1180 | 2/22
 42 h-m-p  0.0019 0.1289   0.5591 +CCC   1819.807645  2 0.0093  1210 | 2/22
 43 h-m-p  0.0007 0.0146   7.1635 +CCC   1819.320410  2 0.0033  1260 | 2/22
 44 h-m-p  0.0004 0.0022  38.5937 CCC    1818.953266  2 0.0005  1289 | 2/22
 45 h-m-p  1.5116 8.0000   0.0129 YCC    1818.882921  2 0.8280  1317 | 2/22
 46 h-m-p  1.4222 7.1111   0.0038 YC     1818.877587  1 0.5894  1363 | 2/22
 47 h-m-p  1.6000 8.0000   0.0010 YC     1818.876609  1 0.8763  1409 | 2/22
 48 h-m-p  1.6000 8.0000   0.0002 Y      1818.876563  0 1.0018  1454 | 2/22
 49 h-m-p  1.6000 8.0000   0.0001 Y      1818.876561  0 1.2203  1499 | 2/22
 50 h-m-p  1.6000 8.0000   0.0000 Y      1818.876561  0 1.1284  1544 | 2/22
 51 h-m-p  1.6000 8.0000   0.0000 Y      1818.876561  0 1.2780  1589 | 2/22
 52 h-m-p  1.6000 8.0000   0.0000 -C     1818.876561  0 0.1000  1635 | 2/22
 53 h-m-p  0.0752 8.0000   0.0000 C      1818.876561  0 0.0752  1680 | 2/22
 54 h-m-p  0.0762 8.0000   0.0000 --------C  1818.876561  0 0.0000  1733
Out..
lnL  = -1818.876561
1734 lfun, 5202 eigenQcodon, 65892 P(t)

Time used:  0:36


Model 2: PositiveSelection

TREE #  1
(1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
initial w for M2:NSpselection reset.

    0.083181    0.025741    0.008950    0.037139    0.042280    0.016784    0.049040    0.001367    0.024406    0.057061    0.036997    0.086024    0.110568    0.151591    0.068699    0.021902    0.013463    0.019642    0.005469    2.164438    0.862503    0.107410    0.336572    2.818396

ntime & nrate & np:    19     3    24

Bounds (np=24):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 3.878959

np =    24
lnL0 = -2176.089566

Iterating by ming2
Initial: fx=  2176.089566
x=  0.08318  0.02574  0.00895  0.03714  0.04228  0.01678  0.04904  0.00137  0.02441  0.05706  0.03700  0.08602  0.11057  0.15159  0.06870  0.02190  0.01346  0.01964  0.00547  2.16444  0.86250  0.10741  0.33657  2.81840

  1 h-m-p  0.0000 0.0022 2490.8736 +CYCCC  2160.972957  4 0.0000    37 | 0/24
  2 h-m-p  0.0002 0.0019 377.1034 ++     1982.794986  m 0.0019    64 | 1/24
  3 h-m-p  0.0004 0.0021 224.8135 ++     1928.114090  m 0.0021    91 | 1/24
  4 h-m-p  0.0000 0.0001 4519.9434 +YCC   1913.162430  2 0.0001   122 | 1/24
  5 h-m-p  0.0012 0.0060  57.7063 +YYYCCC  1905.118087  5 0.0044   157 | 1/24
  6 h-m-p  0.0015 0.0074  38.8669 +CYC   1901.272016  2 0.0062   188 | 1/24
  7 h-m-p  0.0022 0.0110  86.9695 CYC    1899.237237  2 0.0021   218 | 1/24
  8 h-m-p  0.0019 0.0093  33.7881 +YCCC  1897.255527  3 0.0061   251 | 1/24
  9 h-m-p  0.0017 0.0118 120.2310 YCCC   1894.222937  3 0.0035   283 | 1/24
 10 h-m-p  0.0052 0.0347  80.6031 CYCC   1891.468473  3 0.0061   315 | 1/24
 11 h-m-p  0.0055 0.0322  89.6016 YC     1883.617925  1 0.0136   343 | 1/24
 12 h-m-p  0.0048 0.0240  85.9916 YCY    1878.207008  2 0.0109   373 | 1/24
 13 h-m-p  0.0093 0.0467  45.3860 YCCCC  1872.869694  4 0.0230   407 | 1/24
 14 h-m-p  0.0142 0.0708  23.7020 +YCCC  1867.565637  3 0.0463   440 | 1/24
 15 h-m-p  0.0223 0.1117  36.7888 CC     1862.959044  1 0.0310   469 | 1/24
 16 h-m-p  0.0092 0.0459  23.7588 CCCCC  1861.613318  4 0.0153   504 | 1/24
 17 h-m-p  0.0416 0.2079   4.8284 YCC    1861.301477  2 0.0279   534 | 1/24
 18 h-m-p  0.0416 1.2534   3.2346 +CYC   1859.773581  2 0.1932   565 | 1/24
 19 h-m-p  0.0309 0.2107  20.2478 +YCC   1855.344481  2 0.0845   596 | 1/24
 20 h-m-p  0.0326 0.1630  24.5038 CYC    1853.371006  2 0.0342   626 | 1/24
 21 h-m-p  0.0550 0.2752  12.6925 YCCC   1852.290975  3 0.0412   658 | 1/24
 22 h-m-p  0.1173 1.5913   4.4591 YCCC   1850.803346  3 0.1953   690 | 1/24
 23 h-m-p  0.1100 0.5634   7.9194 YCCC   1850.164780  3 0.0477   722 | 1/24
 24 h-m-p  0.1000 1.8916   3.7801 +YCCCCC  1847.320425  5 0.4475   759 | 1/24
 25 h-m-p  0.0515 0.2575  13.6766 YCC    1846.605584  2 0.0369   789 | 1/24
 26 h-m-p  0.2047 8.0000   2.4645 ++YCCC  1843.210986  3 1.9811   823 | 1/24
 27 h-m-p  1.6000 8.0000   1.8570 YCCC   1839.582380  3 3.2871   855 | 1/24
 28 h-m-p  1.6000 8.0000   2.5565 YCCC   1835.974795  3 3.8378   887 | 1/24
 29 h-m-p  1.6000 8.0000   3.1618 YCCC   1833.298465  3 3.7356   919 | 1/24
 30 h-m-p  0.7451 3.7256   7.9325 CCCC   1832.220316  3 0.9924   952 | 1/24
 31 h-m-p  0.6654 3.3271   4.0134 CC     1831.526428  1 1.0471   981 | 1/24
 32 h-m-p  0.7979 3.9896   3.9729 YCCCC  1831.054749  4 1.8886  1015 | 1/24
 33 h-m-p  1.6000 8.0000   0.6941 CCC    1830.475378  2 1.8381  1046 | 1/24
 34 h-m-p  0.4706 8.0000   2.7113 +YCCC  1829.864945  3 3.6950  1102 | 1/24
 35 h-m-p  1.6000 8.0000   2.9282 +YCCC  1829.034879  3 4.3148  1135 | 1/24
 36 h-m-p  1.6000 8.0000   1.4992 CCC    1828.208049  2 1.8410  1166 | 1/24
 37 h-m-p  0.3724 8.0000   7.4114 +YCCC  1827.557952  3 2.6759  1199 | 1/24
 38 h-m-p  1.6000 8.0000   2.9323 YCCC   1827.052165  3 2.6347  1231 | 1/24
 39 h-m-p  1.0649 8.0000   7.2549 CCCC   1826.847052  3 1.5600  1264 | 1/24
 40 h-m-p  1.6000 8.0000   1.1721 YC     1826.606934  1 3.0587  1292 | 1/24
 41 h-m-p  1.0707 8.0000   3.3484 YC     1826.512690  1 2.4066  1320 | 1/24
 42 h-m-p  1.6000 8.0000   1.3944 YC     1826.391569  1 3.0777  1348 | 1/24
 43 h-m-p  1.0793 8.0000   3.9762 CCC    1826.352695  2 1.6250  1379 | 1/24
 44 h-m-p  1.6000 8.0000   0.5098 +YC    1826.302581  1 4.6190  1408 | 1/24
 45 h-m-p  1.6000 8.0000   1.3577 YC     1826.246340  1 2.8621  1459 | 1/24
 46 h-m-p  1.6000 8.0000   1.0947 CC     1826.224950  1 2.3382  1488 | 1/24
 47 h-m-p  1.6000 8.0000   1.1995 +CC    1826.163093  1 6.2695  1518 | 1/24
 48 h-m-p  1.6000 8.0000   1.6753 YC     1826.086706  1 3.5491  1546 | 1/24
 49 h-m-p  1.6000 8.0000   2.1209 +YC    1825.986540  1 5.1817  1575 | 1/24
 50 h-m-p  1.6000 8.0000   2.1542 YCCC   1825.708668  3 3.6420  1607 | 1/24
 51 h-m-p  1.6000 8.0000   3.4291 CC     1825.570070  1 1.9608  1636 | 1/24
 52 h-m-p  1.6000 8.0000   2.1947 ++     1825.137114  m 8.0000  1663 | 1/24
 53 h-m-p  1.0043 5.0215   9.6391 +YCC   1824.737678  2 3.0242  1694 | 1/24
 54 h-m-p  0.2451 1.2253  15.8820 ++     1824.321015  m 1.2253  1721 | 1/24
 55 h-m-p -0.0000 -0.0000  37.5722 
h-m-p:     -0.00000000e+00     -0.00000000e+00      3.75721593e+01  1824.321015
..  | 1/24
 56 h-m-p  0.0002 0.0824   9.1661 +++YCCC  1823.402392  3 0.0255  1780 | 1/24
 57 h-m-p  0.0124 0.0618  13.0928 CCC    1822.953525  2 0.0110  1811 | 1/24
 58 h-m-p  0.0138 0.0688   8.9384 CYCCC  1822.399058  4 0.0247  1845 | 1/24
 59 h-m-p  0.1280 0.8694   1.7259 YCC    1822.374017  2 0.0182  1875 | 1/24
 60 h-m-p  0.0081 0.2208   3.8954 +YCC   1822.309163  2 0.0237  1906 | 1/24
 61 h-m-p  0.0554 1.0548   1.6659 CCC    1822.249193  2 0.0689  1937 | 1/24
 62 h-m-p  0.0714 0.8097   1.6086 YCCC   1822.133795  3 0.1558  1969 | 1/24
 63 h-m-p  0.0405 0.3898   6.1872 YCCCC  1821.824711  4 0.0997  2003 | 1/24
 64 h-m-p  0.0328 0.1640   9.7695 YYYC   1821.693423  3 0.0296  2033 | 1/24
 65 h-m-p  0.0417 0.2085   5.0247 YCCC   1821.631335  3 0.0276  2065 | 1/24
 66 h-m-p  0.0971 0.7611   1.4265 YYC    1821.562606  2 0.0821  2094 | 1/24
 67 h-m-p  0.0531 0.4304   2.2059 CCC    1821.451705  2 0.0637  2125 | 1/24
 68 h-m-p  0.1011 0.7953   1.3896 CCC    1821.292025  2 0.1041  2156 | 1/24
 69 h-m-p  0.1010 0.5974   1.4323 YC     1821.240034  1 0.0436  2184 | 1/24
 70 h-m-p  0.0780 1.7471   0.7997 C      1821.194322  0 0.0781  2211 | 1/24
 71 h-m-p  0.1071 2.7764   0.5833 CCC    1821.088473  2 0.1699  2265 | 1/24
 72 h-m-p  0.0725 0.7803   1.3664 CCC    1820.984494  2 0.0906  2319 | 1/24
 73 h-m-p  0.0649 0.7009   1.9058 CCC    1820.909482  2 0.0737  2350 | 1/24
 74 h-m-p  0.0446 0.5930   3.1480 YCCC   1820.758063  3 0.1033  2382 | 1/24
 75 h-m-p  0.0430 0.2269   7.5700 YYCC   1820.656304  3 0.0301  2413 | 1/24
 76 h-m-p  0.1330 0.9214   1.7116 YCCC   1820.571704  3 0.0876  2445 | 1/24
 77 h-m-p  0.0803 0.5408   1.8661 YYC    1820.479214  2 0.0593  2474 | 1/24
 78 h-m-p  0.1484 1.4799   0.7457 YC     1820.437015  1 0.0630  2502 | 1/24
 79 h-m-p  0.2103 5.2015   0.2235 YC     1820.320995  1 0.4655  2553 | 1/24
 80 h-m-p  0.0870 0.7780   1.1952 YC     1820.288425  1 0.0436  2604 | 1/24
 81 h-m-p  0.0407 1.6776   1.2812 +YCC   1820.201536  2 0.1335  2635 | 1/24
 82 h-m-p  0.1523 0.7615   0.9941 CCCC   1820.091431  3 0.1691  2668 | 1/24
 83 h-m-p  0.3135 2.3258   0.5363 CCCCC  1819.979396  4 0.4265  2726 | 1/24
 84 h-m-p  0.5952 4.1748   0.3843 YC     1819.904706  1 0.2432  2777 | 1/24
 85 h-m-p  0.1735 2.3198   0.5389 CCCC   1819.839982  3 0.2799  2833 | 1/24
 86 h-m-p  0.2966 1.4832   0.3935 YYC    1819.764165  2 0.2551  2885 | 1/24
 87 h-m-p  0.1277 1.0442   0.7862 CCCC   1819.708009  3 0.1499  2941 | 1/24
 88 h-m-p  0.3166 1.9123   0.3721 YCCC   1819.668280  3 0.1758  2996 | 1/24
 89 h-m-p  0.3295 3.6698   0.1986 CY     1819.619521  1 0.3246  3048 | 1/24
 90 h-m-p  0.1442 3.2520   0.4471 YCCC   1819.558723  3 0.3218  3103 | 1/24
 91 h-m-p  0.4376 2.1879   0.2932 YCC    1819.519933  2 0.2602  3156 | 1/24
 92 h-m-p  0.1289 1.4536   0.5918 CCCC   1819.486712  3 0.1616  3212 | 1/24
 93 h-m-p  0.2175 2.1477   0.4398 YCC    1819.457608  2 0.1507  3265 | 1/24
 94 h-m-p  0.3669 4.0377   0.1806 YC     1819.430556  1 0.2325  3316 | 1/24
 95 h-m-p  0.0838 1.7475   0.5011 +YCCC  1819.392900  3 0.2211  3372 | 1/24
 96 h-m-p  0.3581 3.4443   0.3094 YYYC   1819.355347  3 0.3423  3425 | 1/24
 97 h-m-p  0.4532 3.6848   0.2337 YYC    1819.325501  2 0.3313  3477 | 1/24
 98 h-m-p  0.2261 3.0459   0.3425 YYC    1819.302551  2 0.1909  3529 | 1/24
 99 h-m-p  0.3286 7.4462   0.1989 CC     1819.280630  1 0.2877  3581 | 1/24
100 h-m-p  0.1084 2.2949   0.5280 CCC    1819.267209  2 0.1210  3635 | 1/24
101 h-m-p  0.1756 2.1739   0.3638 YCCC   1819.229501  3 0.3494  3690 | 1/24
102 h-m-p  0.2904 2.2397   0.4376 YCC    1819.214396  2 0.1430  3743 | 1/24
103 h-m-p  0.1185 2.2019   0.5285 CCC    1819.196532  2 0.1487  3797 | 1/24
104 h-m-p  0.3133 2.8350   0.2508 YC     1819.185870  1 0.1562  3848 | 1/24
105 h-m-p  0.1146 2.5079   0.3417 CC     1819.166673  1 0.1724  3900 | 1/24
106 h-m-p  0.2258 3.9759   0.2608 YYC    1819.157890  2 0.1933  3952 | 1/24
107 h-m-p  0.1019 2.7003   0.4948 YCC    1819.137329  2 0.1925  4005 | 1/24
108 h-m-p  0.4235 4.7399   0.2249 CC     1819.128775  1 0.1283  4057 | 1/24
109 h-m-p  0.0522 2.6585   0.5526 +CCCC  1819.103471  3 0.2918  4114 | 1/24
110 h-m-p  0.5125 3.9992   0.3147 C      1819.097402  0 0.1281  4164 | 1/24
111 h-m-p  0.0827 2.6922   0.4878 CCC    1819.088316  2 0.1181  4218 | 1/24
112 h-m-p  0.1657 3.3872   0.3476 YC     1819.079967  1 0.1173  4269 | 1/24
113 h-m-p  0.3385 7.4956   0.1204 CC     1819.067348  1 0.5464  4321 | 1/24
114 h-m-p  0.2635 5.2727   0.2497 YC     1819.061175  1 0.1670  4372 | 1/24
115 h-m-p  0.1169 5.2838   0.3569 +YYYC  1819.043042  3 0.4296  4426 | 1/24
116 h-m-p  0.7331 8.0000   0.2091 CC     1819.033476  1 0.2767  4478 | 1/24
117 h-m-p  0.1005 3.5642   0.5760 YCCC   1819.023906  3 0.1874  4533 | 1/24
118 h-m-p  0.3688 5.5253   0.2927 CYC    1819.012994  2 0.3406  4586 | 1/24
119 h-m-p  0.4858 8.0000   0.2053 CCC    1819.003303  2 0.5212  4640 | 1/24
120 h-m-p  0.8976 8.0000   0.1192 YC     1818.994825  1 0.5173  4691 | 1/24
121 h-m-p  0.1558 4.5670   0.3958 CCC    1818.988266  2 0.2150  4745 | 1/24
122 h-m-p  0.4712 8.0000   0.1806 C      1818.980109  0 0.5043  4795 | 1/24
123 h-m-p  0.2222 6.4494   0.4100 CCC    1818.973510  2 0.3053  4849 | 1/24
124 h-m-p  0.5392 8.0000   0.2321 YYC    1818.965292  2 0.4582  4901 | 1/24
125 h-m-p  0.5162 8.0000   0.2060 YCC    1818.959857  2 0.3812  4954 | 1/24
126 h-m-p  0.4349 8.0000   0.1806 CCC    1818.952442  2 0.7209  5008 | 1/24
127 h-m-p  1.0739 8.0000   0.1212 YC     1818.946153  1 0.5971  5059 | 1/24
128 h-m-p  0.1484 5.2076   0.4880 YCCC   1818.940083  3 0.3300  5114 | 1/24
129 h-m-p  0.5741 8.0000   0.2804 YY     1818.934303  1 0.5266  5165 | 1/24
130 h-m-p  1.0469 8.0000   0.1411 YC     1818.930241  1 0.5363  5216 | 1/24
131 h-m-p  0.4301 8.0000   0.1759 YC     1818.925172  1 0.7906  5267 | 1/24
132 h-m-p  0.8465 8.0000   0.1643 YCC    1818.921059  2 0.5694  5320 | 1/24
133 h-m-p  0.1638 8.0000   0.5710 YCCC   1818.916824  3 0.3175  5375 | 1/24
134 h-m-p  0.5424 8.0000   0.3343 YYC    1818.912353  2 0.4741  5427 | 1/24
135 h-m-p  0.9934 8.0000   0.1595 YC     1818.909372  1 0.6352  5478 | 1/24
136 h-m-p  0.8248 8.0000   0.1229 CC     1818.906527  1 0.6688  5530 | 1/24
137 h-m-p  0.1708 8.0000   0.4812 YC     1818.903398  1 0.3824  5581 | 1/24
138 h-m-p  0.6551 8.0000   0.2809 C      1818.899727  0 0.6755  5631 | 1/24
139 h-m-p  0.5313 8.0000   0.3571 YYC    1818.898038  2 0.4020  5683 | 1/24
140 h-m-p  0.8672 8.0000   0.1655 YC     1818.895562  1 0.6054  5734 | 1/24
141 h-m-p  0.2898 8.0000   0.3458 YC     1818.892736  1 0.6896  5785 | 1/24
142 h-m-p  0.8455 8.0000   0.2820 YYC    1818.890628  2 0.6927  5837 | 1/24
143 h-m-p  1.0366 8.0000   0.1884 CC     1818.888585  1 0.8324  5889 | 1/24
144 h-m-p  0.3926 8.0000   0.3995 C      1818.887268  0 0.3991  5939 | 1/24
145 h-m-p  0.5925 8.0000   0.2691 CY     1818.885209  1 0.8495  5991 | 1/24
146 h-m-p  0.3504 8.0000   0.6525 YY     1818.884084  1 0.3504  6042 | 1/24
147 h-m-p  0.7638 8.0000   0.2993 C      1818.882615  0 0.6947  6092 | 1/24
148 h-m-p  1.0611 8.0000   0.1960 C      1818.881327  0 1.1742  6142 | 1/24
149 h-m-p  0.9111 8.0000   0.2526 CC     1818.880088  1 1.0818  6194 | 1/24
150 h-m-p  0.6489 8.0000   0.4211 C      1818.879144  0 0.6642  6244 | 1/24
151 h-m-p  0.8797 8.0000   0.3179 C      1818.878237  0 0.8797  6294 | 1/24
152 h-m-p  0.2862 8.0000   0.9772 C      1818.877586  0 0.2862  6344 | 1/24
153 h-m-p  0.5894 8.0000   0.4745 C      1818.877047  0 0.6122  6394 | 1/24
154 h-m-p  0.9325 8.0000   0.3115 C      1818.876609  0 0.8081  6444 | 1/24
155 h-m-p  1.6000 8.0000   0.1502 YC     1818.876238  1 0.9652  6495 | 1/24
156 h-m-p  0.3129 8.0000   0.4631 +C     1818.875668  0 1.2517  6546 | 1/24
157 h-m-p  1.3460 8.0000   0.4307 C      1818.875273  0 1.2122  6596 | 1/24
158 h-m-p  1.4278 8.0000   0.3657 YC     1818.875055  1 0.7867  6647 | 1/24
159 h-m-p  0.4729 8.0000   0.6083 YC     1818.874804  1 0.9675  6698 | 1/24
160 h-m-p  1.5590 8.0000   0.3775 YC     1818.874649  1 0.7692  6749 | 1/24
161 h-m-p  0.4457 8.0000   0.6516 YC     1818.874504  1 1.0902  6800 | 1/24
162 h-m-p  1.5066 8.0000   0.4715 C      1818.874380  0 1.8849  6850 | 1/24
163 h-m-p  1.6000 8.0000   0.3752 C      1818.874304  0 1.8273  6900 | 1/24
164 h-m-p  1.0596 8.0000   0.6471 C      1818.874271  0 1.0596  6950 | 1/24
165 h-m-p  1.1340 8.0000   0.6047 C      1818.874247  0 1.0081  7000 | 1/24
166 h-m-p  0.9556 8.0000   0.6378 C      1818.874229  0 1.5258  7050 | 1/24
167 h-m-p  1.6000 8.0000   0.5978 C      1818.874218  0 1.3981  7100 | 1/24
168 h-m-p  1.4143 8.0000   0.5909 C      1818.874211  0 1.9318  7150 | 1/24
169 h-m-p  1.6000 8.0000   0.5364 C      1818.874209  0 1.6000  7200 | 1/24
170 h-m-p  1.2467 8.0000   0.6885 C      1818.874207  0 1.5143  7250 | 1/24
171 h-m-p  1.5686 8.0000   0.6647 C      1818.874206  0 1.5685  7300 | 1/24
172 h-m-p  1.6000 8.0000   0.5859 C      1818.874206  0 1.6000  7350 | 1/24
173 h-m-p  1.6000 8.0000   0.5766 C      1818.874206  0 2.2378  7400 | 1/24
174 h-m-p  1.6000 8.0000   0.5671 C      1818.874206  0 1.8832  7450 | 1/24
175 h-m-p  1.6000 8.0000   0.5524 C      1818.874206  0 1.5478  7500 | 1/24
176 h-m-p  1.4348 8.0000   0.5959 C      1818.874206  0 1.6068  7550 | 1/24
177 h-m-p  1.6000 8.0000   0.5953 C      1818.874206  0 1.4973  7600 | 1/24
178 h-m-p  1.4047 8.0000   0.6345 Y      1818.874206  0 2.3480  7650 | 1/24
179 h-m-p  1.6000 8.0000   0.5862 C      1818.874206  0 1.4186  7700 | 1/24
180 h-m-p  1.1112 8.0000   0.7483 C      1818.874206  0 1.4701  7750 | 1/24
181 h-m-p  1.6000 8.0000   0.6641 Y      1818.874206  0 3.9599  7800 | 1/24
182 h-m-p  1.6000 8.0000   0.5855 -C     1818.874206  0 0.1324  7851 | 1/24
183 h-m-p  0.3542 8.0000   0.2188 Y      1818.874206  0 0.0886  7901 | 1/24
184 h-m-p  0.0160 8.0000   1.3770 -------------..  | 1/24
185 h-m-p  0.0004 0.2060   0.0226 --C    1818.874206  0 0.0000  7991 | 1/24
186 h-m-p  0.0115 5.7280   0.0033 ---C   1818.874206  0 0.0000  8044 | 1/24
187 h-m-p  0.0160 8.0000   0.0013 ---C   1818.874206  0 0.0001  8097 | 1/24
188 h-m-p  0.0160 8.0000   0.0007 --Y    1818.874206  0 0.0002  8149
Out..
lnL  = -1818.874206
8150 lfun, 32600 eigenQcodon, 464550 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1899.668596  S = -1876.257185   -16.381717
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 137 patterns   3:13
	did  20 / 137 patterns   3:13
	did  30 / 137 patterns   3:13
	did  40 / 137 patterns   3:13
	did  50 / 137 patterns   3:13
	did  60 / 137 patterns   3:14
	did  70 / 137 patterns   3:14
	did  80 / 137 patterns   3:14
	did  90 / 137 patterns   3:14
	did 100 / 137 patterns   3:14
	did 110 / 137 patterns   3:14
	did 120 / 137 patterns   3:14
	did 130 / 137 patterns   3:14
	did 137 / 137 patterns   3:14
Time used:  3:14


Model 3: discrete

TREE #  1
(1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
    0.083181    0.025741    0.008950    0.037139    0.042280    0.016784    0.049040    0.001367    0.024406    0.057061    0.036997    0.086024    0.110568    0.151591    0.068699    0.021902    0.013463    0.019642    0.005469    2.164433    0.335590    0.845675    0.000050    0.000128    0.000180

ntime & nrate & np:    19     4    25

Bounds (np=25):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 23.687820

np =    25
lnL0 = -1827.618779

Iterating by ming2
Initial: fx=  1827.618779
x=  0.08318  0.02574  0.00895  0.03714  0.04228  0.01678  0.04904  0.00137  0.02441  0.05706  0.03700  0.08602  0.11057  0.15159  0.06870  0.02190  0.01346  0.01964  0.00547  2.16443  0.33559  0.84567  0.00005  0.00013  0.00018

  1 h-m-p  0.0000 0.0000 1277.6955 ++     1827.385362  m 0.0000    30 | 1/25
  2 h-m-p  0.0000 0.0000 915.4404 ++     1827.350440  m 0.0000    58 | 2/25
  3 h-m-p  0.0000 0.0000 845.8597 ++     1827.312777  m 0.0000    86 | 3/25
  4 h-m-p  0.0000 0.0001 248.9288 +YYCCC  1826.763864  4 0.0000   121 | 3/25
  5 h-m-p  0.0001 0.0010  56.9173 CCC    1826.528973  2 0.0001   153 | 3/25
  6 h-m-p  0.0001 0.0017  57.9263 CYC    1826.365005  2 0.0001   184 | 3/25
  7 h-m-p  0.0003 0.0020  30.3063 YC     1826.288536  1 0.0002   213 | 3/25
  8 h-m-p  0.0002 0.0028  30.4180 YC     1826.248536  1 0.0002   242 | 3/25
  9 h-m-p  0.0002 0.0049  22.2832 YC     1826.197694  1 0.0004   271 | 3/25
 10 h-m-p  0.0002 0.0105  51.5556 +C     1826.022786  0 0.0007   300 | 3/25
 11 h-m-p  0.0002 0.0012 137.9115 CCCC   1825.825544  3 0.0003   334 | 3/25
 12 h-m-p  0.0002 0.0016 205.0386 YCCC   1825.418509  3 0.0004   367 | 3/25
 13 h-m-p  0.0002 0.0016 332.9221 YCCC   1824.659796  3 0.0005   400 | 3/25
 14 h-m-p  0.0004 0.0019 270.5712 CCC    1824.122196  2 0.0004   432 | 3/25
 15 h-m-p  0.0006 0.0029  70.0436 YCC    1823.978427  2 0.0004   463 | 3/25
 16 h-m-p  0.0028 0.0232  11.3028 YC     1823.964321  1 0.0004   492 | 3/25
 17 h-m-p  0.0008 0.0102   5.3944 YC     1823.959214  1 0.0004   521 | 3/25
 18 h-m-p  0.0005 0.0115   3.9946 YC     1823.950788  1 0.0009   550 | 3/25
 19 h-m-p  0.0006 0.0252   5.5773 CC     1823.937989  1 0.0010   580 | 3/25
 20 h-m-p  0.0011 0.0508   4.7779 YC     1823.912191  1 0.0021   609 | 3/25
 21 h-m-p  0.0005 0.1677  21.2307 +++CYC  1822.312525  2 0.0309   643 | 3/25
 22 h-m-p  0.0016 0.0087 406.6426 CYC    1821.790407  2 0.0005   674 | 3/25
 23 h-m-p  0.0840 1.3288   2.4121 +YYCCC  1820.624107  4 0.2584   709 | 3/25
 24 h-m-p  1.6000 8.0000   0.3484 YCCC   1819.610017  3 3.1662   742 | 3/25
 25 h-m-p  1.6000 8.0000   0.4014 CCC    1819.094490  2 2.2366   796 | 3/25
 26 h-m-p  1.6000 8.0000   0.3381 CCC    1818.901697  2 2.3413   850 | 3/25
 27 h-m-p  1.6000 8.0000   0.1631 CC     1818.875048  1 1.4093   902 | 3/25
 28 h-m-p  1.6000 8.0000   0.0076 YC     1818.874248  1 1.2358   953 | 3/25
 29 h-m-p  1.6000 8.0000   0.0052 C      1818.874208  0 1.4088  1003 | 3/25
 30 h-m-p  1.6000 8.0000   0.0020 Y      1818.874206  0 1.1350  1053 | 3/25
 31 h-m-p  1.6000 8.0000   0.0004 C      1818.874206  0 1.3359  1103 | 3/25
 32 h-m-p  1.6000 8.0000   0.0000 Y      1818.874206  0 1.1550  1153 | 3/25
 33 h-m-p  1.6000 8.0000   0.0000 C      1818.874206  0 0.4000  1203 | 3/25
 34 h-m-p  0.3088 8.0000   0.0000 -C     1818.874206  0 0.0193  1254 | 3/25
 35 h-m-p  0.0187 8.0000   0.0000 -----------Y  1818.874206  0 0.0000  1315
Out..
lnL  = -1818.874206
1316 lfun, 5264 eigenQcodon, 75012 P(t)

Time used:  3:39


Model 7: beta

TREE #  1
(1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
    0.083181    0.025741    0.008950    0.037139    0.042280    0.016784    0.049040    0.001367    0.024406    0.057061    0.036997    0.086024    0.110568    0.151591    0.068699    0.021902    0.013463    0.019642    0.005469    2.164435    0.637551    1.244267

ntime & nrate & np:    19     1    22

Bounds (np=22):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 8.993874

np =    22
lnL0 = -2020.344027

Iterating by ming2
Initial: fx=  2020.344027
x=  0.08318  0.02574  0.00895  0.03714  0.04228  0.01678  0.04904  0.00137  0.02441  0.05706  0.03700  0.08602  0.11057  0.15159  0.06870  0.02190  0.01346  0.01964  0.00547  2.16444  0.63755  1.24427

  1 h-m-p  0.0000 0.0009 1907.6539 +CYYCC  2009.439564  4 0.0000    35 | 0/22
  2 h-m-p  0.0002 0.0022 303.7207 +YYCCC  1987.310250  4 0.0009    67 | 0/22
  3 h-m-p  0.0000 0.0002 475.8745 ++     1965.229194  m 0.0002    92 | 0/22
  4 h-m-p  0.0000 0.0000 40675.0513 ++     1906.957808  m 0.0000   117 | 0/22
  5 h-m-p  0.0000 0.0001 381.2105 ++     1904.328676  m 0.0001   142 | 0/22
  6 h-m-p -0.0000 -0.0000 126.6778 
h-m-p:     -6.86543696e-22     -3.43271848e-21      1.26677830e+02  1904.328676
..  | 0/22
  7 h-m-p  0.0000 0.0002 1416.3608 YCYYCCC  1902.640834  6 0.0000   198 | 0/22
  8 h-m-p  0.0000 0.0001 354.3331 ++     1886.795502  m 0.0001   223 | 0/22
  9 h-m-p  0.0000 0.0001 2042.7486 ++     1861.822250  m 0.0001   248 | 0/22
 10 h-m-p  0.0000 0.0000 3047.7803 +YCCC  1853.338796  3 0.0000   279 | 0/22
 11 h-m-p  0.0000 0.0002 722.3206 +YYCCC  1842.316119  4 0.0001   311 | 0/22
 12 h-m-p  0.0000 0.0001 1299.9859 YCCCC  1837.317618  4 0.0000   343 | 0/22
 13 h-m-p  0.0000 0.0000 943.2206 +YCCC  1834.937080  3 0.0000   374 | 0/22
 14 h-m-p  0.0001 0.0004 293.8685 CCCC   1832.301420  3 0.0001   405 | 0/22
 15 h-m-p  0.0001 0.0003 170.0130 CYC    1831.824220  2 0.0001   433 | 0/22
 16 h-m-p  0.0001 0.0006 117.9516 CCC    1831.528270  2 0.0001   462 | 0/22
 17 h-m-p  0.0001 0.0006 121.7332 CCC    1831.265887  2 0.0001   491 | 0/22
 18 h-m-p  0.0002 0.0027  43.1659 CC     1831.067163  1 0.0003   518 | 0/22
 19 h-m-p  0.0001 0.0006  97.5971 YYC    1830.935528  2 0.0001   545 | 0/22
 20 h-m-p  0.0004 0.0055  26.4727 CC     1830.865322  1 0.0003   572 | 0/22
 21 h-m-p  0.0004 0.0188  18.1964 YC     1830.740300  1 0.0010   598 | 0/22
 22 h-m-p  0.0006 0.0047  30.5519 CCC    1830.595990  2 0.0007   627 | 0/22
 23 h-m-p  0.0003 0.0038  70.8022 YC     1830.279663  1 0.0007   653 | 0/22
 24 h-m-p  0.0003 0.0014 147.7014 ++     1828.666461  m 0.0014   678 | 1/22
 25 h-m-p  0.0027 0.0135  11.2865 YC     1828.651030  1 0.0004   704 | 1/22
 26 h-m-p  0.0028 0.0833   1.6122 CC     1828.595921  1 0.0045   731 | 1/22
 27 h-m-p  0.0006 0.0631  11.0625 ++CCCC  1826.479069  3 0.0151   764 | 1/22
 28 h-m-p  0.0003 0.0017 284.5304 +YYCCC  1821.977931  4 0.0011   796 | 1/22
 29 h-m-p  0.2048 1.0914   1.5519 CCCCC  1821.292803  4 0.2466   829 | 1/22
 30 h-m-p  0.5524 2.7619   0.5615 CCCC   1819.894868  3 0.7389   860 | 1/22
 31 h-m-p  0.3123 1.5613   0.1504 YCCCC  1819.584293  4 0.6294   913 | 1/22
 32 h-m-p  0.6172 6.4034   0.1534 YC     1819.126335  1 1.4975   960 | 1/22
 33 h-m-p  1.6000 8.0000   0.0548 CCC    1818.983077  2 1.7280  1010 | 1/22
 34 h-m-p  1.6000 8.0000   0.0287 YC     1818.915950  1 2.5684  1057 | 1/22
 35 h-m-p  1.6000 8.0000   0.0101 CY     1818.892362  1 1.5358  1105 | 1/22
 36 h-m-p  1.3137 8.0000   0.0118 YC     1818.882884  1 3.1348  1152 | 1/22
 37 h-m-p  1.6000 8.0000   0.0083 C      1818.880812  0 1.5036  1198 | 1/22
 38 h-m-p  1.6000 8.0000   0.0044 C      1818.880546  0 1.7801  1244 | 1/22
 39 h-m-p  1.4705 8.0000   0.0053 +Y     1818.880176  0 4.9193  1291 | 1/22
 40 h-m-p  1.6000 8.0000   0.0126 +C     1818.879385  0 5.8994  1338 | 1/22
 41 h-m-p  1.6000 8.0000   0.0336 +YC    1818.878050  1 4.2785  1386 | 1/22
 42 h-m-p  1.6000 8.0000   0.0635 +YC    1818.876237  1 4.9283  1434 | 1/22
 43 h-m-p  1.6000 8.0000   0.1289 CC     1818.875267  1 2.2438  1482 | 1/22
 44 h-m-p  1.6000 8.0000   0.1510 
QuantileBeta(0.15, 0.00500, 2.52595) = 1.006134e-160	2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.76759) = 9.007508e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24612) = 1.163408e-160	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds
C    1818.874519  1 4.5088  1530
QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.167173e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24033) = 1.207918e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24046) = 1.167093e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.24021) = 1.167253e-160	2000 rounds
 | 1/22
 45 h-m-p  1.6000 8.0000   0.2525 
QuantileBeta(0.15, 0.00500, 2.64434) = 9.516134e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.85635) = 6.113365e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.85630) = 8.673629e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.35632) = 7.172883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds
C     1818.874072  1 2.3767  1578
QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 8.731432e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84046) = 9.036244e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84060) = 8.730926e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.84032) = 8.731939e-161	2000 rounds
 | 1/22
 46 h-m-p  1.6000 8.0000   0.3235 
QuantileBeta(0.15, 0.00500, 3.35808) = 7.168518e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.91094) = 4.659638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.04595) = 5.788875e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds
C     1818.873773  1 3.6904  1625
QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 5.807730e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03435) = 6.010476e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03452) = 5.807460e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.03419) = 5.807999e-161	2000 rounds
 | 1/22
 47 h-m-p  1.6000 8.0000   0.4244 
QuantileBeta(0.15, 0.00500, 4.71332) = 4.877077e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 6.75024) = 3.292452e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.18151) = 4.391519e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds
C     1818.873604  1 2.6416  1672
QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.416118e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15532) = 4.570283e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15551) = 4.415939e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 5.15513) = 4.416296e-161	2000 rounds
 | 1/22
 48 h-m-p  1.6000 8.0000   0.5942 
QuantileBeta(0.15, 0.00500, 6.10601) = 3.669703e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 8.95809) = 2.434432e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 9.90879) = 2.188758e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 8.02634) = 2.735297e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds
C    1818.873406  1 4.7861  1720
QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.745195e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99915) = 2.841029e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99939) = 2.745106e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 7.99890) = 2.745284e-161	2000 rounds
 | 1/22
 49 h-m-p  1.6000 8.0000   1.0760 
QuantileBeta(0.15, 0.00500, 9.72080) = 2.233325e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.88576) = 1.432039e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds
C      1818.873293  0 2.4564  1766
QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.030638e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64227) = 2.101527e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 10.64228) = 2.030637e-161	2000 rounds
 | 1/22
 50 h-m-p  1.6000 8.0000   1.2001 
QuantileBeta(0.15, 0.00500, 12.56250) = 1.707651e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 18.32316) = 1.155974e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds
Y      1818.873235  0 3.1211  1791
QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483333e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.535116e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.38801) = 1.483332e-161	2000 rounds
 | 1/22
 51 h-m-p  1.6000 8.0000   1.4627 
QuantileBeta(0.15, 0.00500, 16.72840) = 1.269519e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 23.74957) = 8.862485e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds
Y      1818.873190  0 3.7096  1816
QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.066764e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81423) = 1.104005e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 19.81424) = 1.066764e-161	2000 rounds
 | 1/22
 52 h-m-p  1.6000 8.0000   2.4836 
QuantileBeta(0.15, 0.00500, 23.78794) = 8.847885e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 35.70907) = 4.715151e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds
Y      1818.873145  0 3.5529  1841
QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.323100e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63806) = 7.578748e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 28.63807) = 7.323097e-162	2000 rounds
 | 1/22
 53 h-m-p  1.6000 8.0000   3.4405 
QuantileBeta(0.15, 0.00500, 34.14283) = 4.934633e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 50.65716) = 1.980672e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds
Y      1818.873122  0 2.8985  1866
QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.356232e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61042) = 4.505200e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 38.61043) = 4.356230e-162	2000 rounds
 | 1/22
 54 h-m-p  1.6000 8.0000   4.4222 
QuantileBeta(0.15, 0.00500, 45.68586) = 3.674178e-162	2000 rounds
+
QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds
Y     1818.873100  0 4.2705  1892
QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.369142e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49501) = 7.627483e-163	2000 rounds

QuantileBeta(0.15, 0.00500, 57.49504) = 7.369138e-163	2000 rounds
 | 1/22
 55 h-m-p  1.1418 5.7091   7.2700 Y      1818.873087  0 2.6337  1917 | 1/22
 56 h-m-p  0.6409 3.2045   6.9771 +Y     1818.873080  0 2.8735  1943 | 1/22
 57 h-m-p  0.0298 0.1491  15.4892 ++     1818.873080  m 0.1491  1968 | 2/22
 58 h-m-p  0.0514 8.0000   0.0001 ++Y    1818.873078  0 1.3632  1995 | 2/22
 59 h-m-p  1.6000 8.0000   0.0000 C      1818.873078  0 1.6263  2040 | 2/22
 60 h-m-p  1.6000 8.0000   0.0000 C      1818.873078  0 1.6640  2085 | 2/22
 61 h-m-p  1.6000 8.0000   0.0000 C      1818.873078  0 0.4193  2130
Out..
lnL  = -1818.873078
2131 lfun, 23441 eigenQcodon, 404890 P(t)

Time used:  6:17


Model 8: beta&w>1

TREE #  1
(1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
initial w for M8:NSbetaw>1 reset.

    0.083181    0.025741    0.008950    0.037139    0.042280    0.016784    0.049040    0.001367    0.024406    0.057061    0.036997    0.086024    0.110568    0.151591    0.068699    0.021902    0.013463    0.019642    0.005469    2.164422    0.900000    0.681712    1.353905    2.843187

ntime & nrate & np:    19     2    24

Bounds (np=24):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 6.186402

np =    24
lnL0 = -2069.285832

Iterating by ming2
Initial: fx=  2069.285832
x=  0.08318  0.02574  0.00895  0.03714  0.04228  0.01678  0.04904  0.00137  0.02441  0.05706  0.03700  0.08602  0.11057  0.15159  0.06870  0.02190  0.01346  0.01964  0.00547  2.16442  0.90000  0.68171  1.35390  2.84319

  1 h-m-p  0.0000 0.0002 2299.5987 ++YCCC  2036.473679  3 0.0001    36 | 0/24
  2 h-m-p  0.0000 0.0001 425.9099 ++     2017.049634  m 0.0001    63 | 1/24
  3 h-m-p  0.0000 0.0002 914.6690 ++     1994.910116  m 0.0002    90 | 1/24
  4 h-m-p  0.0000 0.0001 5645.8222 ++     1954.207252  m 0.0001   117 | 1/24
  5 h-m-p  0.0000 0.0001 5565.1320 +YCCCC  1932.831907  4 0.0000   152 | 1/24
  6 h-m-p  0.0000 0.0002 553.4219 ++     1922.069256  m 0.0002   179 | 1/24
  7 h-m-p  0.0000 0.0000 19043.9706 ++     1920.791983  m 0.0000   206 | 1/24
  8 h-m-p  0.0000 0.0207 147.2111 ++YCYCCC  1907.939020  5 0.0013   243 | 1/24
  9 h-m-p  0.0004 0.0018  68.5509 +YCYCCC  1904.872624  5 0.0010   279 | 1/24
 10 h-m-p  0.0004 0.0020  63.2303 ++     1902.025169  m 0.0020   306 | 2/24
 11 h-m-p  0.0010 0.0050  54.4491 +YYCCC  1895.975367  4 0.0034   340 | 2/24
 12 h-m-p  0.0001 0.0007 307.8605 +YCYCCC  1886.021380  5 0.0006   376 | 2/24
 13 h-m-p  0.0006 0.0028 132.0501 YCYCCC  1879.049461  5 0.0015   411 | 1/24
 14 h-m-p  0.0002 0.0009 381.8937 CCCC   1877.177830  3 0.0002   444 | 1/24
 15 h-m-p  0.0004 0.0070 153.4352 +
QuantileBeta(0.15, 0.00500, 2.41003) = 1.065874e-160	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.13794) = 1.238052e-160	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.27398) = 1.145599e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.16570) = 1.218009e-160	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.16784) = 1.216495e-160	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.22091) = 1.179995e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17006) = 1.214922e-160	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.19548) = 1.197207e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds
C  1867.979728  5 0.0034   480
QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214797e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.17023) = 1.214798e-160	2000 rounds
 | 1/24
 16 h-m-p  0.0011 0.0053 284.8672 
QuantileBeta(0.15, 0.00500, 2.32306) = 1.115515e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78153) = 8.953387e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.45429) = 1.042250e-160	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.45649) = 1.041107e-160	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.61901) = 9.627801e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46381) = 1.037304e-160	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.54141) = 9.986655e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds
C   1859.717892  3 0.0020   512
QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.073348e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037141e-160	2000 rounds

QuantileBeta(0.15, 0.00500, 2.46413) = 1.037142e-160	2000 rounds
 | 1/24
 17 h-m-p  0.0009 0.0045 229.7913 
QuantileBeta(0.15, 0.00500, 2.57632) = 9.821959e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.91291) = 8.473116e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.65836) = 9.455394e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.66268) = 9.436863e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.78780) = 8.929241e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66862) = 9.411471e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.72821) = 9.164062e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds
C   1855.310238  3 0.0016   544
QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.738494e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66897) = 9.409988e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.66896) = 9.409995e-161	2000 rounds
 | 1/24
 18 h-m-p  0.0021 0.0107  42.3446 
QuantileBeta(0.15, 0.00500, 2.72302) = 9.185071e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.88520) = 8.570112e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.71616) = 9.213036e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.80411) = 8.867015e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72392) = 9.181425e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.76402) = 9.021501e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72447) = 9.179202e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.74424) = 9.099673e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds
C   1854.361077  3 0.0022   577
QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.499440e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.178998e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.72452) = 9.179004e-161	2000 rounds
 | 1/24
 19 h-m-p  0.0024 0.0121  38.7458 
QuantileBeta(0.15, 0.00500, 2.79103) = 8.916847e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.99056) = 8.212641e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.77664) = 8.972297e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.78732) = 8.931076e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.78962) = 8.922244e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.78996) = 8.920931e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds
C  1853.536054  4 0.0024   608
QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 9.232351e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78997) = 8.920919e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 2.78996) = 8.920925e-161	2000 rounds
 | 1/24
 20 h-m-p  0.0030 0.0433  29.9672 
QuantileBeta(0.15, 0.00500, 2.87610) = 8.602436e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.13452) = 7.769555e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.01505) = 5.839400e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.23044) = 7.499812e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.62274) = 6.566674e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.81889) = 6.181795e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.44956) = 6.948463e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.46468) = 6.913373e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.54371) = 6.735584e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48149) = 6.874783e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.48226) = 6.873017e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.51299) = 6.803609e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds
C  1846.517945  5 0.0245   645
QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 7.111503e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871612e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.48288) = 6.871617e-161	2000 rounds
 | 1/24
 21 h-m-p  0.0001 0.0006 1043.6108 
QuantileBeta(0.15, 0.00500, 3.59382) = 6.627505e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92665) = 5.988900e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.03759) = 5.802447e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.87464) = 6.080483e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.98212) = 5.894204e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92348) = 5.994404e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.95439) = 5.941176e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92747) = 5.987481e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.94093) = 5.964239e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds
C  1841.679219  3 0.0005   679
QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 6.196192e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987177e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.92764) = 5.987181e-161	2000 rounds
 | 1/24
 22 h-m-p  0.0003 0.0015  74.1178 
QuantileBeta(0.15, 0.00500, 3.94641) = 5.954820e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00272) = 5.859795e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94907) = 5.950265e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97590) = 5.904685e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds
C     1841.493404  1 0.0003   708
QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 6.157931e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.94910) = 5.950211e-161	2000 rounds
 | 1/24
 23 h-m-p  0.0007 0.0037  19.4870 
QuantileBeta(0.15, 0.00500, 3.96173) = 5.928661e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99963) = 5.864934e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.01226) = 5.843994e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99187) = 5.877864e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.99367) = 5.874861e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.99403) = 5.874268e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.99683) = 5.869597e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds
C  1840.974236  3 0.0026   740
QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 6.079262e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874192e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99407) = 5.874196e-161	2000 rounds
 | 1/24
 24 h-m-p  0.0001 0.0003  70.1073 
QuantileBeta(0.15, 0.00500, 3.99710) = 5.869145e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00619) = 5.854043e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds
+     1840.737485  m 0.0003   767
QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 6.053214e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849023e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.00922) = 5.849026e-161	2000 rounds
 | 1/24
 25 h-m-p  0.0045 0.0485   5.2179 
QuantileBeta(0.15, 0.00500, 3.99600) = 5.870981e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.95634) = 5.937844e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99317) = 5.875704e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97475) = 5.906611e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99267) = 5.876540e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.98371) = 5.891537e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds
C    1840.392872  2 0.0056   798
QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 6.081775e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876620e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.99262) = 5.876624e-161	2000 rounds
 | 1/24
 26 h-m-p  0.0002 0.0008  29.6363 
QuantileBeta(0.15, 0.00500, 3.98972) = 5.881473e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98101) = 5.896070e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
+     1839.494497  m 0.0008   825
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 1/24
 27 h-m-p  0.0000 0.0000   1.7585 
h-m-p:      2.97988068e-20      1.48994034e-19      1.75851003e+00  1839.494497
.. 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 1/24
 28 h-m-p  0.0000 0.0000 994.9134 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
+     1834.196991  m 0.0000   876
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 1/24
 29 h-m-p  0.0000 0.0001 363.8609 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C  1827.410849  6 0.0001   913
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 1/24
 30 h-m-p  0.0000 0.0000 558.0880 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
+     1824.100701  m 0.0000   940
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 2/24
 31 h-m-p  0.0000 0.0000 2259.3845 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C  1821.175673  3 0.0000   973
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 2/24
 32 h-m-p  0.0001 0.0004 180.3857 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C  1819.834813  4 0.0001  1008
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 2/24
 33 h-m-p  0.0002 0.0010  61.5117 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C    1819.551240  2 0.0002  1037
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 2/24
 34 h-m-p  0.0003 0.0023  42.3927 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C    1819.448915  2 0.0002  1067
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 2/24
 35 h-m-p  0.0003 0.0044  22.2780 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
C    1819.398738  2 0.0003  1098
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900952e-161	2000 rounds
 | 2/24
 36 h-m-p  0.0004 0.0155  15.1085 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
C     1819.382843  1 0.0002  1126
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
 | 2/24
 37 h-m-p  0.0004 0.0198   7.6276 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
C      1819.373947  0 0.0004  1153
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106952e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900947e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
 | 2/24
 38 h-m-p  0.0008 0.0161   4.2045 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
C     1819.372385  1 0.0002  1182
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900947e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
 | 2/24
 39 h-m-p  0.0003 0.0185   2.7246 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900950e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
C     1819.371519  1 0.0003  1210
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900947e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds
 | 2/24
 40 h-m-p  0.0002 0.0782   2.8976 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900950e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds
C    1819.365441  1 0.0018  1239
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 6.106950e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900946e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97811) = 5.900949e-161	2000 rounds
 | 2/24
 41 h-m-p  0.0003 0.0206  16.4502 
QuantileBeta(0.15, 0.00500, 3.97811) = 5.900948e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97812) = 5.900933e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds
C    1819.339793  1 0.0013  1269
QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 6.106943e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900939e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97812) = 5.900943e-161	2000 rounds
 | 2/24
 42 h-m-p  0.0003 0.0112  69.4464 
QuantileBeta(0.15, 0.00500, 3.97812) = 5.900936e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900915e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97818) = 5.900832e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds
C    1819.269564  1 0.0008  1298
QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 6.106923e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900920e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97813) = 5.900924e-161	2000 rounds
 | 2/24
 43 h-m-p  0.0004 0.0059 135.1953 
QuantileBeta(0.15, 0.00500, 3.97814) = 5.900905e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97817) = 5.900848e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900894e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97816) = 5.900871e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900894e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900882e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds
C    1819.155931  2 0.0007  1329
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 6.106892e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900890e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900893e-161	2000 rounds
 | 2/24
 44 h-m-p  0.0010 0.0072  91.2648 
QuantileBeta(0.15, 0.00500, 3.97816) = 5.900863e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900886e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97816) = 5.900873e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds
C     1819.118404  1 0.0003  1358
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 6.106881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900879e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900883e-161	2000 rounds
 | 2/24
 45 h-m-p  0.0028 0.0311  11.3198 
QuantileBeta(0.15, 0.00500, 3.97816) = 5.900872e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds
C     1819.111743  1 0.0005  1386
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 6.106879e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97816) = 5.900877e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900881e-161	2000 rounds
 | 2/24
 46 h-m-p  0.0083 0.0989   0.7008 
QuantileBeta(0.15, 0.00500, 3.97816) = 5.900877e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds
C     1819.110732  1 0.0013  1414
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 6.106878e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97832) = 5.900604e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97799) = 5.901157e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97815) = 5.900880e-161	2000 rounds
 | 2/24
 47 h-m-p  0.0007 0.3641   1.3089 
QuantileBeta(0.15, 0.00500, 3.97815) = 5.900879e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97816) = 5.900875e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97817) = 5.900861e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97820) = 5.900801e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds
C   1819.066926  1 0.0221  1466
QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 6.106839e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900839e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97818) = 5.900843e-161	2000 rounds
 | 2/24
 48 h-m-p  0.0005 0.0285  56.3377 
QuantileBeta(0.15, 0.00500, 3.97820) = 5.900805e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97827) = 5.900692e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97853) = 5.900238e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900721e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97822) = 5.900765e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds
C   1818.933483  2 0.0016  1497
QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 6.106717e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900721e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900725e-161	2000 rounds
 | 2/24
 49 h-m-p  0.0098 0.0492   2.9336 
QuantileBeta(0.15, 0.00500, 3.97826) = 5.900698e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900718e-161	2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.97825) = 5.900723e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds
C    1818.932395  1 0.0004  1526
QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 6.106716e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900720e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97825) = 5.900724e-161	2000 rounds
 | 2/24
 50 h-m-p  0.0531 8.0000   0.0218 
QuantileBeta(0.15, 0.00500, 3.97826) = 5.900704e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97829) = 5.900646e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97843) = 5.900413e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.97899) = 5.899480e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900218e-161	2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds
C   1818.879091  1 1.3829  1556
QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 6.106192e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97871) = 5.899941e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97838) = 5.900493e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97855) = 5.900217e-161	2000 rounds
 | 2/24
 51 h-m-p  1.6000 8.0000   0.0024 
QuantileBeta(0.15, 0.00500, 3.97887) = 5.899675e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97984) = 5.898049e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899758e-161	2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97868) = 5.899988e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds
C     1818.876498  1 1.3465  1607
QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 6.105720e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97898) = 5.899485e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97865) = 5.900037e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97882) = 5.899761e-161	2000 rounds
 | 2/24
 52 h-m-p  1.6000 8.0000   0.0015 
QuantileBeta(0.15, 0.00500, 3.97915) = 5.899201e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98015) = 5.897523e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds
C      1818.876231  0 1.4367  1656
QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 6.105200e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97928) = 5.898983e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97895) = 5.899534e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97912) = 5.899258e-161	2000 rounds
 | 2/24
 53 h-m-p  1.6000 8.0000   0.0008 
QuantileBeta(0.15, 0.00500, 3.97946) = 5.898681e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98049) = 5.896951e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds
C      1818.876168  0 2.5009  1705
QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 6.104266e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97982) = 5.898081e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97949) = 5.898632e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97965) = 5.898357e-161	2000 rounds
 | 2/24
 54 h-m-p  1.6000 8.0000   0.0005 
QuantileBeta(0.15, 0.00500, 3.98006) = 5.897663e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98130) = 5.895584e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds
C      1818.876155  0 1.4835  1754
QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 6.103601e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98020) = 5.897438e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.97987) = 5.897990e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98003) = 5.897714e-161	2000 rounds
 | 2/24
 55 h-m-p  1.6000 8.0000   0.0002 
QuantileBeta(0.15, 0.00500, 3.98034) = 5.897207e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98124) = 5.895687e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds
Y      1818.876154  0 1.2190  1803
QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 6.103201e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98043) = 5.897052e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98010) = 5.897603e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98026) = 5.897328e-161	2000 rounds
 | 2/24
 56 h-m-p  1.1465 8.0000   0.0002 
QuantileBeta(0.15, 0.00500, 3.98050) = 5.896938e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98119) = 5.895769e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds
+     1818.876154  m 8.0000  1852
QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 6.100389e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98205) = 5.894334e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98172) = 5.894885e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98188) = 5.894610e-161	2000 rounds
 | 2/24
 57 h-m-p  0.1041 8.0000   0.0155 
QuantileBeta(0.15, 0.00500, 3.98350) = 5.891894e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 3.98835) = 5.883763e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.00775) = 5.851459e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.08535) = 5.725705e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds
C    1818.876151  0 2.4887  1903
QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 6.033916e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02069) = 5.830108e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02036) = 5.830650e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.02052) = 5.830379e-161	2000 rounds
 | 2/24
 58 h-m-p  1.6000 8.0000   0.0216 
QuantileBeta(0.15, 0.00500, 4.05510) = 5.774083e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.15882) = 5.611517e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds
+     1818.876120  m 8.0000  1952
QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.753412e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19356) = 5.559086e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19322) = 5.559590e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.19339) = 5.559338e-161	2000 rounds
 | 2/24
 59 h-m-p  0.0996 8.0000   1.7365 
QuantileBeta(0.15, 0.00500, 4.36626) = 5.312314e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 4.88486) = 4.687224e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.95926) = 3.186164e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 15.25687) = 1.396046e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 18.08496) = 1.171626e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds
C   1818.875741  0 5.4646  2004
QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.617224e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562671e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 13.68246) = 1.562672e-161	2000 rounds
 | 2/24
 60 h-m-p  1.6000 8.0000   0.7168 
QuantileBeta(0.15, 0.00500, 14.82933) = 1.437675e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 18.26995) = 1.159434e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds
Y      1818.875666  0 1.1935  2031
QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.518728e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53831) = 1.467461e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53761) = 1.467535e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 14.53796) = 1.467498e-161	2000 rounds
 | 2/24
 61 h-m-p  1.1113 8.0000   0.7699 
QuantileBeta(0.15, 0.00500, 15.39346) = 1.383250e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 17.95995) = 1.180011e-161	2000 rounds
+
QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds
+     1818.875617  m 8.0000  2080
QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.055780e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69718) = 1.020144e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69630) = 1.020189e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds

QuantileBeta(0.15, 0.00500, 20.69674) = 1.020167e-161	2000 rounds
 | 2/24
 62 h-m-p  1.0696 8.0000   5.7580 
QuantileBeta(0.15, 0.00500, 26.85553) = 7.818287e-162	2000 rounds

QuantileBeta(0.15, 0.00500, 45.33188) = 3.703186e-162	2000 rounds
++     1818.875556  m 8.0000  2129 | 2/24
 63 h-m-p  1.6000 8.0000   3.6680 Y      1818.875535  0 1.2248  2156 | 2/24
 64 h-m-p  1.1406 7.0447   3.9388 ++     1818.875528  m 7.0447  2183 | 3/24
 65 h-m-p  1.4742 8.0000   0.1049 Y      1818.875526  0 1.0453  2210 | 3/24
 66 h-m-p  1.6000 8.0000   0.0050 C      1818.875526  0 1.3406  2258 | 3/24
 67 h-m-p  0.3941 8.0000   0.0171 +++    1818.875526  m 8.0000  2307 | 3/24
 68 h-m-p  0.6796 8.0000   0.2018 ++     1818.875521  m 8.0000  2355 | 3/24
 69 h-m-p  0.8356 8.0000   1.9316 ----------C  1818.875521  0 0.0000  2413 | 3/24
 70 h-m-p  0.0010 0.4900   3.1485 +++++  1818.875436  m 0.4900  2443 | 4/24
 71 h-m-p  0.7568 8.0000   0.0002 C      1818.875434  0 1.1826  2470 | 4/24
 72 h-m-p  1.6000 8.0000   0.0001 Y      1818.875434  0 0.8931  2517 | 4/24
 73 h-m-p  1.6000 8.0000   0.0000 C      1818.875434  0 1.6420  2564 | 4/24
 74 h-m-p  1.6000 8.0000   0.0000 C      1818.875434  0 0.4568  2611
Out..
lnL  = -1818.875434
2612 lfun, 31344 eigenQcodon, 545908 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1916.451632  S = -1876.257624   -33.205898
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 137 patterns  10:22
	did  20 / 137 patterns  10:22
	did  30 / 137 patterns  10:22
	did  40 / 137 patterns  10:23
	did  50 / 137 patterns  10:23
	did  60 / 137 patterns  10:23
	did  70 / 137 patterns  10:23
	did  80 / 137 patterns  10:23
	did  90 / 137 patterns  10:23
	did 100 / 137 patterns  10:24
	did 110 / 137 patterns  10:24
	did 120 / 137 patterns  10:24
	did 130 / 137 patterns  10:24
	did 137 / 137 patterns  10:24
Time used: 10:25
CodeML output code: -1
Download 
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=245 

D_melanogaster_Lmpt-PE   MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_sechellia_Lmpt-PE      MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_simulans_Lmpt-PE       MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_yakuba_Lmpt-PE         MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_erecta_Lmpt-PE         MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_takahashii_Lmpt-PE     MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_biarmipes_Lmpt-PE      MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_suzukii_Lmpt-PE        MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_eugracilis_Lmpt-PE     MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_ficusphila_Lmpt-PE     MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_rhopaloa_Lmpt-PE       MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
D_elegans_Lmpt-PE        MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
                         **************************************************

D_melanogaster_Lmpt-PE   EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_sechellia_Lmpt-PE      EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_simulans_Lmpt-PE       EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_yakuba_Lmpt-PE         EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_erecta_Lmpt-PE         EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_takahashii_Lmpt-PE     EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_biarmipes_Lmpt-PE      EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_suzukii_Lmpt-PE        EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_eugracilis_Lmpt-PE     EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_ficusphila_Lmpt-PE     EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_rhopaloa_Lmpt-PE       EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
D_elegans_Lmpt-PE        EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
                         **************************************************

D_melanogaster_Lmpt-PE   GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_sechellia_Lmpt-PE      GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_simulans_Lmpt-PE       GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_yakuba_Lmpt-PE         GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_erecta_Lmpt-PE         GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_takahashii_Lmpt-PE     GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_biarmipes_Lmpt-PE      GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_suzukii_Lmpt-PE        GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_eugracilis_Lmpt-PE     GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_ficusphila_Lmpt-PE     GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_rhopaloa_Lmpt-PE       GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
D_elegans_Lmpt-PE        GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
                         **************************************************

D_melanogaster_Lmpt-PE   TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_sechellia_Lmpt-PE      TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_simulans_Lmpt-PE       TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_yakuba_Lmpt-PE         TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_erecta_Lmpt-PE         TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_takahashii_Lmpt-PE     TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_biarmipes_Lmpt-PE      TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_suzukii_Lmpt-PE        TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_eugracilis_Lmpt-PE     TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_ficusphila_Lmpt-PE     TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_rhopaloa_Lmpt-PE       TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
D_elegans_Lmpt-PE        TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
                         **************************************************

D_melanogaster_Lmpt-PE   ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_sechellia_Lmpt-PE      ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_simulans_Lmpt-PE       ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_yakuba_Lmpt-PE         ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_erecta_Lmpt-PE         ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_takahashii_Lmpt-PE     ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_biarmipes_Lmpt-PE      ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_suzukii_Lmpt-PE        ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_eugracilis_Lmpt-PE     ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_ficusphila_Lmpt-PE     ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_rhopaloa_Lmpt-PE       ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
D_elegans_Lmpt-PE        ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
                         *********************************************
Download 
>D_melanogaster_Lmpt-PE
ATGACCGACGTGGATGTACTTAGTTCGAGAATGAAGTCTCGACTTCACCT
GCAAACCAAGACCATTGGCGCGGAGCGGATCAAGAAGGCCAAGGATAATA
ACGAGGATATCGCCGTGCTGAGCATGTTTCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTCTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAAATGGAGTATAAAACCA
GGCAGTGGCACGAGAATTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATT
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTATTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCGGAGTGCTTTGGCGAGCTCTTTGCCAAAA
GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATATCGTTTGAGGATCGCCACTGGCATCACGACTGCTTTGTGTGTGCCAG
CTGCAAGGCTAGTCTGGTTGGTCGTGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_sechellia_Lmpt-PE
ATGACCGACGTGGATGTACTCAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACTAAAACGATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATCGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTTTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTGTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAATGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGTTTC
ATCTCGTTTGAGGATCGCCACTGGCATCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_simulans_Lmpt-PE
ATGACCGACGTGGATGTACTCAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACCAAAACGATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATCGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTTTATTGCCAGTTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAATGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAGC
GGTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCATCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_yakuba_Lmpt-PE
ATGACCGACGTGGATGTACTGAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACCAAGACCATTGGTGCCGAGCGCATCAAGAAGGCGAAGGATAACA
ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACAGGAACTTTTATTGCCAGCTGGGCGACTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTATAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAACAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTACTGTGCCGAGTGCTTCGGCGAGCTGTTTGCCAAAC
GCTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGCGGCTTCATCACCGACGGACCCGATA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_erecta_Lmpt-PE
ATGACCGACGTGGATGTACTTAGTTCGAGAATGAAGTCTCGGCTCCACCT
GCAAACCAAGACCATTGGTGCCGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATTGCCGTGCTGAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGCAACTTTTATTGCCAGCTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGCACCAAGAAGATGGAGTATAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACCTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTCGGCGAGCTGTTTGCCAAAC
GCTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCTAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_takahashii_Lmpt-PE
ATGACCGACGTGGATGTGCTAAGCTCGAGAATGAAGTCTCGACTCCACCT
GCAAACCAAGACCATTGGCGCGGAGCGAATCAAGAAGGCCAAGGATAACA
ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
GAGGAAAACCGCAACTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATTAAGTGCAACAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACGTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGACGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCCAGTTTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_biarmipes_Lmpt-PE
ATGACCGATGTGGATGTGCTCAGCTCGAGGATGAAGTCGCGGCTCCATCT
GCAGACCAAAACCATTGGGGCGGAGCGGATCAAGAAGGCCAAGGATAACA
ACGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
GAGGAGAACCGCAATTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTGTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATTAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACGTGCACCCATTGCAACATCACGCTCGCTGGCCAGCGCTTCACCAGCCG
CGACGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCTAGTCTGGTGGGCCGTGGCTTCATCACCGACGGACCCGACA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGTTGATG
>D_suzukii_Lmpt-PE
ATGACCGATGTGGATGTGCTCAGTTCGAGGATGAAGTCGCGGCTTCATCT
GCAGACCAAAACCATTGGAGCGGAGCGAATCAAGAAGGCCAAGGATAACA
ATGAGGACATTGCCGTGCTCAGCATGTTCCTGCCGAACGCCTCCGCCGTG
GAGGAGAACCGGAACTTCTATTGCCAACTGGGCGATTATTGTCGCCTCGG
TGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCC
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATTAAGTGCAATAAGGTCATCA
CCTCGGGCGGTGTTACCTACAAGAACGAGCCGTGGCATCGTGAGTGCTTC
ACGTGCACCCACTGCAACATCACGCTAGCTGGCCAGCGGTTCACCAGCCG
CGATGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCCAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_eugracilis_Lmpt-PE
ATGACCGACGTGGATGTGCTTAGTTCGAGAATGAAGTCTCGGCTTCACCT
GCAAACCAAGACCATTGGAGCCGAGAGAATCAAGAAGGCGAAGGATAACA
ATGAGGACATTGCCGTGCTCAGCATGTTCCTACCCAATGCCTCTGCGGTG
GAGGAGAACAGGAACTTCTATTGCCAGCTGGGCGACTATTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCCTTCATCCCGCGGGAGCAGGAGATTTACTGCGCCGGCTG
CTACGAGGAGAAGTTTGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCTGGCGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTT
ACGTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGATGAGAAGCCCTATTGCGCCGAGTGCTTTGGCGAGTTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTT
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCTAGTCTCGTGGGCCGCGGCTTCATCACCGACGGACCCGACA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_ficusphila_Lmpt-PE
ATGACCGATGTGGATGTCCTCAGTTCGAGAATGAAGTCTCGTCTTCACCT
GCAAACCAAAACTATTGGTGCTGAGAGAATTAAGAAGGCCAAGGATAACA
ATGAGGATATTGCTGTGCTCAGCATGTTCCTACCAAACGCCTCCGCAGTG
GAGGAGAATCGCAATTTTTATTGCCAACTGGGCGATTATTGTCGTCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAGTGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGGACCAAGTCGTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTAATCA
CCTCGGGAGGTGTCACCTACAAGAACGAGCCGTGGCACCGCGAGTGCTTC
ACGTGCACCCACTGCAACATCACGCTCGCTGGCCAGCGGTTCACCAGCCG
CGATGAGAAGCCCTACTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAGC
GCTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGTGGCACACGGTTC
ATCTCGTTCGAGGATCGCCATTGGCACCACGACTGCTTCGTGTGCGCCAG
CTGCAAGGCCAGTCTGGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TCCTCTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_rhopaloa_Lmpt-PE
ATGACCGACGTCGATGTGCTAAGTTCGCGGATGAAGTCGCGACTTCATCT
GCAAACCAAAACCATTGGGGCCGAGCGAATCAAAAAGGCCAAGGATAACA
ATGAGGACATCGCCGTGCTTAGCATGTTCCTGCCGAATGCATCCGCCGTG
GAGGAGAACCGCAACTTCTATTGCCAACTGGGCGACTACTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGCACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCAGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGTGAGTGCTTC
ACCTGCACCCATTGCAACATCACGCTAGCTGGCCAGCGATTCACCAGCCG
CGATGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGAATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGCCACTGGCACCACGACTGCTTCGTGTGTGCCAG
CTGCAAGGCCAGTCTAGTGGGTCGTGGCTTCATCACCGACGGACCCGACA
TCCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
>D_elegans_Lmpt-PE
ATGACCGATGTGGATGTGCTGAGTTCGCGAATGAAGTCTCGCCTTCATCT
GCAAACCAAGACTATTGGCGCCGAGCGAATCAAGAAGGCCAAGGACAACA
ATGAGGACATTGCCGTGCTCAGCATGTTCCTGCCCAACGCCTCCGCCGTG
GAGGAGAACCGCAACTTTTATTGCCAACTGGGCGATTACTGTCGCCTCGG
CGATCCGCGTGCCAGCAAAGCAGGTACCAAGAAGATGGAGTACAAAACCA
GGCAATGGCACGAGAACTGCTTCTGCTGCTGCGTCTGCAAGACGGCCATC
GGCACCAAGTCCTTCATCCCGCGGGAGCAGGAGATCTACTGCGCCGGCTG
CTACGAGGAGAAGTTCGCCACGCGCTGCATCAAGTGCAATAAGGTCATCA
CCTCGGGAGGTGTTACCTACAAGAACGAGCCGTGGCATCGCGAGTGCTTC
ACGTGCACCCACTGCAACATCACGCTAGCTGGCCAGAGATTCACCAGCCG
CGATGAGAAGCCCTATTGTGCCGAGTGCTTTGGCGAGCTGTTTGCCAAAC
GTTGCACGGCCTGTGTGAAGCCCATAACAGGCATTGGCGGCACACGCTTC
ATCTCGTTTGAGGATCGTCACTGGCACCACGACTGCTTCGTTTGTGCCAG
CTGCAAGGCTAGTCTAGTGGGTCGTGGCTTCATCACCGACGGACCCGATA
TTCTGTGCCCCGATTGTGCCAAGCAGAAGCTGATG
Download 
>D_melanogaster_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_sechellia_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_simulans_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_yakuba_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_erecta_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_takahashii_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_biarmipes_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_suzukii_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_eugracilis_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_ficusphila_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_rhopaloa_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
>D_elegans_Lmpt-PE
MTDVDVLSSRMKSRLHLQTKTIGAERIKKAKDNNEDIAVLSMFLPNASAV
EENRNFYCQLGDYCRLGDPRASKAGTKKMEYKTRQWHENCFCCCVCKTAI
GTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGGVTYKNEPWHRECF
TCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTACVKPITGIGGTRF
ISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCPDCAKQKLM
Download 
#NEXUS

[ID: 9803365672]
begin taxa;
	dimensions ntax=12;
	taxlabels
		D_melanogaster_Lmpt-PE
		D_sechellia_Lmpt-PE
		D_simulans_Lmpt-PE
		D_yakuba_Lmpt-PE
		D_erecta_Lmpt-PE
		D_takahashii_Lmpt-PE
		D_biarmipes_Lmpt-PE
		D_suzukii_Lmpt-PE
		D_eugracilis_Lmpt-PE
		D_ficusphila_Lmpt-PE
		D_rhopaloa_Lmpt-PE
		D_elegans_Lmpt-PE
		;
end;
begin trees;
	translate
		1	D_melanogaster_Lmpt-PE,
		2	D_sechellia_Lmpt-PE,
		3	D_simulans_Lmpt-PE,
		4	D_yakuba_Lmpt-PE,
		5	D_erecta_Lmpt-PE,
		6	D_takahashii_Lmpt-PE,
		7	D_biarmipes_Lmpt-PE,
		8	D_suzukii_Lmpt-PE,
		9	D_eugracilis_Lmpt-PE,
		10	D_ficusphila_Lmpt-PE,
		11	D_rhopaloa_Lmpt-PE,
		12	D_elegans_Lmpt-PE
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.06678647,((4:0.03289264,((6:0.04274518,((7:0.05489961,8:0.02186732)0.913:0.02303358,11:0.07714711)0.636:0.02193448)0.506:0.01688433,9:0.09933852,10:0.142071,12:0.04648445)0.992:0.04280176)0.696:0.01097793,5:0.0161484)0.998:0.02419242,(2:0.01577463,3:0.004977948)0.921:0.0114429);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.06678647,((4:0.03289264,((6:0.04274518,((7:0.05489961,8:0.02186732):0.02303358,11:0.07714711):0.02193448):0.01688433,9:0.09933852,10:0.142071,12:0.04648445):0.04280176):0.01097793,5:0.0161484):0.02419242,(2:0.01577463,3:0.004977948):0.0114429);
end;
Download 
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1995.72         -2013.26
2      -1995.78         -2016.93
--------------------------------------
TOTAL    -1995.75         -2016.26
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/295/Lmpt-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.834238    0.012002    0.627644    1.051122    0.825141   1419.53   1460.27    1.000
r(A<->C){all}   0.080960    0.000492    0.040268    0.124935    0.079031    985.86   1102.20    1.000
r(A<->G){all}   0.220212    0.002522    0.128312    0.320676    0.217389    539.12    646.88    1.000
r(A<->T){all}   0.010102    0.000094    0.000005    0.029522    0.007173    761.61    928.49    1.000
r(C<->G){all}   0.097730    0.000470    0.057155    0.140022    0.095920    773.93    880.28    1.000
r(C<->T){all}   0.562495    0.003140    0.458799    0.674044    0.562662    660.73    706.22    1.000
r(G<->T){all}   0.028500    0.000275    0.000097    0.060267    0.026316    950.92   1043.47    1.000
pi(A){all}      0.225826    0.000218    0.196206    0.253302    0.225463   1225.58   1339.66    1.000
pi(C){all}      0.311483    0.000271    0.278221    0.341525    0.311604   1254.54   1261.33    1.000
pi(G){all}      0.275871    0.000265    0.245869    0.308100    0.275597   1196.40   1260.28    1.000
pi(T){all}      0.186820    0.000176    0.162500    0.214740    0.186298   1094.16   1181.14    1.000
alpha{1,2}      0.085992    0.000275    0.057500    0.119788    0.085828    877.60   1024.87    1.000
alpha{3}        2.224142    0.488473    1.061426    3.648855    2.111553   1329.23   1376.04    1.000
pinvar{all}     0.600376    0.001409    0.527285    0.669611    0.602321   1256.34   1372.71    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
Download 
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS/295/Lmpt-PE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =  12  ls = 245

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   6   5   5   3   3   4 | Ser TCT   1   1   1   1   1   1 | Tyr TAT   5   4   4   3   4   3 | Cys TGT   5   4   5   5   4   4
    TTC   7   8   8  10  10   9 |     TCC   2   2   2   2   2   2 |     TAC   2   3   3   4   3   4 |     TGC  18  19  18  18  19  19
Leu TTA   0   0   0   0   0   0 |     TCA   0   0   0   0   0   0 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   1   1   1   0   0   1 |     TCG   3   3   3   3   3   3 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   2   1   1   1   1   0 | Pro CCT   0   0   0   0   0   0 | His CAT   2   2   2   1   1   2 | Arg CGT   2   3   2   1   2   3
    CTC   2   2   2   2   2   3 |     CCC   5   5   5   5   5   4 |     CAC   5   5   5   6   6   5 |     CGC   6   5   6   9   8   7
    CTA   1   1   1   1   1   2 |     CCA   0   0   0   0   0   0 | Gln CAA   1   2   1   1   1   2 |     CGA   2   1   1   1   1   3
    CTG   6   7   7   8   8   6 |     CCG   3   3   3   3   3   4 |     CAG   5   4   5   5   5   4 |     CGG   3   5   5   2   3   2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   3   2   2   3   4   5 | Thr ACT   0   1   0   0   0   0 | Asn AAT   3   2   2   0   1   0 | Ser AGT   2   2   2   2   2   1
    ATC   9  11  11  10   9   8 |     ACC  12  10  11  12  12  11 |     AAC   6   7   7   9   8   9 |     AGC   4   4   4   4   4   5
    ATA   2   1   1   1   1   1 |     ACA   2   2   2   2   2   2 | Lys AAA   4   4   3   3   3   3 | Arg AGA   1   1   1   1   1   1
Met ATG   5   5   5   5   5   5 |     ACG   4   5   5   4   4   5 |     AAG  17  17  18  18  18  18 |     AGG   2   1   1   2   1   0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   2   1   1   1   0   1 | Ala GCT   2   2   2   2   2   1 | Asp GAT   8   7   7   6   7   6 | Gly GGT   2   3   3   4   3   3
    GTC   2   1   2   2   3   2 |     GCC  12  14  14  13  14  14 |     GAC   4   5   5   6   5   6 |     GGC  11  10  10   9  10   9
    GTA   1   1   1   1   1   0 |     GCA   1   1   1   1   1   1 | Glu GAA   0   0   0   0   0   1 |     GGA   2   2   2   2   2   3
    GTG   5   7   6   6   6   7 |     GCG   2   0   0   1   0   1 |     GAG  16  16  16  16  16  15 |     GGG   1   1   1   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   3   3   6   3   3   4 | Ser TCT   0   0   3   1   0   1 | Tyr TAT   2   2   3   2   2   2 | Cys TGT   4   5   4   4   5   5
    TTC  10  10   7  10  10   9 |     TCC   2   2   1   1   2   2 |     TAC   5   5   4   5   5   5 |     TGC  19  18  19  19  18  18
Leu TTA   0   0   0   0   0   0 |     TCA   0   0   0   0   1   0 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   1   0   1   0   0   0 |     TCG   4   4   2   4   3   3 |     TAG   0   0   0   0   0   0 | Trp TGG   3   3   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   0   1   2   1   2   1 | Pro CCT   0   0   0   0   0   0 | His CAT   3   2   2   1   3   2 | Arg CGT   3   4   2   4   4   4
    CTC   5   3   3   5   1   2 |     CCC   4   4   5   4   4   5 |     CAC   4   5   5   6   4   5 |     CGC   8   5   7   6   6   7
    CTA   0   1   2   1   3   2 |     CCA   0   0   0   1   0   0 | Gln CAA   1   1   2   2   3   3 |     CGA   0   1   1   0   3   2
    CTG   6   7   4   5   6   7 |     CCG   4   4   3   3   4   3 |     CAG   5   5   4   4   3   3 |     CGG   4   5   2   3   2   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   4   5   5   4   2   4 | Thr ACT   0   0   0   1   0   1 | Asn AAT   2   2   3   4   3   2 | Ser AGT   1   2   2   2   2   2
    ATC   9   8   8   9  11   9 |     ACC  11  11  11  10  12  10 |     AAC   7   7   6   5   6   7 |     AGC   5   4   4   4   4   4
    ATA   1   1   1   1   1   1 |     ACA   2   2   2   2   2   2 | Lys AAA   4   4   3   3   5   3 | Arg AGA   0   0   2   2   0   1
Met ATG   5   5   5   5   5   5 |     ACG   5   5   5   5   4   5 |     AAG  17  17  18  18  16  18 |     AGG   1   1   2   1   1   1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   0   1   1   0   1   2 | Ala GCT   2   1   2   3   1   2 | Asp GAT   7   8   6   9   6   8 | Gly GGT   2   4   2   5   3   3
    GTC   2   2   2   3   3   2 |     GCC  13  14  12  12  14  14 |     GAC   5   4   6   3   6   4 |     GGC   9   8  10   7   9  11
    GTA   0   0   0   1   0   0 |     GCA   1   1   1   2   2   1 | Glu GAA   0   0   0   0   0   0 |     GGA   3   3   3   3   3   2
    GTG   8   7   7   6   6   6 |     GCG   1   1   2   0   0   0 |     GAG  16  16  16  16  16  16 |     GGG   2   1   1   1   1   0
--------------------------------------------------------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: D_melanogaster_Lmpt-PE             
position  1:    T:0.21633    C:0.18367    A:0.31020    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.18367    C:0.43673    A:0.06939    G:0.31020
Average         T:0.20680    C:0.27347    A:0.23265    G:0.28707

#2: D_sechellia_Lmpt-PE             
position  1:    T:0.21633    C:0.18776    A:0.30612    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.16327    C:0.45306    A:0.06531    G:0.31837
Average         T:0.20000    C:0.28027    A:0.22993    G:0.28980

#3: D_simulans_Lmpt-PE             
position  1:    T:0.21633    C:0.18776    A:0.30612    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.15918    C:0.46122    A:0.05714    G:0.32245
Average         T:0.19864    C:0.28299    A:0.22721    G:0.29116

#4: D_yakuba_Lmpt-PE             
position  1:    T:0.21224    C:0.18776    A:0.31020    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.13469    C:0.49388    A:0.05714    G:0.31429
Average         T:0.18912    C:0.29388    A:0.22857    G:0.28844

#5: D_erecta_Lmpt-PE             
position  1:    T:0.21224    C:0.19184    A:0.30612    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.14286    C:0.48980    A:0.05714    G:0.31020
Average         T:0.19184    C:0.29388    A:0.22721    G:0.28707

#6: D_takahashii_Lmpt-PE             
position  1:    T:0.21633    C:0.19184    A:0.30204    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.13878    C:0.47755    A:0.07755    G:0.30612
Average         T:0.19184    C:0.28980    A:0.23265    G:0.28571

#7: D_biarmipes_Lmpt-PE             
position  1:    T:0.21633    C:0.19184    A:0.30204    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.13469    C:0.48163    A:0.04898    G:0.33469
Average         T:0.19048    C:0.29116    A:0.22313    G:0.29524

#8: D_suzukii_Lmpt-PE             
position  1:    T:0.21224    C:0.19592    A:0.30204    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.16327    C:0.44898    A:0.05714    G:0.33061
Average         T:0.19864    C:0.28163    A:0.22585    G:0.29388

#9: D_eugracilis_Lmpt-PE             
position  1:    T:0.21633    C:0.17959    A:0.31429    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.17551    C:0.44898    A:0.06939    G:0.30612
Average         T:0.20408    C:0.27619    A:0.23401    G:0.28571

#10: D_ficusphila_Lmpt-PE            
position  1:    T:0.21224    C:0.18776    A:0.31020    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.17959    C:0.44490    A:0.07347    G:0.30204
Average         T:0.20408    C:0.27755    A:0.23401    G:0.28435

#11: D_rhopaloa_Lmpt-PE            
position  1:    T:0.21224    C:0.19592    A:0.30204    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.15102    C:0.46939    A:0.09388    G:0.28571
Average         T:0.19456    C:0.28844    A:0.23810    G:0.27891

#12: D_elegans_Lmpt-PE            
position  1:    T:0.21224    C:0.19184    A:0.30612    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.17551    C:0.46531    A:0.06939    G:0.28980
Average         T:0.20272    C:0.28571    A:0.23129    G:0.28027

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      48 | Ser S TCT      11 | Tyr Y TAT      36 | Cys C TGT      54
      TTC     108 |       TCC      22 |       TAC      48 |       TGC     222
Leu L TTA       0 |       TCA       1 | *** * TAA       0 | *** * TGA       0
      TTG       6 |       TCG      38 |       TAG       0 | Trp W TGG      36
------------------------------------------------------------------------------
Leu L CTT      13 | Pro P CCT       0 | His H CAT      23 | Arg R CGT      34
      CTC      32 |       CCC      55 |       CAC      61 |       CGC      80
      CTA      16 |       CCA       1 | Gln Q CAA      20 |       CGA      16
      CTG      77 |       CCG      40 |       CAG      52 |       CGG      37
------------------------------------------------------------------------------
Ile I ATT      43 | Thr T ACT       3 | Asn N AAT      24 | Ser S AGT      22
      ATC     112 |       ACC     133 |       AAC      84 |       AGC      50
      ATA      13 |       ACA      24 | Lys K AAA      42 | Arg R AGA      11
Met M ATG      60 |       ACG      56 |       AAG     210 |       AGG      14
------------------------------------------------------------------------------
Val V GTT      11 | Ala A GCT      22 | Asp D GAT      85 | Gly G GGT      37
      GTC      26 |       GCC     160 |       GAC      59 |       GGC     113
      GTA       6 |       GCA      14 | Glu E GAA       1 |       GGA      30
      GTG      77 |       GCG       8 |       GAG     191 |       GGG      12
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.21429    C:0.18946    A:0.30646    G:0.28980
position  2:    T:0.22041    C:0.20000    A:0.31837    G:0.26122
position  3:    T:0.15850    C:0.46429    A:0.06633    G:0.31088
Average         T:0.19773    C:0.28458    A:0.23039    G:0.28730


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

D_melanogaster_Lmpt-PE                  
D_sechellia_Lmpt-PE                  -1.0000 (0.0000 0.1800)
D_simulans_Lmpt-PE                  -1.0000 (0.0000 0.1493)-1.0000 (0.0000 0.0378)
D_yakuba_Lmpt-PE                   0.0076 (0.0017 0.2291)-1.0000 (0.0000 0.1644)-1.0000 (0.0000 0.1344)
D_erecta_Lmpt-PE                   0.0093 (0.0017 0.1879)-1.0000 (0.0000 0.1195)-1.0000 (0.0000 0.1053) 0.0191 (0.0017 0.0915)
D_takahashii_Lmpt-PE                   0.0061 (0.0017 0.2891)-1.0000 (0.0000 0.2702)-1.0000 (0.0000 0.2529) 0.0080 (0.0017 0.2199)-1.0000 (0.0000 0.1871)
D_biarmipes_Lmpt-PE                   0.0044 (0.0017 0.3979)-1.0000 (0.0000 0.2985)-1.0000 (0.0000 0.2985) 0.0062 (0.0017 0.2812)-1.0000 (0.0000 0.2370)-1.0000 (0.0000 0.1644)
D_suzukii_Lmpt-PE                   0.0048 (0.0017 0.3645)-1.0000 (0.0000 0.3057)-1.0000 (0.0000 0.2698)-1.0000 (0.0000 0.2531)-1.0000 (0.0000 0.2611)-1.0000 (0.0000 0.1711)-1.0000 (0.0000 0.1416)
D_eugracilis_Lmpt-PE                   0.0090 (0.0035 0.3895)-1.0000 (0.0000 0.3378)-1.0000 (0.0000 0.3187) 0.0076 (0.0017 0.2303) 0.0062 (0.0017 0.2819) 0.0137 (0.0035 0.2551) 0.0049 (0.0017 0.3590)-1.0000 (0.0000 0.2721)
D_ficusphila_Lmpt-PE                  0.0034 (0.0017 0.5123)-1.0000 (0.0000 0.3869)-1.0000 (0.0000 0.3565) 0.0103 (0.0035 0.3379)-1.0000 (0.0000 0.3274)-1.0000 (0.0000 0.3463)-1.0000 (0.0000 0.3191)-1.0000 (0.0000 0.2984) 0.0040 (0.0017 0.4337)
D_rhopaloa_Lmpt-PE                  0.0046 (0.0018 0.3844)-1.0000 (0.0000 0.3147)-1.0000 (0.0000 0.2963) 0.0061 (0.0018 0.2881)-1.0000 (0.0000 0.2964)-1.0000 (0.0000 0.2351)-1.0000 (0.0000 0.2706)-1.0000 (0.0000 0.2020) 0.0062 (0.0017 0.2808)-1.0000 (0.0000 0.4169)
D_elegans_Lmpt-PE                  0.0052 (0.0017 0.3365)-1.0000 (0.0000 0.2621)-1.0000 (0.0000 0.2448) 0.0082 (0.0017 0.2121)-1.0000 (0.0000 0.2035)-1.0000 (0.0000 0.2278) 0.0060 (0.0017 0.2898)-1.0000 (0.0000 0.2192) 0.0064 (0.0017 0.2732)-1.0000 (0.0000 0.3471)-1.0000 (0.0000 0.2028)


Model 0: one-ratio


TREE #  1:  (1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
lnL(ntime: 19  np: 21):  -1818.988065      +0.000000
  13..1    13..14   14..15   15..4    15..16   16..17   17..6    17..18   18..19   19..7    19..8    18..11   16..9    16..10   16..12   14..5    13..20   20..2    20..3  
 0.080802 0.031106 0.009671 0.044135 0.058711 0.038800 0.054159 0.022216 0.023681 0.076044 0.025143 0.089301 0.123504 0.173007 0.070237 0.021285 0.016046 0.021701 0.004299 2.165680 0.000100

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.98385

(1: 0.080802, ((4: 0.044135, ((6: 0.054159, ((7: 0.076044, 8: 0.025143): 0.023681, 11: 0.089301): 0.022216): 0.038800, 9: 0.123504, 10: 0.173007, 12: 0.070237): 0.058711): 0.009671, 5: 0.021285): 0.031106, (2: 0.021701, 3: 0.004299): 0.016046);

(D_melanogaster_Lmpt-PE: 0.080802, ((D_yakuba_Lmpt-PE: 0.044135, ((D_takahashii_Lmpt-PE: 0.054159, ((D_biarmipes_Lmpt-PE: 0.076044, D_suzukii_Lmpt-PE: 0.025143): 0.023681, D_rhopaloa_Lmpt-PE: 0.089301): 0.022216): 0.038800, D_eugracilis_Lmpt-PE: 0.123504, D_ficusphila_Lmpt-PE: 0.173007, D_elegans_Lmpt-PE: 0.070237): 0.058711): 0.009671, D_erecta_Lmpt-PE: 0.021285): 0.031106, (D_sechellia_Lmpt-PE: 0.021701, D_simulans_Lmpt-PE: 0.004299): 0.016046);

Detailed output identifying parameters

kappa (ts/tv) =  2.16568

omega (dN/dS) =  0.00010

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1      0.081   609.2   125.8  0.0001  0.0000  0.1573   0.0  19.8
  13..14     0.031   609.2   125.8  0.0001  0.0000  0.0606   0.0   7.6
  14..15     0.010   609.2   125.8  0.0001  0.0000  0.0188   0.0   2.4
  15..4      0.044   609.2   125.8  0.0001  0.0000  0.0859   0.0  10.8
  15..16     0.059   609.2   125.8  0.0001  0.0000  0.1143   0.0  14.4
  16..17     0.039   609.2   125.8  0.0001  0.0000  0.0755   0.0   9.5
  17..6      0.054   609.2   125.8  0.0001  0.0000  0.1054   0.0  13.3
  17..18     0.022   609.2   125.8  0.0001  0.0000  0.0432   0.0   5.4
  18..19     0.024   609.2   125.8  0.0001  0.0000  0.0461   0.0   5.8
  19..7      0.076   609.2   125.8  0.0001  0.0000  0.1480   0.0  18.6
  19..8      0.025   609.2   125.8  0.0001  0.0000  0.0489   0.0   6.2
  18..11     0.089   609.2   125.8  0.0001  0.0000  0.1738   0.0  21.9
  16..9      0.124   609.2   125.8  0.0001  0.0000  0.2404   0.0  30.2
  16..10     0.173   609.2   125.8  0.0001  0.0000  0.3368   0.0  42.4
  16..12     0.070   609.2   125.8  0.0001  0.0000  0.1367   0.0  17.2
  14..5      0.021   609.2   125.8  0.0001  0.0000  0.0414   0.0   5.2
  13..20     0.016   609.2   125.8  0.0001  0.0000  0.0312   0.0   3.9
  20..2      0.022   609.2   125.8  0.0001  0.0000  0.0422   0.0   5.3
  20..3      0.004   609.2   125.8  0.0001  0.0000  0.0084   0.0   1.1

tree length for dN:       0.0002
tree length for dS:       1.9153


Time used:  0:14


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
lnL(ntime: 19  np: 22):  -1818.876561      +0.000000
  13..1    13..14   14..15   15..4    15..16   16..17   17..6    17..18   18..19   19..7    19..8    18..11   16..9    16..10   16..12   14..5    13..20   20..2    20..3  
 0.080815 0.031110 0.009672 0.044142 0.058722 0.038803 0.054168 0.022216 0.023685 0.076058 0.025144 0.089315 0.123526 0.173051 0.070246 0.021287 0.016047 0.021703 0.004299 2.164438 0.999990 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.98401

(1: 0.080815, ((4: 0.044142, ((6: 0.054168, ((7: 0.076058, 8: 0.025144): 0.023685, 11: 0.089315): 0.022216): 0.038803, 9: 0.123526, 10: 0.173051, 12: 0.070246): 0.058722): 0.009672, 5: 0.021287): 0.031110, (2: 0.021703, 3: 0.004299): 0.016047);

(D_melanogaster_Lmpt-PE: 0.080815, ((D_yakuba_Lmpt-PE: 0.044142, ((D_takahashii_Lmpt-PE: 0.054168, ((D_biarmipes_Lmpt-PE: 0.076058, D_suzukii_Lmpt-PE: 0.025144): 0.023685, D_rhopaloa_Lmpt-PE: 0.089315): 0.022216): 0.038803, D_eugracilis_Lmpt-PE: 0.123526, D_ficusphila_Lmpt-PE: 0.173051, D_elegans_Lmpt-PE: 0.070246): 0.058722): 0.009672, D_erecta_Lmpt-PE: 0.021287): 0.031110, (D_sechellia_Lmpt-PE: 0.021703, D_simulans_Lmpt-PE: 0.004299): 0.016047);

Detailed output identifying parameters

kappa (ts/tv) =  2.16444


dN/dS (w) for site classes (K=2)

p:   0.99999  0.00001
w:   0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.081    609.2    125.8   0.0000   0.0000   0.1574    0.0   19.8
  13..14      0.031    609.2    125.8   0.0000   0.0000   0.0606    0.0    7.6
  14..15      0.010    609.2    125.8   0.0000   0.0000   0.0188    0.0    2.4
  15..4       0.044    609.2    125.8   0.0000   0.0000   0.0860    0.0   10.8
  15..16      0.059    609.2    125.8   0.0000   0.0000   0.1144    0.0   14.4
  16..17      0.039    609.2    125.8   0.0000   0.0000   0.0756    0.0    9.5
  17..6       0.054    609.2    125.8   0.0000   0.0000   0.1055    0.0   13.3
  17..18      0.022    609.2    125.8   0.0000   0.0000   0.0433    0.0    5.4
  18..19      0.024    609.2    125.8   0.0000   0.0000   0.0461    0.0    5.8
  19..7       0.076    609.2    125.8   0.0000   0.0000   0.1481    0.0   18.6
  19..8       0.025    609.2    125.8   0.0000   0.0000   0.0490    0.0    6.2
  18..11      0.089    609.2    125.8   0.0000   0.0000   0.1740    0.0   21.9
  16..9       0.124    609.2    125.8   0.0000   0.0000   0.2406    0.0   30.3
  16..10      0.173    609.2    125.8   0.0000   0.0000   0.3371    0.0   42.4
  16..12      0.070    609.2    125.8   0.0000   0.0000   0.1368    0.0   17.2
  14..5       0.021    609.2    125.8   0.0000   0.0000   0.0415    0.0    5.2
  13..20      0.016    609.2    125.8   0.0000   0.0000   0.0313    0.0    3.9
  20..2       0.022    609.2    125.8   0.0000   0.0000   0.0423    0.0    5.3
  20..3       0.004    609.2    125.8   0.0000   0.0000   0.0084    0.0    1.1


Time used:  0:36


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
lnL(ntime: 19  np: 24):  -1818.874206      +0.000000
  13..1    13..14   14..15   15..4    15..16   16..17   17..6    17..18   18..19   19..7    19..8    18..11   16..9    16..10   16..12   14..5    13..20   20..2    20..3  
 0.080811 0.031109 0.009671 0.044140 0.058720 0.038801 0.054166 0.022215 0.023683 0.076054 0.025143 0.089311 0.123521 0.173042 0.070243 0.021286 0.016046 0.021702 0.004299 2.164433 1.000000 0.000000 0.000001 250.748398

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.98396

(1: 0.080811, ((4: 0.044140, ((6: 0.054166, ((7: 0.076054, 8: 0.025143): 0.023683, 11: 0.089311): 0.022215): 0.038801, 9: 0.123521, 10: 0.173042, 12: 0.070243): 0.058720): 0.009671, 5: 0.021286): 0.031109, (2: 0.021702, 3: 0.004299): 0.016046);

(D_melanogaster_Lmpt-PE: 0.080811, ((D_yakuba_Lmpt-PE: 0.044140, ((D_takahashii_Lmpt-PE: 0.054166, ((D_biarmipes_Lmpt-PE: 0.076054, D_suzukii_Lmpt-PE: 0.025143): 0.023683, D_rhopaloa_Lmpt-PE: 0.089311): 0.022215): 0.038801, D_eugracilis_Lmpt-PE: 0.123521, D_ficusphila_Lmpt-PE: 0.173042, D_elegans_Lmpt-PE: 0.070243): 0.058720): 0.009671, D_erecta_Lmpt-PE: 0.021286): 0.031109, (D_sechellia_Lmpt-PE: 0.021702, D_simulans_Lmpt-PE: 0.004299): 0.016046);

Detailed output identifying parameters

kappa (ts/tv) =  2.16443


dN/dS (w) for site classes (K=3)

p:   1.00000  0.00000  0.00000
w:   0.00000  1.00000 250.74840
(note that p[2] is zero)


dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.081    609.2    125.8   0.0000   0.0000   0.1574    0.0   19.8
  13..14      0.031    609.2    125.8   0.0000   0.0000   0.0606    0.0    7.6
  14..15      0.010    609.2    125.8   0.0000   0.0000   0.0188    0.0    2.4
  15..4       0.044    609.2    125.8   0.0000   0.0000   0.0860    0.0   10.8
  15..16      0.059    609.2    125.8   0.0000   0.0000   0.1144    0.0   14.4
  16..17      0.039    609.2    125.8   0.0000   0.0000   0.0756    0.0    9.5
  17..6       0.054    609.2    125.8   0.0000   0.0000   0.1055    0.0   13.3
  17..18      0.022    609.2    125.8   0.0000   0.0000   0.0433    0.0    5.4
  18..19      0.024    609.2    125.8   0.0000   0.0000   0.0461    0.0    5.8
  19..7       0.076    609.2    125.8   0.0000   0.0000   0.1481    0.0   18.6
  19..8       0.025    609.2    125.8   0.0000   0.0000   0.0490    0.0    6.2
  18..11      0.089    609.2    125.8   0.0000   0.0000   0.1740    0.0   21.9
  16..9       0.124    609.2    125.8   0.0000   0.0000   0.2406    0.0   30.3
  16..10      0.173    609.2    125.8   0.0000   0.0000   0.3371    0.0   42.4
  16..12      0.070    609.2    125.8   0.0000   0.0000   0.1368    0.0   17.2
  14..5       0.021    609.2    125.8   0.0000   0.0000   0.0415    0.0    5.2
  13..20      0.016    609.2    125.8   0.0000   0.0000   0.0313    0.0    3.9
  20..2       0.022    609.2    125.8   0.0000   0.0000   0.0423    0.0    5.3
  20..3       0.004    609.2    125.8   0.0000   0.0000   0.0084    0.0    1.1


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Lmpt-PE)

            Pr(w>1)     post mean +- SE for w




The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.113  0.102  0.099  0.098  0.098  0.098  0.098  0.098  0.098  0.098

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000

sum of density on p0-p1 =   1.000000

Time used:  3:14


Model 3: discrete (3 categories)


TREE #  1:  (1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
lnL(ntime: 19  np: 25):  -1818.874206      +0.000000
  13..1    13..14   14..15   15..4    15..16   16..17   17..6    17..18   18..19   19..7    19..8    18..11   16..9    16..10   16..12   14..5    13..20   20..2    20..3  
 0.080811 0.031109 0.009671 0.044140 0.058720 0.038802 0.054166 0.022215 0.023683 0.076054 0.025143 0.089311 0.123521 0.173042 0.070243 0.021287 0.016046 0.021702 0.004299 2.164435 0.002339 0.925143 0.000001 0.000001 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.98396

(1: 0.080811, ((4: 0.044140, ((6: 0.054166, ((7: 0.076054, 8: 0.025143): 0.023683, 11: 0.089311): 0.022215): 0.038802, 9: 0.123521, 10: 0.173042, 12: 0.070243): 0.058720): 0.009671, 5: 0.021287): 0.031109, (2: 0.021702, 3: 0.004299): 0.016046);

(D_melanogaster_Lmpt-PE: 0.080811, ((D_yakuba_Lmpt-PE: 0.044140, ((D_takahashii_Lmpt-PE: 0.054166, ((D_biarmipes_Lmpt-PE: 0.076054, D_suzukii_Lmpt-PE: 0.025143): 0.023683, D_rhopaloa_Lmpt-PE: 0.089311): 0.022215): 0.038802, D_eugracilis_Lmpt-PE: 0.123521, D_ficusphila_Lmpt-PE: 0.173042, D_elegans_Lmpt-PE: 0.070243): 0.058720): 0.009671, D_erecta_Lmpt-PE: 0.021287): 0.031109, (D_sechellia_Lmpt-PE: 0.021702, D_simulans_Lmpt-PE: 0.004299): 0.016046);

Detailed output identifying parameters

kappa (ts/tv) =  2.16444


dN/dS (w) for site classes (K=3)

p:   0.00234  0.92514  0.07252
w:   0.00000  0.00000  0.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.081    609.2    125.8   0.0000   0.0000   0.1574    0.0   19.8
  13..14      0.031    609.2    125.8   0.0000   0.0000   0.0606    0.0    7.6
  14..15      0.010    609.2    125.8   0.0000   0.0000   0.0188    0.0    2.4
  15..4       0.044    609.2    125.8   0.0000   0.0000   0.0860    0.0   10.8
  15..16      0.059    609.2    125.8   0.0000   0.0000   0.1144    0.0   14.4
  16..17      0.039    609.2    125.8   0.0000   0.0000   0.0756    0.0    9.5
  17..6       0.054    609.2    125.8   0.0000   0.0000   0.1055    0.0   13.3
  17..18      0.022    609.2    125.8   0.0000   0.0000   0.0433    0.0    5.4
  18..19      0.024    609.2    125.8   0.0000   0.0000   0.0461    0.0    5.8
  19..7       0.076    609.2    125.8   0.0000   0.0000   0.1481    0.0   18.6
  19..8       0.025    609.2    125.8   0.0000   0.0000   0.0490    0.0    6.2
  18..11      0.089    609.2    125.8   0.0000   0.0000   0.1740    0.0   21.9
  16..9       0.124    609.2    125.8   0.0000   0.0000   0.2406    0.0   30.3
  16..10      0.173    609.2    125.8   0.0000   0.0000   0.3371    0.0   42.4
  16..12      0.070    609.2    125.8   0.0000   0.0000   0.1368    0.0   17.2
  14..5       0.021    609.2    125.8   0.0000   0.0000   0.0415    0.0    5.2
  13..20      0.016    609.2    125.8   0.0000   0.0000   0.0313    0.0    3.9
  20..2       0.022    609.2    125.8   0.0000   0.0000   0.0423    0.0    5.3
  20..3       0.004    609.2    125.8   0.0000   0.0000   0.0084    0.0    1.1


Naive Empirical Bayes (NEB) analysis
Time used:  3:39


Model 7: beta (10 categories)


TREE #  1:  (1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
lnL(ntime: 19  np: 22):  -1818.873078      +0.000000
  13..1    13..14   14..15   15..4    15..16   16..17   17..6    17..18   18..19   19..7    19..8    18..11   16..9    16..10   16..12   14..5    13..20   20..2    20..3  
 0.080811 0.031109 0.009671 0.044140 0.058720 0.038801 0.054166 0.022215 0.023683 0.076054 0.025143 0.089311 0.123521 0.173043 0.070243 0.021287 0.016046 0.021702 0.004299 2.164422 0.005000 99.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.98396

(1: 0.080811, ((4: 0.044140, ((6: 0.054166, ((7: 0.076054, 8: 0.025143): 0.023683, 11: 0.089311): 0.022215): 0.038801, 9: 0.123521, 10: 0.173043, 12: 0.070243): 0.058720): 0.009671, 5: 0.021287): 0.031109, (2: 0.021702, 3: 0.004299): 0.016046);

(D_melanogaster_Lmpt-PE: 0.080811, ((D_yakuba_Lmpt-PE: 0.044140, ((D_takahashii_Lmpt-PE: 0.054166, ((D_biarmipes_Lmpt-PE: 0.076054, D_suzukii_Lmpt-PE: 0.025143): 0.023683, D_rhopaloa_Lmpt-PE: 0.089311): 0.022215): 0.038801, D_eugracilis_Lmpt-PE: 0.123521, D_ficusphila_Lmpt-PE: 0.173043, D_elegans_Lmpt-PE: 0.070243): 0.058720): 0.009671, D_erecta_Lmpt-PE: 0.021287): 0.031109, (D_sechellia_Lmpt-PE: 0.021702, D_simulans_Lmpt-PE: 0.004299): 0.016046);

Detailed output identifying parameters

kappa (ts/tv) =  2.16442

Parameters in M7 (beta):
 p =   0.00500  q =  99.00000


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.081    609.2    125.8   0.0000   0.0000   0.1574    0.0   19.8
  13..14      0.031    609.2    125.8   0.0000   0.0000   0.0606    0.0    7.6
  14..15      0.010    609.2    125.8   0.0000   0.0000   0.0188    0.0    2.4
  15..4       0.044    609.2    125.8   0.0000   0.0000   0.0860    0.0   10.8
  15..16      0.059    609.2    125.8   0.0000   0.0000   0.1144    0.0   14.4
  16..17      0.039    609.2    125.8   0.0000   0.0000   0.0756    0.0    9.5
  17..6       0.054    609.2    125.8   0.0000   0.0000   0.1055    0.0   13.3
  17..18      0.022    609.2    125.8   0.0000   0.0000   0.0433    0.0    5.4
  18..19      0.024    609.2    125.8   0.0000   0.0000   0.0461    0.0    5.8
  19..7       0.076    609.2    125.8   0.0000   0.0000   0.1481    0.0   18.6
  19..8       0.025    609.2    125.8   0.0000   0.0000   0.0490    0.0    6.2
  18..11      0.089    609.2    125.8   0.0000   0.0000   0.1740    0.0   21.9
  16..9       0.124    609.2    125.8   0.0000   0.0000   0.2406    0.0   30.3
  16..10      0.173    609.2    125.8   0.0000   0.0000   0.3371    0.0   42.4
  16..12      0.070    609.2    125.8   0.0000   0.0000   0.1368    0.0   17.2
  14..5       0.021    609.2    125.8   0.0000   0.0000   0.0415    0.0    5.2
  13..20      0.016    609.2    125.8   0.0000   0.0000   0.0313    0.0    3.9
  20..2       0.022    609.2    125.8   0.0000   0.0000   0.0423    0.0    5.3
  20..3       0.004    609.2    125.8   0.0000   0.0000   0.0084    0.0    1.1


Time used:  6:17


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, ((4, ((6, ((7, 8), 11)), 9, 10, 12)), 5), (2, 3));   MP score: 205
lnL(ntime: 19  np: 24):  -1818.875434      +0.000000
  13..1    13..14   14..15   15..4    15..16   16..17   17..6    17..18   18..19   19..7    19..8    18..11   16..9    16..10   16..12   14..5    13..20   20..2    20..3  
 0.080815 0.031110 0.009672 0.044142 0.058723 0.038803 0.054168 0.022216 0.023685 0.076058 0.025144 0.089316 0.123527 0.173051 0.070246 0.021288 0.016047 0.021703 0.004299 2.164426 0.999990 0.005000 99.000000 1.000000

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.98401

(1: 0.080815, ((4: 0.044142, ((6: 0.054168, ((7: 0.076058, 8: 0.025144): 0.023685, 11: 0.089316): 0.022216): 0.038803, 9: 0.123527, 10: 0.173051, 12: 0.070246): 0.058723): 0.009672, 5: 0.021288): 0.031110, (2: 0.021703, 3: 0.004299): 0.016047);

(D_melanogaster_Lmpt-PE: 0.080815, ((D_yakuba_Lmpt-PE: 0.044142, ((D_takahashii_Lmpt-PE: 0.054168, ((D_biarmipes_Lmpt-PE: 0.076058, D_suzukii_Lmpt-PE: 0.025144): 0.023685, D_rhopaloa_Lmpt-PE: 0.089316): 0.022216): 0.038803, D_eugracilis_Lmpt-PE: 0.123527, D_ficusphila_Lmpt-PE: 0.173051, D_elegans_Lmpt-PE: 0.070246): 0.058723): 0.009672, D_erecta_Lmpt-PE: 0.021288): 0.031110, (D_sechellia_Lmpt-PE: 0.021703, D_simulans_Lmpt-PE: 0.004299): 0.016047);

Detailed output identifying parameters

kappa (ts/tv) =  2.16443

Parameters in M8 (beta&w>1):
  p0 =   0.99999  p =   0.00500 q =  99.00000
 (p1 =   0.00001) w =   1.00000


dN/dS (w) for site classes (K=11)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.00001
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

  13..1       0.081    609.2    125.8   0.0000   0.0000   0.1574    0.0   19.8
  13..14      0.031    609.2    125.8   0.0000   0.0000   0.0606    0.0    7.6
  14..15      0.010    609.2    125.8   0.0000   0.0000   0.0188    0.0    2.4
  15..4       0.044    609.2    125.8   0.0000   0.0000   0.0860    0.0   10.8
  15..16      0.059    609.2    125.8   0.0000   0.0000   0.1144    0.0   14.4
  16..17      0.039    609.2    125.8   0.0000   0.0000   0.0756    0.0    9.5
  17..6       0.054    609.2    125.8   0.0000   0.0000   0.1055    0.0   13.3
  17..18      0.022    609.2    125.8   0.0000   0.0000   0.0433    0.0    5.4
  18..19      0.024    609.2    125.8   0.0000   0.0000   0.0461    0.0    5.8
  19..7       0.076    609.2    125.8   0.0000   0.0000   0.1481    0.0   18.6
  19..8       0.025    609.2    125.8   0.0000   0.0000   0.0490    0.0    6.2
  18..11      0.089    609.2    125.8   0.0000   0.0000   0.1740    0.0   21.9
  16..9       0.124    609.2    125.8   0.0000   0.0000   0.2406    0.0   30.3
  16..10      0.173    609.2    125.8   0.0000   0.0000   0.3371    0.0   42.4
  16..12      0.070    609.2    125.8   0.0000   0.0000   0.1368    0.0   17.2
  14..5       0.021    609.2    125.8   0.0000   0.0000   0.0415    0.0    5.2
  13..20      0.016    609.2    125.8   0.0000   0.0000   0.0313    0.0    3.9
  20..2       0.022    609.2    125.8   0.0000   0.0000   0.0423    0.0    5.3
  20..3       0.004    609.2    125.8   0.0000   0.0000   0.0084    0.0    1.1


Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Lmpt-PE)

            Pr(w>1)     post mean +- SE for w




The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  1.000
p :   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.006  0.096  0.897
ws:   0.121  0.102  0.099  0.098  0.097  0.097  0.097  0.097  0.097  0.097

Time used: 10:25
Download 
Model 1: NearlyNeutral	-1818.876561
Model 2: PositiveSelection	-1818.874206
Model 0: one-ratio	-1818.988065
Model 3: discrete	-1818.874206
Model 7: beta	-1818.873078
Model 8: beta&w>1	-1818.875434


Model 0 vs 1	0.22300799999993615

Model 2 vs 1	0.004710000000159198

Model 8 vs 7	0.004711999999926775

i3S

Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal

If you use B+, please cite us:

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7

N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3

IBMC INEB IPATIMUP UPORTO