--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Sat Nov 19 04:58:33 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/28/bves-PC/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3589.00 -3604.33 2 -3589.37 -3603.03 -------------------------------------- TOTAL -3589.17 -3603.88 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.675052 0.004334 0.552135 0.802740 0.671698 1354.52 1359.99 1.000 r(A<->C){all} 0.112940 0.000464 0.072316 0.154826 0.111657 995.06 1073.48 1.001 r(A<->G){all} 0.179747 0.000717 0.129183 0.233310 0.178346 971.34 1078.29 1.001 r(A<->T){all} 0.097148 0.000641 0.050112 0.146419 0.095696 983.42 1041.88 1.000 r(C<->G){all} 0.070068 0.000180 0.046538 0.099339 0.069039 1060.33 1061.85 1.000 r(C<->T){all} 0.464476 0.001644 0.381273 0.539274 0.463907 835.55 984.52 1.000 r(G<->T){all} 0.075621 0.000287 0.041718 0.107464 0.074870 1165.38 1265.16 1.000 pi(A){all} 0.191600 0.000118 0.171233 0.213889 0.191556 923.43 1082.53 1.001 pi(C){all} 0.289599 0.000148 0.266747 0.313910 0.289428 1302.74 1344.46 1.001 pi(G){all} 0.315142 0.000161 0.290962 0.341013 0.314891 1227.06 1230.30 1.000 pi(T){all} 0.203659 0.000112 0.182682 0.223672 0.203115 1140.31 1226.56 1.003 alpha{1,2} 0.157315 0.000527 0.116654 0.206415 0.154884 1423.01 1462.00 1.000 alpha{3} 2.649032 0.652979 1.338836 4.389093 2.553274 1371.29 1394.43 1.000 pinvar{all} 0.505950 0.001624 0.424004 0.580642 0.507757 1314.06 1394.14 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -3150.585329 Model 2: PositiveSelection -3148.321012 Model 0: one-ratio -3175.059384 Model 3: discrete -3145.482796 Model 7: beta -3152.189208 Model 8: beta&w>1 -3145.542888 Model 0 vs 1 48.94811000000027 Model 2 vs 1 4.528634000000238 Model 8 vs 7 13.292639999999665 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 39 G 0.950 5.382 40 S 0.999** 5.647 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 38 T 0.515 1.957 +- 1.820 39 G 0.965* 4.356 +- 2.453 40 S 0.995** 4.454 +- 2.409
>C1 MPSTAGSAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAPGSSGSGA DASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCLGPHH LYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDV ILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFK KVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVF PHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQ TVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILKK SVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAVo oooooooo >C2 MPSTAGSAAGVWMGALINSAGSSASSVMGIGMGRAAATGAGAPGSSGSGA EASAGTLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSIEQSLGPHHL YFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAKDVI LWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKK VLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVFP HQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQT VFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILKKS VDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAVoo oooooooo >C3 MPSTAGSAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAPGSSGSGA EASAGTLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSIEQSLGPHHL YFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAKDVI LWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKK VLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVFP HQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQT VFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILKKS VDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAVoo oooooooo >C4 MPSTAGSAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAGAPGSSGS GAEASAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCLGPH HLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGMHGYLVARAPD VMLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQF KKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIV FPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFL QTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILK KSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAV oooooooo >C5 MPSTAGSSAAGVGMGALINSAGSSASSVMGIGLGGAAAAAGASGGSPGSG GGDASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCLGW QQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGMHGYLVA CTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVT RHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRA LHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMA EPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPM LILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDH ETAVoooo >C6 MPSTAGSAAGVGMGALINSAGSSASSVMGIGLGGAAAPGAPGSASGSGAE ASAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCLGWQQPH HLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGMHGYLVACTPD VVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQF KKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIV FPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFL QTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILK KSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAV oooooooo >C7 MPSTAGSAAGVGMGALINNAGSSASSVMGIGLGRAAATGAGAGAPGAASA GAEASAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCLGPH HLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVACAPD VVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQF KKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIV FPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFL QTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILK KSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAV oooooooo >C8 MPSTAGSAAGVGMGALINSAGSSASGAMGIGLGGAAAAGAAGAAAGPGAG AAVSGGAEASAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQ CLGWQQPHPLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGMHG YLVACTPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQP LHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQ HQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKL SIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAE DKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRID ETDHETAV >C9 MPSTAGSAAGVGMGALINSAGSSASSVMGIGLGGAAVSGSGAEASAGTLI AQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCFGWQQPHHLYFQLG WAFLFLAFLAPHGPYGSLWMRATLLIGCLMMGMHGYLVACTPDLVLWSSM GLFVNFVYLVVVLCRLRPVIFEQEIEAVYLALFQPLHVTRHQFKKVLNCM KVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVFPHQFLD SPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQTVFDHI LGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILKKSVDVGH GLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAVooooooo oooooooo >C10 MPSTTGSAAGVGMGALINSAGSSASSVMGIGLGGAAAAGTGAGAGAEASA GTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCLGWQQPHHLY FQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGMHGYLVACTPDVVL WSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKKV LNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVFPH QFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQTV FDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAEDAEDKPMLILKKSV DVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGRIDETDHETAVooo oooooooo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=425 C1 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- C2 MPSTAG-SAAGVWMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- C3 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- C4 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAGAP---- C5 MPSTAGSSAAGVGMGALINSAGSSASSVMGIGLGGAAAAAGASGGS---- C6 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAPGAPG------- C7 MPSTAG-SAAGVGMGALINNAGSSASSVMGIGLGRAAATGAGAGAP---- C8 MPSTAG-SAAGVGMGALINSAGSSASGAMGIGLGGAAAAGAAGAAAGPGA C9 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAVS----------- C10 MPSTTG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAAG---------- ****:* ***** ******.******..****:* **.. C1 -GSSGSGADASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI C2 -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI C3 -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI C4 -GSSGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI C5 -PGSGGGDASAAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI C6 -SASGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI C7 -GAASAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI C8 GAAVSGGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI C9 ----GSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI C10 -TGAGAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI ..* ::*. *****************:.***************** C1 EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM C2 EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM C3 EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM C4 EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM C5 EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM C6 EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM C7 EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM C8 EQCLGWQQPHPLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM C9 EQCFGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRATLLIGCLMMGM C10 EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM **.:* ** **********************:***** ********** C1 HGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF C2 HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF C3 HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF C4 HGYLVARAPDVMLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF C5 HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF C6 HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF C7 HGYLVACAPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF C8 HGYLVACTPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF C9 HGYLVACTPDLVLWSSMGLFVNFVYLVVVLCRLRPVIFEQEIEAVYLALF C10 HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF ****** : *::***.*******:************ ************* C1 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C2 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C3 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C4 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C5 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C6 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C7 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C8 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C9 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV C10 QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV ************************************************** C1 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C2 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C3 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C4 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C5 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C6 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C7 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C8 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C9 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL C10 SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL ************************************************** C1 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C2 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C3 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C4 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C5 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C6 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C7 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C8 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C9 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED C10 KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED ************************************************** C1 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C2 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C3 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C4 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C5 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C6 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C7 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C8 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C9 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR C10 AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR ************************************************** C1 IDETDHETAVooooooooo------ C2 IDETDHETAVoooooooooo----- C3 IDETDHETAVoooooooooo----- C4 IDETDHETAVoooooooo------- C5 IDETDHETAVoooo----------- C6 IDETDHETAVoooooooo------- C7 IDETDHETAVoooooooo------- C8 IDETDHETAV--------------- C9 IDETDHETAVooooooooooooooo C10 IDETDHETAVooooooooooo---- ********** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] ins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 10 SEQUENCES [PROTEIN] Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 408 type PROTEIN Struct Unchecked Input File /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 408 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [46484] Library Relaxation: Multi_proc [72] Relaxation Summary: [46484]--->[43571] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/28/bves-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.639 Mb, Max= 31.836 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGADASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVooooooooo------ >C2 MPSTAG-SAAGVWMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooooo----- >C3 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooooo----- >C4 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVARAPDVMLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooo------- >C5 MPSTAGSSAAGVGMGALINSAGSSASSVMGIGLGGAAAAAGASGGS---- -PGSGGGDASAAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooo----------- >C6 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAPGAPG------- -SASGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooo------- >C7 MPSTAG-SAAGVGMGALINNAGSSASSVMGIGLGRAAATGAGAGAP---- -GAASAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVACAPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooo------- >C8 MPSTAG-SAAGVGMGALINSAGSSASGAMGIGLGGAAAAGAAGAAAGPGA GAAVSGGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHPLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV--------------- >C9 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAVS----------- ----GSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCFGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRATLLIGCLMMGM HGYLVACTPDLVLWSSMGLFVNFVYLVVVLCRLRPVIFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVooooooooooooooo >C10 MPSTTG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAAG---------- -TGAGAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVooooooooooo---- FORMAT of file /tmp/tmp909604648873519861aln Not Supported[FATAL:T-COFFEE] >C1 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGADASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVooooooooo------ >C2 MPSTAG-SAAGVWMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooooo----- >C3 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooooo----- >C4 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVARAPDVMLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooo------- >C5 MPSTAGSSAAGVGMGALINSAGSSASSVMGIGLGGAAAAAGASGGS---- -PGSGGGDASAAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooo----------- >C6 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAPGAPG------- -SASGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooo------- >C7 MPSTAG-SAAGVGMGALINNAGSSASSVMGIGLGRAAATGAGAGAP---- -GAASAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVACAPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVoooooooo------- >C8 MPSTAG-SAAGVGMGALINSAGSSASGAMGIGLGGAAAAGAAGAAAGPGA GAAVSGGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHPLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV--------------- >C9 MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAVS----------- ----GSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCFGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRATLLIGCLMMGM HGYLVACTPDLVLWSSMGLFVNFVYLVVVLCRLRPVIFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVooooooooooooooo >C10 MPSTTG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAAG---------- -TGAGAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAVooooooooooo---- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:425 S:96 BS:425 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # PW_SEQ_DISTANCES BOT 0 1 98.28 C1 C2 98.28 TOP 1 0 98.28 C2 C1 98.28 BOT 0 2 98.53 C1 C3 98.53 TOP 2 0 98.53 C3 C1 98.53 BOT 0 3 98.77 C1 C4 98.77 TOP 3 0 98.77 C4 C1 98.77 BOT 0 4 95.02 C1 C5 95.02 TOP 4 0 95.02 C5 C1 95.02 BOT 0 5 96.53 C1 C6 96.53 TOP 5 0 96.53 C6 C1 96.53 BOT 0 6 97.54 C1 C7 97.54 TOP 6 0 97.54 C7 C1 97.54 BOT 0 7 94.72 C1 C8 94.72 TOP 7 0 94.72 C8 C1 94.72 BOT 0 8 95.99 C1 C9 95.99 TOP 8 0 95.99 C9 C1 95.99 BOT 0 9 96.27 C1 C10 96.27 TOP 9 0 96.27 C10 C1 96.27 BOT 1 2 99.75 C2 C3 99.75 TOP 2 1 99.75 C3 C2 99.75 BOT 1 3 98.03 C2 C4 98.03 TOP 3 1 98.03 C4 C2 98.03 BOT 1 4 94.03 C2 C5 94.03 TOP 4 1 94.03 C5 C2 94.03 BOT 1 5 95.78 C2 C6 95.78 TOP 5 1 95.78 C6 C2 95.78 BOT 1 6 96.80 C2 C7 96.80 TOP 6 1 96.80 C7 C2 96.80 BOT 1 7 93.97 C2 C8 93.97 TOP 7 1 93.97 C8 C2 93.97 BOT 1 8 95.25 C2 C9 95.25 TOP 8 1 95.25 C9 C2 95.25 BOT 1 9 95.53 C2 C10 95.53 TOP 9 1 95.53 C10 C2 95.53 BOT 2 3 98.28 C3 C4 98.28 TOP 3 2 98.28 C4 C3 98.28 BOT 2 4 94.28 C3 C5 94.28 TOP 4 2 94.28 C5 C3 94.28 BOT 2 5 96.03 C3 C6 96.03 TOP 5 2 96.03 C6 C3 96.03 BOT 2 6 97.04 C3 C7 97.04 TOP 6 2 97.04 C7 C3 97.04 BOT 2 7 94.22 C3 C8 94.22 TOP 7 2 94.22 C8 C3 94.22 BOT 2 8 95.50 C3 C9 95.50 TOP 8 2 95.50 C9 C3 95.50 BOT 2 9 95.78 C3 C10 95.78 TOP 9 2 95.78 C10 C3 95.78 BOT 3 4 95.05 C4 C5 95.05 TOP 4 3 95.05 C5 C4 95.05 BOT 3 5 97.28 C4 C6 97.28 TOP 5 3 97.28 C6 C4 97.28 BOT 3 6 97.79 C4 C7 97.79 TOP 6 3 97.79 C7 C4 97.79 BOT 3 7 95.50 C4 C8 95.50 TOP 7 3 95.50 C8 C4 95.50 BOT 3 8 96.73 C4 C9 96.73 TOP 8 3 96.73 C9 C4 96.73 BOT 3 9 97.01 C4 C10 97.01 TOP 9 3 97.01 C10 C4 97.01 BOT 4 5 97.03 C5 C6 97.03 TOP 5 4 97.03 C6 C5 97.03 BOT 4 6 94.80 C5 C7 94.80 TOP 6 4 94.80 C7 C5 94.80 BOT 4 7 95.53 C5 C8 95.53 TOP 7 4 95.53 C8 C5 95.53 BOT 4 8 96.98 C5 C9 96.98 TOP 8 4 96.98 C9 C5 96.98 BOT 4 9 97.76 C5 C10 97.76 TOP 9 4 97.76 C10 C5 97.76 BOT 5 6 97.04 C6 C7 97.04 TOP 6 5 97.04 C7 C6 97.04 BOT 5 7 97.50 C6 C8 97.50 TOP 7 5 97.50 C8 C6 97.50 BOT 5 8 98.25 C6 C9 98.25 TOP 8 5 98.25 C9 C6 98.25 BOT 5 9 98.52 C6 C10 98.52 TOP 9 5 98.52 C10 C6 98.52 BOT 6 7 96.25 C7 C8 96.25 TOP 7 6 96.25 C8 C7 96.25 BOT 6 8 96.48 C7 C9 96.48 TOP 8 6 96.48 C9 C7 96.48 BOT 6 9 97.51 C7 C10 97.51 TOP 9 6 97.51 C10 C7 97.51 BOT 7 8 96.69 C8 C9 96.69 TOP 8 7 96.69 C9 C8 96.69 BOT 7 9 97.48 C8 C10 97.48 TOP 9 7 97.48 C10 C8 97.48 BOT 8 9 97.77 C9 C10 97.77 TOP 9 8 97.77 C10 C9 97.77 AVG 0 C1 * 96.85 AVG 1 C2 * 96.38 AVG 2 C3 * 96.60 AVG 3 C4 * 97.16 AVG 4 C5 * 95.61 AVG 5 C6 * 97.11 AVG 6 C7 * 96.81 AVG 7 C8 * 95.76 AVG 8 C9 * 96.63 AVG 9 C10 * 97.07 TOT TOT * 96.60 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCCCAGCACGGCGGGC---AGTGCAGCTGGCGTTGGTATGGGCGCCCT C2 ATGCCCAGCACGGCGGGC---AGTGCAGCTGGCGTTTGGATGGGCGCCCT C3 ATGCCCAGCACGGCGGGC---AGTGCGGCGGGCGTTGGGATGGGCGCCCT C4 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCCCT C5 ATGCCCAGCACGGCGGGCAGTAGTGCAGCGGGCGTTGGGATGGGCGCTCT C6 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCTCT C7 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGAGCTCT C8 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGAATGGGCGCTCT C9 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCTCT C10 ATGCCAAGCACGACGGGC---AGTGCAGCAGGCGTTGGAATGGGAGCTTT *****.******.***** *****.** ****** * *****.** * C1 GATCAACAGTGCCGGCAGCAGCGCCAGTAGTGTCATGGGCATTGGCATGG C2 GATCAACAGTGCCGGCAGCAGCGCCAGTAGCGTCATGGGCATCGGCATGG C3 GATCAACAGTGCCGGCAGCAGCGCCAGTAGCGTCATGGGCATCGGCATGG C4 GATCAACAGCGCCGGCAGCAGCGCCAGTAGTGTCATGGGCATCGGCATGG C5 GATCAATAGTGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATTGGCCTGG C6 GATCAATAGTGCCGGCAGCAGCGCCAGCAGCGTCATGGGCATCGGTCTGG C7 AATCAATAATGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATCGGCCTGG C8 AATCAATAGTGCCGGCAGCAGTGCCAGTGGTGCCATGGGCATCGGCCTGG C9 GATCAACAGTGCCGGTAGTAGTGCCAGTAGTGTCATGGGCATCGGACTAG C10 GATCAATAGTGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATTGGACTGG .***** *. ***** ** ** ***** .* * ********* ** .*.* C1 GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ C2 GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ C3 GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ C4 GCAGAGCAGCGGCTACGGGGGCAGGAGCAGGAGCACCG------------ C5 GCGGAGCAGCTGCAGCAGCGGGAGCATCAGGAGGATCA------------ C6 GCGGAGCAGCTGCACCAGGAGCTCCTGGC--------------------- C7 GAAGAGCAGCTGCCACGGGAGCAGGAGCTGGGGCACCA------------ C8 GTGGAGCAGCGGCGGCCGGAGCAGCAGGAGCAGCAGCTGGACCAGGTGCT C9 GCGGAGCAGCTGTATCT--------------------------------- C10 GCGGAGCAGCCGCAGCAGGA------------------------------ * .******* * * C1 ---GGCAGTTCGGGATCTGGAGCAGATGCCTCCGCCGCCGGCACTTTAAT C2 ---GGCAGCTCGGGATCTGGAGCAGAGGCCTCCGCTGGC---ACTTTAAT C3 ---GGCAGTTCGGGATCTGGAGCAGAGGCCTCCGCCGGC---ACTTTAAT C4 ---GGTAGTTCGGGATCTGGAGCAGAGGCATCTGCCGGC---ACACTAAT C5 ---CCTGGATCTGGAGGAGGAGATGCCTCCGCTGCTGGC---ACCCTAAT C6 ---TCCGCCTCCGGATCTGGGGCAGAGGCCTCCGCTGGC---ACTTTGAT C7 ---GGGGCAGCTAGTGCTGGAGCAGAGGCTTCTGCTGGC---ACTCTAAT C8 GGAGCGGCTGTCTCCGGTGGAGCAGAGGCCTCCGCCGGT---ACCTTGAT C9 ------------GGATCTGGAGCAGAGGCCTCCGCCGGC---ACCTTGAT C10 ---ACTGGAGCTGGAGCTGGAGCAGAGGCCTCAGCCGGC---ACCTTAAT :**.*.:*. * * ** * ** *.** C1 CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGTGGAACGATCACCT C2 CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACCATGCCCT C3 CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACCATGCCCT C4 CGCGCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACGATCACCT C5 CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGCACGATCACCT C6 AGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGTACGATCACCT C7 TGCCCAGAGCACGGCAGGAACGAGCGCGGCCAGCAGCGGTACGATCACCT C8 CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGTACGATCACCT C9 TGCCCAGAGCACGGCGGGTACGAGTGCCGCCAGCAGCGGTACGATCACCT C10 CGCACAGAGCACGGCGGGAACAAGCGCCGCCAGCAGCGGTACCATCACTT ** ***********.**:**.** ** ******** ** ** ** .* * C1 GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGATTGGTCCATC C2 GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C3 GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C4 GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C5 GGGACAACAACGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C6 GGGACAACAACGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C7 GGGACAATAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C8 GGGACAACAACGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C9 GGGACAACAATGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC C10 GGGACAACAATGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC ******* ** **.************************** ********* C1 GAACAGTGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG C2 GAACAGAGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG C3 GAACAGAGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG C4 GAACAGTGCCTTGGG---------CCACATCACCTGTACTTTCAGCTCGG C5 GAACAGTGCCTCGGTTGGCAGCAGCCGCATCACCTCTACTTTCAGCTCGG C6 GAACAGTGCCTCGGATGGCAGCAGCCACATCACCTGTACTTTCAGCTCGG C7 GAACAGTGCCTCGGA---------CCACATCACCTGTACTTTCAGCTCGG C8 GAACAGTGCCTCGGTTGGCAGCAGCCGCATCCGCTCTACTTTCAGCTCGG C9 GAACAGTGCTTCGGATGGCAGCAGCCGCATCACCTGTACTTTCAGCTCGG C10 GAACAGTGCCTCGGTTGGCAGCAGCCGCATCACCTGTACTTTCAGCTCGG ******:** * ** **.****. ** ************** C1 CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCACACGGTCCCTACGGCG C2 CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCCCACGGTCCCTACGGTG C3 CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCCCACGGTCCCTACGGCG C4 CTGGGCCTTCCTCTTCCTAGCCTTTTTGGCTCCACACGGTCCCTACGGAT C5 CTGGGCCTTCCTCTTCCTGGCCTTCTTGGCCCCGCACGGCCCCTACGGAT C6 CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCCCCCCACGGCCCCTACGGCT C7 CTGGGCCTTCCTCTTCCTGGCTTTTTTGGCCCCCCATGGTCCCTACGGAG C8 CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCGCCCCACGGTCCGTACGGAT C9 CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCCCCCCACGGTCCCTACGGAT C10 CTGGGCCTTTCTCTTCCTGGCCTTCCTGGCGCCCCATGGTCCCTACGGAT ********* ********.** ** **** ** ** ** ** ***** C1 CCCTGTGGATGCGTGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG C2 CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG C3 CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG C4 CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG C5 CCCTCTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG C6 CGCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG C7 CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTAATGATGGGCATG C8 CGCTCTGGATGCGGGCCATGCTGCTCATCGGCTGCCTGATGATGGGCATG C9 CGCTGTGGATGCGGGCCACGCTGCTCATTGGCTGCCTGATGATGGGCATG C10 CGCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG * ** ******** **** ********* ********.************ C1 CATGGCTACTTGGTGGCCTTTGCACCGGACGTCATCCTGTGGTCGGGCAT C2 CATGGCTACTTGGTGGCCTTTGCAAAGGACGTCATCCTGTGGTCGGGCAT C3 CATGGCTACTTGGTGGCCTTTGCAAAGGACGTCATCCTGTGGTCGGGCAT C4 CATGGCTACTTGGTGGCCCGTGCACCGGACGTCATGCTGTGGTCGGGCAT C5 CACGGCTATCTGGTGGCCTGTACACCGGATGTTGTCCTCTGGTCGGGCAT C6 CACGGCTATCTGGTGGCCTGCACGCCGGACGTGGTCCTATGGTCCGGCAT C7 CACGGCTATCTGGTGGCCTGTGCACCGGATGTGGTCTTGTGGTCCGGCAT C8 CACGGCTATCTGGTGGCCTGCACACCGGACGTGGTCCTCTGGTCCGGAAT C9 CACGGCTATCTGGTCGCCTGCACCCCGGACTTAGTTTTGTGGTCGAGCAT C10 CACGGCTACCTGGTCGCCTGCACGCCGGATGTGGTCCTATGGTCGGGCAT ** ***** **** *** .* ..*** * .* * ***** .*.** C1 GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTATGCCGGCTGA C2 GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA C3 GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA C4 GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA C5 GGGACTCTTCGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGCCGACTGA C6 GGGACTGTTTGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGCCGCCTGA C7 GGGACTCTTCGTCAACTTCATCTATCTCGTCGTGGTGCTATGCCGGCTGA C8 GGGACTGTTCGTCAACTTCATCTATCTCGTCGTGGTGCTCTGCCGGCTGA C9 GGGCCTGTTCGTCAACTTTGTCTATCTCGTCGTGGTGCTGTGCCGGCTGA C10 GGGCCTCTTTGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGTCGGCTGA ***.** ** ******** .******************* ** ** **** C1 GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTCTACCTGGCACTTTTC C2 GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTGTACCTGGCACTTTTC C3 GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTGTACCTGGCACTTTTC C4 GGCCTGTGAGATTCGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTC C5 GACCCGTGAGATTCGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTC C6 GACCCGTGAGATTCGAGCAGGAAATCGAGGCGGTTTACCTGGCACTTTTC C7 GGCCCGTCAGATTCGAGCAGGAAATCGAGGCGGTGTATCTGGCACTTTTC C8 GACCCGTGCGATTCGAGCAGGAAATCGAGGCGGTTTACCTGGCACTTTTC C9 GACCCGTGATATTTGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTT C10 GACCCGTGAGATTTGAGCAAGAAATCGAGGCGGTGTACCTGGCACTTTTT *.** ** . *** *****.********.***** ** *********** C1 CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT C2 CAGCCGCTGCACGTGACACGCCACCAGTTCAAGAAGGTGCTCAACTGCAT C3 CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT C4 CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT C5 CAGCCGCTGCACGTGACTCGCCATCAGTTCAAGAAGGTGCTCAACTGCAT C6 CAGCCCCTGCACGTGACTCGCCATCAGTTCAAGAAGGTGCTCAACTGCAT C7 CAGCCGCTGCACGTGACTCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT C8 CAGCCGCTGCACGTGACGCGCCATCAGTTCAAAAAGGTGCTCAACTGCAT C9 CAGCCGCTGCACGTGACTCGTCATCAGTTCAAGAAGGTGCTCAACTGCAT C10 CAGCCGCTGCACGTGACTCGCCACCAGTTCAAAAAGGTGCTCAACTGCAT ***** *********** ** ** ********.***************** C1 GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG C2 GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG C3 GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG C4 GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG C5 GAAGGTGATACGCGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG C6 GAAGGTGATACGTGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG C7 GAAGGTGATACGTGCATTGAAGTACCAGGAGGTCTATGCCCAGGAGAAGG C8 GAAGGTGATACGCGCCCTGAAATACCAGGAAGTCTATGCCCAGGAGAAGG C9 GAAGGTGATACGCGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG C10 GAAGGTGATACGTGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG ************ **. ****.********.***** ************* C1 TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG C2 TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG C3 TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG C4 TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAATTGGTGGTG C5 TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTGGTGGTG C6 TTACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTAGTGGTG C7 TCACCAAGGTCGACAGCCTGTCGCTGGTGTTGAGTGGCAAGTTGGTGGTG C8 TCACCAAGGTGGACAGCCTCTCGTTGGTGCTGAGTGGCAAATTGGTGGTG C9 TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTGGTGGTG C10 TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAACTGGTGGTG * ******** ******** *** ***** **** *****. *.****** C1 TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C2 TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C3 TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C4 TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C5 TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C6 TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C7 TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C8 TCGCAGCATCAGCGAGCGCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C9 TCCCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA C10 TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA ** ***********.** ******************************** C1 CTCGCCAGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C2 CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C3 CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C4 CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C5 CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C6 CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C7 CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C8 CTCGCCGGAATGGTTTGGCGTCTCGACCGACGACTACTTTCAGGTCTCCA C9 CTCGCCGGAGTGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA C10 TTCGCCCGAGTGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA ***** **.******************** ******************* C1 TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC C2 TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC C3 TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC C4 TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC C5 TCATGGCCATGGAGGAATCGCGGGTGCTGATCTGGCATCGCGACAAGCTC C6 TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC C7 TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCACCGCGACAAGCTC C8 TTATGGCCATGGAGGAGTCGCGAGTGCTGATCTGGCATCGCGACAAGCTC C9 TTATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC C10 TTATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC * **************.***** ************** ************ C1 AAATTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT C2 AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT C3 AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT C4 AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT C5 AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTTTTCGATCACAT C6 AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT C7 AAACTGTCAATTATGGCCGAGCCTTTCTTGCAGACCGTCTTCGATCACAT C8 AAATTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT C9 AAACTGTCTATTATGGCCGAGCCCTTCTTGCAAACCGTCTTCGATCACAT C10 AAGCTGTCTATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT **. ****:************** ********.***** *********** C1 TCTGGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C2 TCTGGGCCGGGATGTGGTCAAGAAGCTAATGCAGGTCACCCAGGTGAGCG C3 TCTGGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C4 TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C5 TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C6 TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C7 TCTCGGTCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C8 TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C9 TCTCGGCCGAGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG C10 TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG *** ** **.*****************.********************** C1 AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT C2 AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT C3 AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT C4 AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT C5 AATCGATAGCCAGCAATGGCTTCCTGCCATCGGGAGGATATGCGGAGGAT C6 AATCGATAGCCAGCAATGGCTTCCTGCCCTCGGGTGGCTATGCGGAGGAT C7 AATCGATAGCCAGCAATGGCTTCCTGCCTTCGGGAGGATATGCGGAGGAT C8 AATCGATAGCCAGCAATGGCTTCCTGCCATCGGGAGGATATGCTGAGGAT C9 AATCGATAGCCAGTAATGGCTTTTTGCCCTCGGGAGGATATGCGGAGGAT C10 AATCGATAGCCAGCAATGGCTTTCTGCCATCGGGAGGATATGCGGAGGAT *.*********** ******** **** ** **:**.***** ****** C1 GCGGAGGACAAGCCCATGTTGATACTAAAGAAGAGTGTGGATGTGGGACA C2 GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGACA C3 GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGACA C4 GCGGAGGACAAGCCCATGCTGATACTCAAGAAGAGTGTGGATGTGGGACA C5 GCGGAGGATAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA C6 GCGGAGGACAAGCCCATGTTGATACTAAAGAAGAGTGTGGATGTGGGCCA C7 GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGACGTGGGCCA C8 GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA C9 GCGGAGGACAAGCCCATGTTGATACTGAAGAAGAGTGTGGATGTGGGTCA C10 GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA ******** ********* ******* ************** ***** ** C1 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT C2 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT C3 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT C4 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT C5 CGGACTGACGGCCCTGATCAACCGGCAGCTGCAGGCCCTGCCCAGGATAT C6 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT C7 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT C8 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT C9 CGGACTGACGGCCTTGATCAACCGGCAGTTACAGGCCCTGCCCAGGATAT C10 CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT ************* ************** *.*********** ******* C1 CGAAGTATTACGATTGCGCTGGAGATCCGAATTCTTGGCGCCTTGGAAGG C2 CGAAGTATTACGATTGCGCTGGGGATCCGAATTCTTGGCGCCTTGGAAGG C3 CGAAGTATTACGATTGCGCTGGGGATCCGAATTCTTGGCGCCTTGGAAGG C4 CGAAGTATTACGATTGCGCTGGGGATCCGAACTCTTGGCGCCTTGGGAGG C5 CGAAGTATTATGACTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGGAGG C6 CGAAGTATTATGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGA C7 CGAAGTATTACGACTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGG C8 CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGG C9 CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGGAGG C10 CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGACGG ******* ** ** ********.***** ** **************..*. C1 ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- C2 ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- C3 ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- C4 ATCGATGAAACGGATCATGAAACGGCCGTT-------------------- C5 ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- C6 ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- C7 ATCGACGAGACGGACCACGAAACGGCCGTT-------------------- C8 ATCGACGAAACGGACCACGAAACGGCGGTT-------------------- C9 ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- C10 ATCGATGAAACGGACCATGAAACGGCCGTT-------------------- ***** **.***** ** ******** *** C1 ------------------------- C2 ------------------------- C3 ------------------------- C4 ------------------------- C5 ------------------------- C6 ------------------------- C7 ------------------------- C8 ------------------------- C9 ------------------------- C10 ------------------------- >C1 ATGCCCAGCACGGCGGGC---AGTGCAGCTGGCGTTGGTATGGGCGCCCT GATCAACAGTGCCGGCAGCAGCGCCAGTAGTGTCATGGGCATTGGCATGG GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ ---GGCAGTTCGGGATCTGGAGCAGATGCCTCCGCCGCCGGCACTTTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGTGGAACGATCACCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGATTGGTCCATC GAACAGTGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCACACGGTCCCTACGGCG CCCTGTGGATGCGTGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCTTTGCACCGGACGTCATCCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTATGCCGGCTGA GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTCTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCAGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAATTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTGGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTAAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGAGATCCGAATTCTTGGCGCCTTGGAAGG ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- ------------------------- >C2 ATGCCCAGCACGGCGGGC---AGTGCAGCTGGCGTTTGGATGGGCGCCCT GATCAACAGTGCCGGCAGCAGCGCCAGTAGCGTCATGGGCATCGGCATGG GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ ---GGCAGCTCGGGATCTGGAGCAGAGGCCTCCGCTGGC---ACTTTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACCATGCCCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGAGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCCCACGGTCCCTACGGTG CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCTTTGCAAAGGACGTCATCCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACACGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTGGGCCGGGATGTGGTCAAGAAGCTAATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGGGATCCGAATTCTTGGCGCCTTGGAAGG ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- ------------------------- >C3 ATGCCCAGCACGGCGGGC---AGTGCGGCGGGCGTTGGGATGGGCGCCCT GATCAACAGTGCCGGCAGCAGCGCCAGTAGCGTCATGGGCATCGGCATGG GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ ---GGCAGTTCGGGATCTGGAGCAGAGGCCTCCGCCGGC---ACTTTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACCATGCCCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGAGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCCCACGGTCCCTACGGCG CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCTTTGCAAAGGACGTCATCCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTGGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGGGATCCGAATTCTTGGCGCCTTGGAAGG ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- ------------------------- >C4 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCCCT GATCAACAGCGCCGGCAGCAGCGCCAGTAGTGTCATGGGCATCGGCATGG GCAGAGCAGCGGCTACGGGGGCAGGAGCAGGAGCACCG------------ ---GGTAGTTCGGGATCTGGAGCAGAGGCATCTGCCGGC---ACACTAAT CGCGCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACGATCACCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTTGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTAGCCTTTTTGGCTCCACACGGTCCCTACGGAT CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCCGTGCACCGGACGTCATGCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA GGCCTGTGAGATTCGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAATTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGCTGATACTCAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGGGATCCGAACTCTTGGCGCCTTGGGAGG ATCGATGAAACGGATCATGAAACGGCCGTT-------------------- ------------------------- >C5 ATGCCCAGCACGGCGGGCAGTAGTGCAGCGGGCGTTGGGATGGGCGCTCT GATCAATAGTGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATTGGCCTGG GCGGAGCAGCTGCAGCAGCGGGAGCATCAGGAGGATCA------------ ---CCTGGATCTGGAGGAGGAGATGCCTCCGCTGCTGGC---ACCCTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGCACGATCACCT GGGACAACAACGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGTTGGCAGCAGCCGCATCACCTCTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCTTGGCCCCGCACGGCCCCTACGGAT CCCTCTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTGGCCTGTACACCGGATGTTGTCCTCTGGTCGGGCAT GGGACTCTTCGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGCCGACTGA GACCCGTGAGATTCGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACTCGCCATCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGCGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTGGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAATCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTTTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCATCGGGAGGATATGCGGAGGAT GCGGAGGATAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTGCAGGCCCTGCCCAGGATAT CGAAGTATTATGACTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGGAGG ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- ------------------------- >C6 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCTCT GATCAATAGTGCCGGCAGCAGCGCCAGCAGCGTCATGGGCATCGGTCTGG GCGGAGCAGCTGCACCAGGAGCTCCTGGC--------------------- ---TCCGCCTCCGGATCTGGGGCAGAGGCCTCCGCTGGC---ACTTTGAT AGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGTACGATCACCT GGGACAACAACGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGATGGCAGCAGCCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCCCCCCACGGCCCCTACGGCT CGCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTGGCCTGCACGCCGGACGTGGTCCTATGGTCCGGCAT GGGACTGTTTGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGCCGCCTGA GACCCGTGAGATTCGAGCAGGAAATCGAGGCGGTTTACCTGGCACTTTTC CAGCCCCTGCACGTGACTCGCCATCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TTACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTAGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCCTCGGGTGGCTATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTAAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTATTATGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGA ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- ------------------------- >C7 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGAGCTCT AATCAATAATGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATCGGCCTGG GAAGAGCAGCTGCCACGGGAGCAGGAGCTGGGGCACCA------------ ---GGGGCAGCTAGTGCTGGAGCAGAGGCTTCTGCTGGC---ACTCTAAT TGCCCAGAGCACGGCAGGAACGAGCGCGGCCAGCAGCGGTACGATCACCT GGGACAATAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGA---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCTTTTTTGGCCCCCCATGGTCCCTACGGAG CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTAATGATGGGCATG CACGGCTATCTGGTGGCCTGTGCACCGGATGTGGTCTTGTGGTCCGGCAT GGGACTCTTCGTCAACTTCATCTATCTCGTCGTGGTGCTATGCCGGCTGA GGCCCGTCAGATTCGAGCAGGAAATCGAGGCGGTGTATCTGGCACTTTTC CAGCCGCTGCACGTGACTCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCATTGAAGTACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGTTGAGTGGCAAGTTGGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCACCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCTTTCTTGCAGACCGTCTTCGATCACAT TCTCGGTCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCTTCGGGAGGATATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGACGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTATTACGACTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGG ATCGACGAGACGGACCACGAAACGGCCGTT-------------------- ------------------------- >C8 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGAATGGGCGCTCT AATCAATAGTGCCGGCAGCAGTGCCAGTGGTGCCATGGGCATCGGCCTGG GTGGAGCAGCGGCGGCCGGAGCAGCAGGAGCAGCAGCTGGACCAGGTGCT GGAGCGGCTGTCTCCGGTGGAGCAGAGGCCTCCGCCGGT---ACCTTGAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGTACGATCACCT GGGACAACAACGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGTTGGCAGCAGCCGCATCCGCTCTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCGCCCCACGGTCCGTACGGAT CGCTCTGGATGCGGGCCATGCTGCTCATCGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTGGCCTGCACACCGGACGTGGTCCTCTGGTCCGGAAT GGGACTGTTCGTCAACTTCATCTATCTCGTCGTGGTGCTCTGCCGGCTGA GACCCGTGCGATTCGAGCAGGAAATCGAGGCGGTTTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCATCAGTTCAAAAAGGTGCTCAACTGCAT GAAGGTGATACGCGCCCTGAAATACCAGGAAGTCTATGCCCAGGAGAAGG TCACCAAGGTGGACAGCCTCTCGTTGGTGCTGAGTGGCAAATTGGTGGTG TCGCAGCATCAGCGAGCGCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGACGACTACTTTCAGGTCTCCA TTATGGCCATGGAGGAGTCGCGAGTGCTGATCTGGCATCGCGACAAGCTC AAATTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCATCGGGAGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGG ATCGACGAAACGGACCACGAAACGGCGGTT-------------------- ------------------------- >C9 ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCTCT GATCAACAGTGCCGGTAGTAGTGCCAGTAGTGTCATGGGCATCGGACTAG GCGGAGCAGCTGTATCT--------------------------------- ------------GGATCTGGAGCAGAGGCCTCCGCCGGC---ACCTTGAT TGCCCAGAGCACGGCGGGTACGAGTGCCGCCAGCAGCGGTACGATCACCT GGGACAACAATGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCTTCGGATGGCAGCAGCCGCATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCCCCCCACGGTCCCTACGGAT CGCTGTGGATGCGGGCCACGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTCGCCTGCACCCCGGACTTAGTTTTGTGGTCGAGCAT GGGCCTGTTCGTCAACTTTGTCTATCTCGTCGTGGTGCTGTGCCGGCTGA GACCCGTGATATTTGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTT CAGCCGCTGCACGTGACTCGTCATCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGCGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTGGTGGTG TCCCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAGTGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TTATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCTATTATGGCCGAGCCCTTCTTGCAAACCGTCTTCGATCACAT TCTCGGCCGAGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGTAATGGCTTTTTGCCCTCGGGAGGATATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTGAAGAAGAGTGTGGATGTGGGTCA CGGACTGACGGCCTTGATCAACCGGCAGTTACAGGCCCTGCCCAGGATAT CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGGAGG ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- ------------------------- >C10 ATGCCAAGCACGACGGGC---AGTGCAGCAGGCGTTGGAATGGGAGCTTT GATCAATAGTGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATTGGACTGG GCGGAGCAGCCGCAGCAGGA------------------------------ ---ACTGGAGCTGGAGCTGGAGCAGAGGCCTCAGCCGGC---ACCTTAAT CGCACAGAGCACGGCGGGAACAAGCGCCGCCAGCAGCGGTACCATCACTT GGGACAACAATGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGTTGGCAGCAGCCGCATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTGGCCTTCCTGGCGCCCCATGGTCCCTACGGAT CGCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTACCTGGTCGCCTGCACGCCGGATGTGGTCCTATGGTCGGGCAT GGGCCTCTTTGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGTCGGCTGA GACCCGTGAGATTTGAGCAAGAAATCGAGGCGGTGTACCTGGCACTTTTT CAGCCGCTGCACGTGACTCGCCACCAGTTCAAAAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAACTGGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA TTCGCCCGAGTGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TTATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAGCTGTCTATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTTCTGCCATCGGGAGGATATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGACGG ATCGATGAAACGGACCATGAAACGGCCGTT-------------------- ------------------------- >C1 MPSTAGoSAAGVGMGALINSAGSSASSVMGIGMGRAAATooGAGAPoooo oGSSGSGADASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGoooPHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C2 MPSTAGoSAAGVWMGALINSAGSSASSVMGIGMGRAAATooGAGAPoooo oGSSGSGAEASAGoTLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLGoooPHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C3 MPSTAGoSAAGVGMGALINSAGSSASSVMGIGMGRAAATooGAGAPoooo oGSSGSGAEASAGoTLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLGoooPHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C4 MPSTAGoSAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAGAPoooo oGSSGSGAEASAGoTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGoooPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVARAPDVMLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C5 MPSTAGSSAAGVGMGALINSAGSSASSVMGIGLGGAAAAAGASGGSoooo oPGSGGGDASAAGoTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C6 MPSTAGoSAAGVGMGALINSAGSSASSVMGIGLGGAAAPGAPGooooooo oSASGSGAEASAGoTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C7 MPSTAGoSAAGVGMGALINNAGSSASSVMGIGLGRAAATGAGAGAPoooo oGAASAGAEASAGoTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGoooPHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVACAPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C8 MPSTAGoSAAGVGMGALINSAGSSASGAMGIGLGGAAAAGAAGAAAGPGA GAAVSGGAEASAGoTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHPLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C9 MPSTAGoSAAGVGMGALINSAGSSASSVMGIGLGGAAVSooooooooooo ooooGSGAEASAGoTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCFGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRATLLIGCLMMGM HGYLVACTPDLVLWSSMGLFVNFVYLVVVLCRLRPVIFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >C10 MPSTTGoSAAGVGMGALINSAGSSASSVMGIGLGGAAAAGoooooooooo oTGAGAGAEASAGoTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 10 taxa and 1275 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479530560 Setting output file names to "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1019519723 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 3345153777 Seed = 694649991 Swapseed = 1479530560 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 52 unique site patterns Division 2 has 34 unique site patterns Division 3 has 146 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4997.839682 -- -24.412588 Chain 2 -- -5277.600612 -- -24.412588 Chain 3 -- -5147.492751 -- -24.412588 Chain 4 -- -5297.107771 -- -24.412588 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -5284.853738 -- -24.412588 Chain 2 -- -5171.370438 -- -24.412588 Chain 3 -- -5134.887809 -- -24.412588 Chain 4 -- -5213.142686 -- -24.412588 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4997.840] (-5277.601) (-5147.493) (-5297.108) * [-5284.854] (-5171.370) (-5134.888) (-5213.143) 500 -- (-3758.881) (-3746.003) (-3774.341) [-3736.546] * (-3743.412) (-3730.611) (-3776.578) [-3728.255] -- 0:00:00 1000 -- (-3704.641) (-3694.584) [-3705.680] (-3695.077) * (-3700.604) (-3656.927) (-3680.946) [-3671.571] -- 0:00:00 1500 -- (-3669.961) (-3671.329) (-3645.959) [-3672.669] * (-3645.575) [-3600.754] (-3650.285) (-3638.745) -- 0:00:00 2000 -- (-3641.213) (-3641.021) [-3609.368] (-3644.336) * (-3613.726) [-3595.389] (-3606.160) (-3618.144) -- 0:08:19 2500 -- (-3598.314) (-3623.137) (-3603.611) [-3606.412] * (-3601.074) [-3593.710] (-3600.029) (-3600.481) -- 0:06:39 3000 -- (-3601.547) (-3608.370) [-3601.826] (-3597.051) * [-3597.759] (-3593.588) (-3595.886) (-3602.683) -- 0:05:32 3500 -- [-3594.929] (-3607.391) (-3592.814) (-3596.928) * (-3601.120) [-3592.680] (-3593.329) (-3597.365) -- 0:09:29 4000 -- (-3591.663) (-3598.854) [-3596.930] (-3592.770) * (-3601.994) (-3589.833) [-3597.690] (-3597.397) -- 0:08:18 4500 -- [-3593.443] (-3595.840) (-3603.194) (-3598.599) * (-3594.602) [-3590.950] (-3596.197) (-3608.108) -- 0:07:22 5000 -- (-3590.598) [-3599.761] (-3601.650) (-3592.155) * (-3603.102) (-3591.979) [-3586.844] (-3607.609) -- 0:06:38 Average standard deviation of split frequencies: 0.078567 5500 -- (-3597.284) [-3604.013] (-3601.331) (-3610.671) * (-3592.017) [-3595.224] (-3593.233) (-3599.171) -- 0:09:02 6000 -- [-3596.134] (-3587.025) (-3597.481) (-3594.904) * (-3596.606) [-3599.794] (-3595.738) (-3595.191) -- 0:08:17 6500 -- (-3603.147) [-3587.308] (-3596.191) (-3610.682) * (-3596.035) (-3586.255) [-3591.292] (-3596.163) -- 0:07:38 7000 -- (-3599.748) [-3596.952] (-3595.055) (-3595.641) * (-3592.755) (-3588.657) (-3607.387) [-3595.146] -- 0:07:05 7500 -- (-3597.541) (-3593.556) (-3603.410) [-3600.733] * (-3595.586) [-3596.012] (-3598.236) (-3598.444) -- 0:08:49 8000 -- (-3594.299) (-3593.995) (-3596.586) [-3588.368] * [-3589.438] (-3591.772) (-3592.571) (-3598.592) -- 0:08:16 8500 -- (-3599.802) (-3593.797) (-3587.182) [-3596.284] * (-3597.733) [-3588.204] (-3591.020) (-3589.880) -- 0:07:46 9000 -- (-3594.159) (-3594.238) (-3597.952) [-3591.750] * (-3594.067) (-3594.874) (-3598.983) [-3595.338] -- 0:07:20 9500 -- (-3599.978) (-3592.396) [-3587.826] (-3600.572) * [-3597.179] (-3592.757) (-3602.108) (-3590.210) -- 0:08:41 10000 -- (-3594.128) (-3596.024) (-3594.702) [-3590.639] * [-3598.795] (-3595.810) (-3599.627) (-3595.953) -- 0:08:15 Average standard deviation of split frequencies: 0.084705 10500 -- [-3595.214] (-3596.920) (-3599.043) (-3596.593) * (-3611.478) (-3592.656) (-3594.633) [-3590.239] -- 0:07:51 11000 -- [-3595.035] (-3595.525) (-3598.702) (-3596.973) * [-3601.002] (-3595.417) (-3595.968) (-3596.738) -- 0:07:29 11500 -- (-3600.755) (-3597.650) [-3591.253] (-3595.463) * (-3592.903) [-3597.103] (-3601.596) (-3591.757) -- 0:08:35 12000 -- (-3597.580) (-3595.778) [-3591.652] (-3590.935) * [-3589.528] (-3600.344) (-3603.313) (-3596.175) -- 0:08:14 12500 -- [-3596.158] (-3601.062) (-3597.207) (-3592.077) * (-3590.488) [-3596.819] (-3595.828) (-3597.234) -- 0:07:54 13000 -- (-3599.132) [-3596.356] (-3592.239) (-3595.513) * (-3598.274) [-3601.363] (-3599.493) (-3601.448) -- 0:08:51 13500 -- (-3593.619) (-3596.968) [-3599.212] (-3602.214) * (-3597.425) [-3588.354] (-3605.437) (-3602.418) -- 0:08:31 14000 -- (-3601.365) (-3594.268) (-3594.261) [-3599.682] * (-3597.535) [-3591.653] (-3598.621) (-3598.109) -- 0:08:13 14500 -- [-3596.324] (-3597.499) (-3593.839) (-3589.549) * (-3596.740) [-3589.525] (-3595.340) (-3605.219) -- 0:07:55 15000 -- (-3595.787) (-3596.970) (-3595.998) [-3594.841] * (-3600.030) (-3601.953) [-3593.326] (-3594.609) -- 0:08:45 Average standard deviation of split frequencies: 0.072318 15500 -- (-3596.207) (-3604.465) [-3597.363] (-3598.287) * (-3598.662) [-3590.663] (-3594.076) (-3594.848) -- 0:08:28 16000 -- (-3597.702) [-3597.948] (-3601.340) (-3593.200) * [-3594.548] (-3597.577) (-3595.966) (-3608.016) -- 0:08:12 16500 -- [-3589.474] (-3597.652) (-3593.877) (-3595.874) * (-3598.567) (-3592.140) (-3589.205) [-3601.693] -- 0:07:56 17000 -- (-3597.526) (-3599.087) (-3592.624) [-3599.084] * (-3600.893) [-3596.675] (-3601.108) (-3599.416) -- 0:08:40 17500 -- (-3596.081) (-3595.191) (-3593.640) [-3591.542] * [-3587.469] (-3592.187) (-3593.651) (-3600.218) -- 0:08:25 18000 -- [-3593.933] (-3590.617) (-3599.550) (-3593.905) * [-3590.064] (-3601.186) (-3587.865) (-3595.269) -- 0:08:11 18500 -- (-3596.267) (-3588.732) [-3594.417] (-3605.539) * (-3598.622) (-3600.777) [-3591.404] (-3597.547) -- 0:07:57 19000 -- (-3591.340) [-3592.659] (-3603.055) (-3600.301) * (-3596.628) (-3598.369) [-3595.402] (-3602.471) -- 0:08:36 19500 -- [-3592.907] (-3602.382) (-3601.467) (-3599.261) * (-3599.751) [-3596.120] (-3598.750) (-3601.414) -- 0:08:22 20000 -- (-3589.574) (-3600.234) (-3603.577) [-3588.679] * (-3589.695) (-3597.758) (-3604.891) [-3590.710] -- 0:08:10 Average standard deviation of split frequencies: 0.058062 20500 -- [-3593.490] (-3593.585) (-3599.206) (-3593.798) * (-3595.554) (-3593.252) [-3592.564] (-3589.719) -- 0:07:57 21000 -- [-3592.105] (-3597.908) (-3595.394) (-3597.632) * (-3592.508) (-3597.281) (-3599.566) [-3598.467] -- 0:08:32 21500 -- [-3591.372] (-3599.887) (-3598.852) (-3594.893) * (-3597.391) (-3599.956) [-3590.958] (-3597.742) -- 0:08:20 22000 -- [-3592.863] (-3597.560) (-3595.656) (-3594.616) * (-3597.400) (-3601.991) (-3591.008) [-3597.941] -- 0:08:09 22500 -- (-3599.830) (-3600.546) (-3596.989) [-3594.859] * [-3586.598] (-3587.945) (-3595.593) (-3599.938) -- 0:07:57 23000 -- [-3590.473] (-3604.525) (-3593.738) (-3591.873) * [-3588.493] (-3590.942) (-3602.879) (-3592.264) -- 0:08:29 23500 -- (-3596.026) (-3593.268) (-3597.359) [-3599.742] * [-3586.915] (-3592.778) (-3596.574) (-3593.231) -- 0:08:18 24000 -- [-3590.752] (-3603.959) (-3593.737) (-3595.631) * [-3591.275] (-3602.043) (-3597.206) (-3598.687) -- 0:08:08 24500 -- (-3595.303) (-3593.109) [-3605.663] (-3602.997) * (-3592.133) (-3602.004) (-3599.792) [-3595.402] -- 0:08:37 25000 -- [-3590.531] (-3602.585) (-3605.145) (-3596.497) * (-3594.325) (-3607.411) (-3594.517) [-3588.789] -- 0:08:26 Average standard deviation of split frequencies: 0.072524 25500 -- (-3608.264) [-3592.330] (-3598.984) (-3595.654) * (-3602.105) (-3600.046) [-3588.983] (-3592.136) -- 0:08:16 26000 -- (-3609.726) (-3594.490) [-3599.492] (-3608.125) * (-3596.953) (-3593.039) (-3594.012) [-3586.656] -- 0:08:07 26500 -- (-3604.415) [-3597.023] (-3596.539) (-3591.488) * (-3596.881) [-3602.583] (-3596.300) (-3597.017) -- 0:08:34 27000 -- (-3596.039) (-3597.807) [-3592.955] (-3594.537) * (-3602.936) [-3593.513] (-3597.231) (-3591.461) -- 0:08:24 27500 -- (-3603.757) [-3595.904] (-3590.492) (-3590.498) * [-3591.281] (-3592.056) (-3600.491) (-3599.218) -- 0:08:15 28000 -- (-3600.986) (-3596.724) [-3602.791] (-3598.089) * (-3597.400) (-3600.316) (-3595.728) [-3590.715] -- 0:08:06 28500 -- (-3604.878) (-3590.682) (-3600.288) [-3590.891] * [-3598.952] (-3593.664) (-3602.662) (-3596.947) -- 0:08:31 29000 -- (-3600.229) [-3589.262] (-3596.178) (-3588.092) * [-3596.282] (-3596.891) (-3598.897) (-3597.748) -- 0:08:22 29500 -- (-3597.548) (-3601.947) (-3588.408) [-3596.641] * (-3596.877) [-3596.676] (-3611.877) (-3598.296) -- 0:08:13 30000 -- (-3603.215) (-3591.665) [-3595.608] (-3595.589) * (-3601.252) (-3598.897) [-3604.015] (-3602.520) -- 0:08:05 Average standard deviation of split frequencies: 0.067636 30500 -- (-3603.197) (-3589.637) (-3597.428) [-3604.074] * (-3594.512) [-3594.453] (-3600.664) (-3604.923) -- 0:08:28 31000 -- (-3603.756) (-3594.769) (-3595.499) [-3595.575] * (-3617.578) [-3598.865] (-3593.397) (-3591.462) -- 0:08:20 31500 -- (-3591.738) [-3594.148] (-3593.140) (-3600.076) * (-3606.533) [-3598.696] (-3588.235) (-3594.650) -- 0:08:11 32000 -- (-3604.827) (-3598.540) [-3588.675] (-3592.120) * (-3602.808) [-3598.403] (-3594.683) (-3597.402) -- 0:08:34 32500 -- [-3594.461] (-3595.816) (-3601.923) (-3597.288) * (-3601.136) (-3595.021) (-3590.240) [-3591.874] -- 0:08:26 33000 -- [-3590.711] (-3594.663) (-3590.954) (-3602.591) * (-3602.638) [-3594.418] (-3595.624) (-3591.751) -- 0:08:18 33500 -- (-3608.141) (-3600.376) [-3587.539] (-3596.016) * (-3601.843) [-3597.946] (-3594.352) (-3590.793) -- 0:08:10 34000 -- (-3595.501) (-3594.784) [-3587.888] (-3592.015) * (-3593.874) [-3594.534] (-3596.278) (-3593.888) -- 0:08:31 34500 -- (-3597.395) (-3597.313) [-3591.289] (-3592.380) * [-3603.234] (-3592.629) (-3594.201) (-3602.277) -- 0:08:23 35000 -- [-3590.591] (-3597.151) (-3601.262) (-3595.538) * (-3597.884) [-3594.619] (-3600.218) (-3604.110) -- 0:08:16 Average standard deviation of split frequencies: 0.058926 35500 -- (-3594.538) (-3595.129) (-3600.608) [-3593.310] * (-3599.288) (-3596.214) [-3593.834] (-3595.180) -- 0:08:09 36000 -- [-3593.817] (-3602.814) (-3595.696) (-3591.317) * (-3597.631) (-3594.074) [-3595.194] (-3597.119) -- 0:08:28 36500 -- [-3597.688] (-3590.421) (-3603.765) (-3596.241) * (-3605.311) (-3589.983) [-3587.831] (-3599.768) -- 0:08:21 37000 -- [-3596.484] (-3596.090) (-3593.280) (-3592.443) * (-3598.742) [-3590.256] (-3599.884) (-3597.460) -- 0:08:14 37500 -- (-3598.596) [-3595.177] (-3591.693) (-3599.818) * (-3606.462) (-3600.681) (-3593.212) [-3589.823] -- 0:08:07 38000 -- (-3592.760) (-3599.364) (-3593.003) [-3595.750] * [-3592.505] (-3593.530) (-3599.135) (-3594.026) -- 0:08:26 38500 -- (-3604.926) (-3594.981) (-3595.970) [-3593.766] * (-3596.801) (-3599.032) (-3595.813) [-3596.522] -- 0:08:19 39000 -- (-3603.430) (-3592.588) [-3593.012] (-3607.505) * [-3587.838] (-3594.280) (-3603.088) (-3592.925) -- 0:08:12 39500 -- [-3595.016] (-3592.139) (-3588.326) (-3600.568) * (-3605.330) [-3592.144] (-3595.453) (-3592.150) -- 0:08:06 40000 -- (-3599.233) (-3596.898) (-3593.285) [-3594.497] * (-3610.568) [-3590.468] (-3597.611) (-3589.185) -- 0:08:23 Average standard deviation of split frequencies: 0.046368 40500 -- [-3596.556] (-3596.279) (-3593.762) (-3590.776) * [-3593.538] (-3597.027) (-3597.280) (-3598.794) -- 0:08:17 41000 -- (-3599.501) [-3594.479] (-3607.018) (-3595.749) * [-3594.271] (-3593.473) (-3600.257) (-3605.323) -- 0:08:11 41500 -- (-3594.399) [-3591.887] (-3614.441) (-3590.504) * (-3590.344) (-3591.502) [-3595.886] (-3604.685) -- 0:08:28 42000 -- [-3595.545] (-3592.125) (-3603.611) (-3600.007) * (-3592.655) (-3598.946) [-3605.023] (-3598.774) -- 0:08:21 42500 -- (-3600.248) [-3592.496] (-3595.654) (-3605.417) * [-3593.968] (-3590.157) (-3607.100) (-3597.628) -- 0:08:15 43000 -- [-3597.186] (-3610.109) (-3601.206) (-3592.268) * (-3593.415) [-3594.472] (-3596.922) (-3598.720) -- 0:08:09 43500 -- (-3596.347) (-3596.019) (-3602.983) [-3587.582] * (-3609.502) (-3599.748) (-3595.032) [-3598.244] -- 0:08:25 44000 -- (-3601.451) (-3599.876) (-3591.457) [-3591.903] * (-3597.893) (-3596.288) (-3593.324) [-3591.027] -- 0:08:19 44500 -- (-3594.002) [-3595.349] (-3595.753) (-3604.434) * [-3602.381] (-3597.034) (-3594.364) (-3598.704) -- 0:08:13 45000 -- (-3596.390) (-3596.459) [-3588.739] (-3596.254) * [-3595.084] (-3596.808) (-3590.336) (-3601.027) -- 0:08:08 Average standard deviation of split frequencies: 0.024595 45500 -- (-3600.013) (-3602.796) (-3596.977) [-3597.354] * (-3594.438) (-3591.898) [-3587.036] (-3600.098) -- 0:08:23 46000 -- (-3608.260) (-3602.236) (-3590.064) [-3592.987] * (-3595.872) (-3593.795) [-3588.789] (-3600.594) -- 0:08:17 46500 -- (-3597.595) (-3600.437) (-3604.450) [-3595.264] * (-3593.524) [-3593.192] (-3597.843) (-3601.514) -- 0:08:12 47000 -- (-3607.909) [-3593.697] (-3598.853) (-3605.804) * (-3589.322) (-3595.641) (-3597.928) [-3593.835] -- 0:08:06 47500 -- (-3610.218) (-3602.894) (-3599.428) [-3600.859] * (-3591.825) (-3593.178) (-3600.588) [-3593.162] -- 0:08:21 48000 -- (-3600.237) [-3596.675] (-3607.169) (-3593.219) * (-3590.433) (-3588.843) (-3596.642) [-3595.639] -- 0:08:15 48500 -- (-3593.071) (-3600.018) (-3596.953) [-3602.721] * (-3599.589) (-3594.058) (-3595.292) [-3593.155] -- 0:08:10 49000 -- [-3598.923] (-3599.656) (-3597.765) (-3595.136) * (-3595.670) (-3606.959) (-3592.013) [-3591.651] -- 0:08:05 49500 -- (-3596.343) (-3595.695) (-3603.271) [-3594.640] * (-3592.182) (-3602.189) [-3592.365] (-3591.470) -- 0:08:19 50000 -- (-3596.928) (-3598.032) (-3607.967) [-3603.155] * (-3609.652) (-3598.082) [-3599.532] (-3599.785) -- 0:08:13 Average standard deviation of split frequencies: 0.016747 50500 -- [-3594.749] (-3589.496) (-3592.768) (-3598.967) * (-3609.314) (-3599.758) [-3587.866] (-3595.155) -- 0:08:08 51000 -- (-3604.335) [-3593.541] (-3599.021) (-3589.665) * (-3602.423) (-3591.740) [-3594.997] (-3597.560) -- 0:08:03 51500 -- (-3590.409) [-3595.562] (-3594.142) (-3607.001) * (-3599.263) (-3600.163) (-3595.410) [-3590.618] -- 0:08:17 52000 -- (-3594.282) (-3602.262) (-3594.840) [-3596.889] * (-3598.222) (-3589.663) [-3594.771] (-3596.207) -- 0:08:12 52500 -- [-3597.848] (-3596.330) (-3598.335) (-3593.837) * (-3594.571) [-3586.274] (-3587.656) (-3594.460) -- 0:08:07 53000 -- (-3601.415) [-3591.224] (-3603.107) (-3587.364) * (-3596.745) [-3594.722] (-3602.728) (-3596.949) -- 0:08:20 53500 -- [-3592.667] (-3611.649) (-3599.952) (-3599.664) * (-3597.524) (-3598.023) [-3589.086] (-3592.698) -- 0:08:15 54000 -- (-3601.272) (-3600.379) (-3591.393) [-3591.236] * (-3602.290) [-3588.637] (-3598.668) (-3600.139) -- 0:08:10 54500 -- (-3603.202) (-3588.558) [-3588.681] (-3598.832) * (-3590.461) [-3589.880] (-3605.480) (-3589.148) -- 0:08:05 55000 -- [-3588.547] (-3593.733) (-3598.455) (-3593.954) * (-3597.781) (-3588.974) [-3595.861] (-3590.943) -- 0:08:18 Average standard deviation of split frequencies: 0.012627 55500 -- [-3590.347] (-3593.324) (-3603.251) (-3595.059) * [-3594.100] (-3592.910) (-3593.531) (-3598.276) -- 0:08:13 56000 -- [-3594.875] (-3587.488) (-3603.465) (-3601.512) * (-3597.348) [-3594.449] (-3587.690) (-3594.947) -- 0:08:08 56500 -- [-3597.404] (-3589.325) (-3600.840) (-3601.220) * (-3594.611) [-3593.705] (-3592.098) (-3595.008) -- 0:08:04 57000 -- (-3599.895) [-3590.707] (-3600.778) (-3589.137) * (-3590.784) (-3598.365) (-3596.169) [-3600.258] -- 0:08:16 57500 -- (-3606.557) (-3594.956) (-3604.077) [-3599.479] * [-3591.630] (-3595.245) (-3593.692) (-3605.622) -- 0:08:11 58000 -- (-3597.472) [-3591.387] (-3595.948) (-3604.889) * (-3592.589) (-3599.014) (-3597.775) [-3590.797] -- 0:08:07 58500 -- (-3597.369) (-3588.932) (-3600.562) [-3600.400] * [-3600.846] (-3599.405) (-3596.573) (-3598.631) -- 0:08:02 59000 -- (-3598.498) (-3598.010) (-3604.569) [-3594.709] * (-3594.723) (-3604.566) [-3589.788] (-3600.721) -- 0:08:14 59500 -- [-3597.889] (-3602.643) (-3593.942) (-3588.388) * [-3596.347] (-3597.033) (-3595.239) (-3597.553) -- 0:08:10 60000 -- (-3600.563) (-3596.537) [-3596.752] (-3593.690) * (-3594.716) (-3591.760) [-3588.598] (-3598.617) -- 0:08:05 Average standard deviation of split frequencies: 0.013987 60500 -- (-3588.716) [-3598.055] (-3611.346) (-3597.277) * (-3596.615) (-3602.553) [-3592.333] (-3601.695) -- 0:08:01 61000 -- (-3602.620) [-3597.035] (-3596.841) (-3587.915) * (-3598.681) (-3594.452) (-3596.390) [-3599.889] -- 0:08:12 61500 -- (-3593.280) (-3590.878) (-3603.335) [-3597.551] * [-3590.499] (-3611.128) (-3590.670) (-3597.026) -- 0:08:08 62000 -- [-3591.797] (-3597.050) (-3597.533) (-3605.628) * [-3591.773] (-3601.355) (-3600.340) (-3607.428) -- 0:08:04 62500 -- [-3591.554] (-3603.045) (-3599.836) (-3597.021) * (-3598.008) [-3592.106] (-3588.560) (-3597.041) -- 0:08:15 63000 -- (-3595.979) (-3597.659) (-3596.917) [-3594.656] * (-3597.164) (-3594.964) [-3596.826] (-3598.229) -- 0:08:10 63500 -- [-3594.742] (-3592.716) (-3600.648) (-3596.339) * (-3593.029) (-3600.232) (-3596.170) [-3603.870] -- 0:08:06 64000 -- (-3595.805) (-3595.729) [-3592.477] (-3601.072) * (-3593.021) (-3601.100) [-3595.438] (-3604.193) -- 0:08:02 64500 -- (-3601.474) (-3593.753) (-3594.288) [-3593.908] * [-3591.687] (-3597.148) (-3590.758) (-3591.539) -- 0:08:13 65000 -- (-3594.184) (-3605.775) (-3585.541) [-3590.393] * (-3599.809) (-3593.441) (-3596.897) [-3594.815] -- 0:08:09 Average standard deviation of split frequencies: 0.012142 65500 -- [-3595.340] (-3598.089) (-3592.004) (-3589.321) * (-3598.019) (-3599.721) (-3598.238) [-3587.941] -- 0:08:05 66000 -- [-3591.535] (-3600.211) (-3591.916) (-3595.208) * [-3595.392] (-3600.627) (-3590.191) (-3596.023) -- 0:08:01 66500 -- [-3595.836] (-3597.174) (-3596.631) (-3597.161) * (-3598.685) (-3599.595) (-3597.151) [-3592.283] -- 0:08:11 67000 -- (-3598.596) (-3602.376) (-3604.154) [-3595.406] * (-3599.142) (-3596.995) (-3594.852) [-3600.975] -- 0:08:07 67500 -- [-3596.955] (-3600.066) (-3598.266) (-3594.861) * (-3602.784) (-3590.388) (-3597.793) [-3595.706] -- 0:08:03 68000 -- (-3600.016) [-3590.812] (-3606.636) (-3604.159) * (-3601.679) (-3597.655) (-3600.852) [-3597.093] -- 0:07:59 68500 -- (-3601.601) (-3594.547) (-3597.954) [-3588.336] * (-3594.186) [-3588.258] (-3590.856) (-3610.325) -- 0:08:09 69000 -- [-3599.626] (-3595.220) (-3590.581) (-3590.823) * (-3593.933) [-3597.648] (-3603.184) (-3601.675) -- 0:08:05 69500 -- (-3593.227) (-3600.643) [-3593.202] (-3596.075) * (-3596.058) (-3598.876) (-3596.457) [-3592.548] -- 0:08:01 70000 -- (-3593.682) (-3591.722) [-3594.510] (-3598.991) * (-3592.558) (-3594.880) (-3608.137) [-3588.941] -- 0:08:11 Average standard deviation of split frequencies: 0.014009 70500 -- (-3595.548) [-3592.439] (-3595.606) (-3599.478) * (-3588.937) [-3584.948] (-3595.231) (-3592.471) -- 0:08:07 71000 -- (-3590.401) (-3596.961) (-3596.688) [-3604.722] * (-3594.202) (-3595.969) [-3600.480] (-3596.711) -- 0:08:04 71500 -- (-3599.554) [-3591.215] (-3596.924) (-3592.134) * (-3598.159) (-3604.995) (-3600.706) [-3594.367] -- 0:08:00 72000 -- (-3604.546) [-3590.316] (-3589.877) (-3594.648) * (-3603.434) (-3598.002) [-3591.282] (-3593.199) -- 0:08:09 72500 -- (-3594.035) [-3595.245] (-3592.554) (-3605.714) * (-3596.550) (-3603.123) (-3585.113) [-3590.467] -- 0:08:06 73000 -- (-3598.849) [-3597.432] (-3593.979) (-3600.463) * (-3593.327) (-3601.853) [-3598.187] (-3590.236) -- 0:08:02 73500 -- (-3597.089) (-3600.786) (-3592.061) [-3603.149] * (-3594.042) (-3598.744) [-3591.442] (-3615.863) -- 0:07:59 74000 -- (-3590.896) (-3603.155) [-3586.752] (-3599.731) * (-3588.519) [-3594.518] (-3596.538) (-3611.744) -- 0:08:08 74500 -- (-3595.531) [-3593.536] (-3601.164) (-3602.830) * (-3589.992) [-3589.754] (-3600.791) (-3599.262) -- 0:08:04 75000 -- (-3596.817) (-3586.211) (-3598.808) [-3590.978] * (-3593.201) (-3595.212) [-3593.779] (-3597.703) -- 0:08:00 Average standard deviation of split frequencies: 0.016127 75500 -- (-3594.786) (-3594.482) [-3593.512] (-3592.832) * (-3588.491) (-3600.241) (-3599.170) [-3592.531] -- 0:07:57 76000 -- (-3600.291) [-3589.976] (-3601.657) (-3601.055) * [-3595.641] (-3604.499) (-3599.584) (-3588.911) -- 0:08:06 76500 -- [-3603.310] (-3596.504) (-3591.575) (-3599.795) * [-3589.704] (-3596.888) (-3592.884) (-3599.513) -- 0:08:02 77000 -- [-3592.220] (-3596.712) (-3598.669) (-3594.833) * (-3597.813) [-3589.857] (-3591.499) (-3591.093) -- 0:07:59 77500 -- (-3597.540) (-3596.087) (-3587.498) [-3602.457] * (-3592.733) (-3593.693) (-3598.596) [-3595.906] -- 0:07:56 78000 -- (-3597.770) (-3598.546) [-3600.239] (-3597.018) * (-3596.409) (-3597.892) [-3591.831] (-3598.327) -- 0:08:04 78500 -- [-3595.902] (-3617.496) (-3596.345) (-3594.996) * (-3614.046) (-3599.917) [-3589.841] (-3598.476) -- 0:08:01 79000 -- (-3587.174) (-3606.030) (-3599.036) [-3594.047] * [-3597.582] (-3594.474) (-3591.890) (-3593.387) -- 0:07:57 79500 -- (-3600.625) [-3600.740] (-3595.425) (-3597.073) * [-3597.050] (-3591.583) (-3589.016) (-3605.947) -- 0:08:06 80000 -- (-3593.456) [-3609.476] (-3604.269) (-3596.684) * (-3590.692) (-3595.419) [-3595.670] (-3593.179) -- 0:08:02 Average standard deviation of split frequencies: 0.013441 80500 -- (-3594.022) [-3601.257] (-3596.329) (-3600.122) * [-3597.026] (-3597.064) (-3603.615) (-3590.157) -- 0:07:59 81000 -- (-3590.664) (-3605.008) [-3594.527] (-3594.631) * (-3594.340) [-3592.238] (-3594.720) (-3589.676) -- 0:07:56 81500 -- (-3590.342) (-3607.528) [-3595.472] (-3593.253) * (-3598.300) (-3599.220) [-3596.700] (-3595.608) -- 0:08:04 82000 -- (-3595.535) (-3606.884) [-3587.655] (-3598.804) * [-3597.766] (-3589.925) (-3597.329) (-3593.426) -- 0:08:01 82500 -- (-3592.468) [-3604.738] (-3599.472) (-3596.444) * (-3609.079) (-3594.359) [-3590.180] (-3594.980) -- 0:07:58 83000 -- (-3597.165) [-3602.206] (-3597.552) (-3601.297) * (-3608.028) [-3598.949] (-3592.484) (-3596.691) -- 0:07:55 83500 -- [-3597.690] (-3603.074) (-3596.338) (-3596.899) * (-3600.616) [-3592.588] (-3593.440) (-3591.325) -- 0:08:02 84000 -- (-3599.905) [-3590.073] (-3606.690) (-3601.851) * (-3601.256) (-3596.708) [-3599.879] (-3596.770) -- 0:07:59 84500 -- (-3599.160) [-3594.232] (-3599.533) (-3600.263) * [-3599.868] (-3599.853) (-3605.052) (-3593.145) -- 0:07:56 85000 -- (-3604.337) [-3600.415] (-3593.465) (-3595.149) * [-3596.360] (-3592.600) (-3595.007) (-3591.134) -- 0:07:53 Average standard deviation of split frequencies: 0.013704 85500 -- (-3596.133) [-3593.500] (-3597.073) (-3591.129) * (-3591.509) [-3602.637] (-3597.923) (-3588.864) -- 0:08:01 86000 -- [-3595.736] (-3592.802) (-3598.953) (-3598.828) * (-3593.024) [-3591.706] (-3604.853) (-3592.756) -- 0:07:58 86500 -- (-3594.907) (-3586.208) (-3607.711) [-3604.794] * (-3596.779) [-3592.665] (-3597.224) (-3603.608) -- 0:07:55 87000 -- (-3602.485) (-3598.669) (-3608.233) [-3596.736] * (-3600.922) (-3597.793) (-3596.606) [-3595.842] -- 0:07:52 87500 -- (-3596.131) (-3601.006) (-3595.091) [-3591.079] * (-3606.923) [-3587.003] (-3594.867) (-3593.092) -- 0:07:59 88000 -- [-3599.094] (-3594.170) (-3608.746) (-3592.644) * [-3592.391] (-3594.636) (-3599.091) (-3597.811) -- 0:07:56 88500 -- [-3599.681] (-3598.720) (-3607.695) (-3597.364) * (-3597.673) (-3590.345) [-3601.182] (-3594.583) -- 0:07:53 89000 -- [-3597.320] (-3596.879) (-3611.206) (-3593.541) * [-3590.067] (-3599.503) (-3597.640) (-3594.213) -- 0:07:50 89500 -- (-3607.947) [-3594.621] (-3603.956) (-3603.270) * [-3592.275] (-3589.444) (-3595.721) (-3591.042) -- 0:07:58 90000 -- [-3601.754] (-3599.179) (-3608.191) (-3601.587) * (-3600.308) (-3590.636) (-3598.838) [-3589.461] -- 0:07:55 Average standard deviation of split frequencies: 0.012478 90500 -- (-3595.677) (-3592.878) (-3599.910) [-3601.711] * (-3596.440) (-3590.828) (-3597.968) [-3586.450] -- 0:07:52 91000 -- (-3602.455) [-3591.109] (-3589.997) (-3595.234) * (-3593.917) (-3594.814) [-3590.435] (-3601.585) -- 0:07:59 91500 -- [-3594.527] (-3599.194) (-3599.950) (-3597.627) * (-3594.361) (-3595.533) [-3588.700] (-3590.441) -- 0:07:56 92000 -- [-3598.992] (-3602.664) (-3595.988) (-3612.530) * (-3608.639) (-3593.168) (-3597.148) [-3589.210] -- 0:07:53 92500 -- (-3599.858) (-3593.160) [-3594.208] (-3598.627) * (-3599.815) (-3596.831) [-3590.823] (-3602.295) -- 0:07:50 93000 -- (-3593.416) (-3596.847) (-3600.086) [-3596.139] * (-3607.437) [-3594.977] (-3595.789) (-3589.188) -- 0:07:57 93500 -- (-3588.249) (-3597.800) (-3602.400) [-3597.964] * (-3599.792) (-3593.642) [-3599.860] (-3602.929) -- 0:07:55 94000 -- (-3597.807) (-3593.702) (-3597.309) [-3595.309] * (-3596.163) (-3596.875) (-3598.315) [-3594.260] -- 0:07:52 94500 -- [-3599.840] (-3600.023) (-3600.178) (-3599.259) * (-3592.652) (-3603.363) [-3599.114] (-3589.392) -- 0:07:49 95000 -- (-3597.777) (-3605.465) (-3600.386) [-3591.327] * (-3586.309) (-3597.685) [-3592.130] (-3597.601) -- 0:07:56 Average standard deviation of split frequencies: 0.011785 95500 -- [-3598.681] (-3593.888) (-3607.259) (-3596.260) * [-3587.923] (-3602.824) (-3596.510) (-3594.173) -- 0:07:53 96000 -- (-3599.004) (-3593.410) [-3593.242] (-3594.806) * [-3594.411] (-3596.411) (-3596.871) (-3590.718) -- 0:07:50 96500 -- (-3596.244) (-3596.855) [-3590.195] (-3597.933) * (-3597.703) (-3593.098) [-3597.116] (-3604.939) -- 0:07:48 97000 -- (-3597.905) (-3590.401) [-3598.177] (-3594.851) * (-3597.156) (-3596.477) [-3592.460] (-3590.496) -- 0:07:54 97500 -- [-3595.316] (-3596.513) (-3605.122) (-3605.143) * (-3594.351) (-3602.495) [-3595.013] (-3591.994) -- 0:07:52 98000 -- (-3590.796) (-3596.648) [-3591.206] (-3592.374) * [-3599.615] (-3594.584) (-3589.598) (-3598.639) -- 0:07:49 98500 -- (-3601.153) (-3595.271) [-3589.834] (-3591.800) * (-3600.532) (-3588.694) [-3592.420] (-3590.633) -- 0:07:46 99000 -- (-3595.288) (-3595.415) (-3601.686) [-3592.888] * [-3587.644] (-3591.365) (-3594.256) (-3594.771) -- 0:07:53 99500 -- (-3590.927) [-3596.629] (-3603.284) (-3602.930) * (-3587.234) (-3596.008) (-3590.531) [-3588.486] -- 0:07:50 100000 -- [-3596.904] (-3594.105) (-3592.786) (-3600.619) * [-3592.796] (-3596.488) (-3594.358) (-3592.815) -- 0:07:47 Average standard deviation of split frequencies: 0.016858 100500 -- (-3592.270) [-3600.569] (-3609.482) (-3590.498) * (-3595.923) (-3593.224) [-3591.738] (-3604.336) -- 0:07:54 101000 -- [-3590.582] (-3594.364) (-3602.090) (-3597.964) * (-3599.990) (-3596.630) (-3592.609) [-3593.244] -- 0:07:51 101500 -- (-3597.138) (-3591.847) (-3592.429) [-3604.271] * (-3590.984) (-3594.186) (-3592.401) [-3595.227] -- 0:07:49 102000 -- (-3604.033) [-3597.093] (-3595.331) (-3596.850) * (-3594.232) (-3595.827) (-3593.938) [-3591.819] -- 0:07:46 102500 -- (-3590.939) (-3591.398) [-3593.596] (-3592.314) * (-3594.137) (-3588.638) [-3598.149] (-3596.027) -- 0:07:52 103000 -- (-3600.417) (-3597.677) [-3599.504] (-3592.374) * [-3593.373] (-3593.750) (-3605.879) (-3601.339) -- 0:07:50 103500 -- [-3600.481] (-3594.138) (-3596.911) (-3597.401) * (-3596.183) (-3597.750) (-3593.993) [-3594.619] -- 0:07:47 104000 -- (-3590.900) (-3596.660) [-3597.595] (-3595.437) * (-3593.986) (-3593.387) [-3593.287] (-3597.131) -- 0:07:45 104500 -- (-3598.215) (-3593.044) (-3595.097) [-3592.493] * (-3600.888) [-3597.159] (-3592.839) (-3593.027) -- 0:07:51 105000 -- (-3590.223) (-3590.936) (-3601.672) [-3597.331] * (-3603.607) [-3591.021] (-3602.679) (-3592.065) -- 0:07:48 Average standard deviation of split frequencies: 0.014676 105500 -- (-3588.811) (-3589.238) [-3590.818] (-3592.750) * (-3593.740) [-3596.815] (-3597.613) (-3588.928) -- 0:07:46 106000 -- (-3606.457) [-3596.598] (-3596.244) (-3599.493) * (-3596.857) (-3590.434) (-3599.496) [-3587.865] -- 0:07:43 106500 -- (-3601.077) [-3595.719] (-3601.893) (-3590.485) * (-3605.446) (-3591.531) (-3589.102) [-3588.926] -- 0:07:49 107000 -- [-3600.939] (-3597.760) (-3594.464) (-3593.357) * (-3599.638) (-3598.625) (-3592.594) [-3589.341] -- 0:07:47 107500 -- (-3592.117) [-3593.563] (-3600.929) (-3605.363) * (-3601.788) (-3601.878) [-3594.204] (-3594.061) -- 0:07:44 108000 -- (-3588.977) [-3593.341] (-3601.829) (-3606.093) * (-3597.136) (-3593.276) (-3597.415) [-3596.105] -- 0:07:42 108500 -- [-3589.758] (-3594.261) (-3600.755) (-3589.771) * (-3587.758) [-3590.825] (-3601.646) (-3592.782) -- 0:07:48 109000 -- (-3588.736) (-3593.222) [-3603.298] (-3599.148) * (-3595.063) [-3593.342] (-3592.479) (-3593.816) -- 0:07:45 109500 -- (-3594.159) (-3596.008) [-3590.703] (-3597.322) * [-3590.315] (-3596.691) (-3590.799) (-3595.791) -- 0:07:43 110000 -- [-3593.449] (-3601.393) (-3599.053) (-3594.352) * (-3599.318) (-3595.781) (-3594.379) [-3595.821] -- 0:07:41 Average standard deviation of split frequencies: 0.013631 110500 -- (-3594.369) (-3600.189) [-3590.778] (-3593.211) * [-3588.149] (-3594.823) (-3595.162) (-3588.174) -- 0:07:46 111000 -- [-3597.377] (-3597.238) (-3593.123) (-3603.575) * (-3593.864) (-3603.609) (-3597.166) [-3590.210] -- 0:07:44 111500 -- [-3592.279] (-3596.170) (-3588.955) (-3599.687) * (-3590.018) [-3601.878] (-3596.366) (-3587.675) -- 0:07:42 112000 -- [-3593.042] (-3604.412) (-3590.745) (-3595.648) * (-3595.042) (-3598.162) (-3598.624) [-3598.092] -- 0:07:47 112500 -- (-3600.775) [-3593.552] (-3589.536) (-3594.935) * (-3602.281) (-3599.870) [-3593.577] (-3597.612) -- 0:07:45 113000 -- (-3592.398) [-3590.112] (-3607.748) (-3593.590) * (-3610.398) (-3588.543) (-3590.422) [-3593.059] -- 0:07:43 113500 -- [-3594.124] (-3592.103) (-3599.255) (-3600.670) * (-3600.100) [-3592.537] (-3587.105) (-3598.936) -- 0:07:40 114000 -- [-3589.862] (-3595.272) (-3599.756) (-3602.592) * (-3596.171) [-3592.117] (-3601.345) (-3605.887) -- 0:07:46 114500 -- (-3592.893) [-3589.218] (-3597.586) (-3600.368) * (-3597.758) [-3592.234] (-3606.093) (-3588.127) -- 0:07:44 115000 -- [-3589.339] (-3598.477) (-3595.678) (-3598.593) * [-3592.784] (-3588.625) (-3594.954) (-3590.521) -- 0:07:41 Average standard deviation of split frequencies: 0.019506 115500 -- (-3594.445) [-3589.822] (-3597.575) (-3601.556) * [-3591.035] (-3598.505) (-3593.982) (-3601.629) -- 0:07:39 116000 -- (-3589.605) (-3588.952) (-3595.747) [-3588.508] * (-3601.966) [-3598.244] (-3593.452) (-3599.601) -- 0:07:44 116500 -- (-3596.856) (-3594.030) (-3592.326) [-3600.090] * (-3598.921) [-3600.452] (-3606.701) (-3600.406) -- 0:07:42 117000 -- [-3593.653] (-3598.670) (-3591.509) (-3597.826) * (-3601.177) (-3603.576) [-3592.653] (-3599.538) -- 0:07:40 117500 -- (-3594.766) (-3596.540) [-3591.950] (-3590.148) * (-3599.745) (-3597.906) [-3601.485] (-3592.888) -- 0:07:38 118000 -- (-3601.955) (-3589.745) [-3589.193] (-3594.749) * [-3592.074] (-3596.475) (-3596.335) (-3599.830) -- 0:07:43 118500 -- (-3607.095) [-3605.110] (-3609.962) (-3593.954) * (-3591.852) (-3598.724) [-3602.583] (-3598.614) -- 0:07:41 119000 -- (-3596.683) (-3608.878) [-3592.315] (-3601.291) * (-3589.991) (-3599.142) [-3586.782] (-3591.870) -- 0:07:39 119500 -- (-3598.792) (-3601.573) [-3596.887] (-3595.166) * (-3589.553) (-3599.888) [-3595.290] (-3592.069) -- 0:07:36 120000 -- [-3598.046] (-3605.342) (-3590.048) (-3599.508) * (-3597.277) (-3592.341) (-3591.691) [-3596.498] -- 0:07:41 Average standard deviation of split frequencies: 0.017971 120500 -- [-3594.356] (-3597.738) (-3591.609) (-3599.425) * (-3596.180) [-3593.589] (-3591.085) (-3592.004) -- 0:07:39 121000 -- (-3590.881) (-3604.930) [-3594.696] (-3596.550) * (-3595.843) (-3591.127) (-3586.824) [-3593.015] -- 0:07:37 121500 -- [-3594.412] (-3606.323) (-3600.089) (-3594.098) * (-3595.331) [-3588.232] (-3590.599) (-3592.520) -- 0:07:35 122000 -- (-3601.329) [-3592.286] (-3597.566) (-3594.073) * (-3595.393) (-3592.452) [-3590.423] (-3591.984) -- 0:07:40 122500 -- (-3591.792) (-3600.806) (-3605.065) [-3605.900] * [-3593.253] (-3598.235) (-3609.122) (-3599.733) -- 0:07:38 123000 -- [-3595.434] (-3602.749) (-3594.335) (-3591.411) * (-3597.633) (-3588.196) [-3598.444] (-3601.464) -- 0:07:36 123500 -- [-3594.410] (-3599.589) (-3595.159) (-3605.344) * (-3608.797) (-3588.447) [-3603.568] (-3605.214) -- 0:07:41 124000 -- [-3593.260] (-3595.115) (-3593.219) (-3592.482) * [-3595.656] (-3598.144) (-3596.314) (-3593.623) -- 0:07:39 124500 -- (-3596.758) (-3593.142) [-3589.141] (-3599.198) * [-3591.137] (-3597.699) (-3600.953) (-3597.804) -- 0:07:37 125000 -- (-3603.565) [-3587.731] (-3603.825) (-3607.718) * (-3604.790) [-3596.725] (-3600.055) (-3592.213) -- 0:07:34 Average standard deviation of split frequencies: 0.010850 125500 -- (-3600.572) [-3587.942] (-3606.370) (-3594.766) * (-3597.712) (-3588.966) [-3587.878] (-3592.211) -- 0:07:39 126000 -- (-3594.919) [-3597.339] (-3596.665) (-3587.299) * (-3607.058) (-3600.194) [-3594.153] (-3594.579) -- 0:07:37 126500 -- (-3594.378) [-3592.108] (-3592.914) (-3594.014) * (-3594.913) (-3601.446) (-3601.823) [-3593.185] -- 0:07:35 127000 -- [-3598.879] (-3589.252) (-3596.523) (-3593.934) * [-3596.385] (-3617.823) (-3591.260) (-3594.698) -- 0:07:33 127500 -- (-3591.790) [-3592.932] (-3609.748) (-3593.425) * (-3590.732) (-3606.172) [-3594.464] (-3601.152) -- 0:07:38 128000 -- (-3592.353) [-3591.309] (-3596.663) (-3595.257) * (-3595.579) (-3613.287) [-3596.650] (-3597.943) -- 0:07:36 128500 -- (-3596.912) (-3592.339) [-3590.724] (-3599.142) * (-3594.410) (-3601.743) [-3590.200] (-3607.105) -- 0:07:34 129000 -- (-3601.721) [-3592.073] (-3593.330) (-3595.261) * (-3596.969) [-3593.494] (-3599.448) (-3605.558) -- 0:07:32 129500 -- (-3597.955) (-3599.852) [-3593.826] (-3589.482) * [-3604.700] (-3607.129) (-3597.318) (-3601.294) -- 0:07:37 130000 -- [-3593.633] (-3596.847) (-3591.992) (-3598.990) * (-3608.283) (-3594.729) [-3590.585] (-3602.229) -- 0:07:35 Average standard deviation of split frequencies: 0.010102 130500 -- [-3594.049] (-3599.905) (-3594.190) (-3596.684) * (-3600.884) (-3610.767) (-3592.859) [-3600.491] -- 0:07:33 131000 -- [-3596.761] (-3592.749) (-3595.156) (-3603.427) * (-3592.268) (-3594.186) (-3590.987) [-3590.979] -- 0:07:31 131500 -- (-3593.794) [-3597.090] (-3593.545) (-3594.557) * (-3610.634) (-3598.975) [-3600.135] (-3590.894) -- 0:07:35 132000 -- (-3599.477) (-3591.352) [-3589.366] (-3598.868) * (-3600.871) [-3589.153] (-3608.509) (-3594.077) -- 0:07:33 132500 -- [-3591.957] (-3592.611) (-3587.930) (-3603.468) * (-3596.321) [-3602.937] (-3590.900) (-3593.218) -- 0:07:31 133000 -- (-3591.155) (-3594.120) [-3585.487] (-3593.936) * (-3604.254) (-3605.296) [-3595.693] (-3593.603) -- 0:07:29 133500 -- [-3588.892] (-3588.958) (-3599.831) (-3610.184) * (-3602.604) (-3597.836) [-3595.843] (-3589.924) -- 0:07:34 134000 -- (-3595.577) (-3595.745) (-3593.636) [-3602.504] * [-3596.596] (-3593.419) (-3605.985) (-3597.790) -- 0:07:32 134500 -- (-3600.027) [-3595.979] (-3597.069) (-3597.435) * (-3596.659) [-3589.235] (-3599.670) (-3596.689) -- 0:07:30 135000 -- (-3592.505) [-3587.528] (-3589.974) (-3591.668) * (-3609.155) [-3599.307] (-3600.224) (-3595.751) -- 0:07:34 Average standard deviation of split frequencies: 0.012478 135500 -- (-3593.735) (-3598.947) (-3595.707) [-3595.214] * (-3596.186) (-3601.540) (-3598.094) [-3596.627] -- 0:07:32 136000 -- (-3599.553) (-3593.395) (-3596.563) [-3589.448] * (-3595.275) (-3614.393) [-3589.962] (-3608.738) -- 0:07:31 136500 -- (-3590.052) (-3593.777) (-3612.687) [-3594.624] * (-3592.220) (-3594.947) (-3597.266) [-3594.131] -- 0:07:29 137000 -- (-3602.217) [-3599.522] (-3611.172) (-3600.843) * [-3595.429] (-3592.469) (-3591.094) (-3590.007) -- 0:07:33 137500 -- (-3592.714) [-3593.208] (-3604.603) (-3593.531) * (-3596.089) (-3595.070) (-3594.445) [-3601.164] -- 0:07:31 138000 -- (-3604.651) [-3595.548] (-3603.019) (-3597.737) * (-3594.586) (-3601.242) [-3586.968] (-3593.957) -- 0:07:29 138500 -- (-3598.002) [-3591.918] (-3597.927) (-3593.172) * [-3593.101] (-3598.969) (-3589.257) (-3602.376) -- 0:07:27 139000 -- [-3593.487] (-3594.649) (-3591.273) (-3594.666) * (-3592.809) (-3589.466) (-3597.619) [-3599.230] -- 0:07:32 139500 -- (-3592.524) (-3591.863) [-3592.786] (-3590.487) * (-3595.081) (-3604.228) (-3589.553) [-3599.775] -- 0:07:30 140000 -- [-3591.752] (-3596.524) (-3598.513) (-3592.534) * (-3595.638) [-3598.408] (-3598.596) (-3600.867) -- 0:07:28 Average standard deviation of split frequencies: 0.012064 140500 -- (-3594.492) (-3598.632) (-3608.723) [-3590.101] * (-3605.479) (-3593.788) [-3592.160] (-3598.291) -- 0:07:26 141000 -- [-3597.145] (-3590.569) (-3603.931) (-3597.150) * (-3593.818) (-3593.709) (-3596.893) [-3591.136] -- 0:07:30 141500 -- (-3607.086) [-3593.161] (-3596.650) (-3590.662) * [-3600.054] (-3587.773) (-3599.596) (-3587.644) -- 0:07:28 142000 -- (-3593.960) (-3592.838) [-3592.731] (-3595.149) * (-3597.522) [-3585.108] (-3605.629) (-3599.689) -- 0:07:27 142500 -- (-3589.263) [-3588.709] (-3590.009) (-3596.096) * (-3599.729) (-3592.724) [-3590.092] (-3594.884) -- 0:07:25 143000 -- (-3598.131) (-3588.392) (-3605.187) [-3590.403] * (-3591.503) (-3607.115) [-3591.783] (-3593.649) -- 0:07:29 143500 -- (-3598.644) (-3591.112) [-3597.541] (-3597.724) * (-3602.944) [-3593.011] (-3595.709) (-3596.841) -- 0:07:27 144000 -- (-3596.137) (-3598.087) [-3590.393] (-3594.914) * (-3599.712) [-3596.163] (-3598.408) (-3599.013) -- 0:07:25 144500 -- (-3590.264) (-3590.555) [-3593.839] (-3597.921) * (-3599.602) (-3597.179) [-3596.586] (-3596.176) -- 0:07:24 145000 -- [-3591.430] (-3596.170) (-3596.549) (-3596.926) * [-3589.982] (-3592.652) (-3597.920) (-3598.427) -- 0:07:28 Average standard deviation of split frequencies: 0.011301 145500 -- (-3591.476) [-3589.679] (-3599.495) (-3608.241) * [-3592.159] (-3594.706) (-3599.425) (-3592.204) -- 0:07:26 146000 -- (-3596.963) (-3592.311) (-3598.118) [-3594.123] * (-3596.692) (-3591.879) (-3597.313) [-3594.845] -- 0:07:24 146500 -- (-3600.445) (-3603.906) [-3593.706] (-3601.415) * (-3590.222) (-3594.926) (-3601.934) [-3593.375] -- 0:07:28 147000 -- (-3592.922) (-3601.932) (-3596.981) [-3590.780] * (-3597.827) (-3596.515) (-3596.493) [-3599.583] -- 0:07:26 147500 -- [-3590.956] (-3602.829) (-3590.919) (-3595.494) * [-3588.997] (-3598.270) (-3594.439) (-3595.733) -- 0:07:25 148000 -- (-3592.657) [-3595.236] (-3592.418) (-3600.153) * (-3596.444) (-3593.461) [-3597.204] (-3596.392) -- 0:07:23 148500 -- [-3595.786] (-3595.640) (-3609.788) (-3591.719) * [-3595.274] (-3601.659) (-3601.712) (-3597.581) -- 0:07:27 149000 -- (-3591.788) [-3592.142] (-3604.361) (-3597.263) * (-3615.320) (-3592.765) (-3598.506) [-3594.800] -- 0:07:25 149500 -- (-3608.308) [-3595.031] (-3594.581) (-3589.200) * [-3599.928] (-3597.459) (-3600.104) (-3587.547) -- 0:07:23 150000 -- (-3599.726) (-3600.381) (-3601.762) [-3590.023] * [-3595.222] (-3599.635) (-3591.984) (-3590.494) -- 0:07:21 Average standard deviation of split frequencies: 0.010638 150500 -- [-3606.546] (-3605.624) (-3594.409) (-3605.633) * (-3603.791) [-3595.300] (-3609.151) (-3596.798) -- 0:07:25 151000 -- [-3594.570] (-3599.706) (-3599.918) (-3594.312) * (-3602.487) (-3592.425) [-3603.034] (-3599.667) -- 0:07:24 151500 -- (-3590.529) [-3593.380] (-3608.548) (-3596.123) * (-3593.367) (-3591.225) (-3591.380) [-3589.119] -- 0:07:22 152000 -- [-3594.472] (-3610.878) (-3601.686) (-3601.233) * [-3601.002] (-3597.359) (-3592.630) (-3593.544) -- 0:07:20 152500 -- (-3597.755) [-3594.346] (-3595.039) (-3598.210) * (-3594.566) (-3595.934) [-3590.749] (-3595.739) -- 0:07:24 153000 -- [-3597.291] (-3595.556) (-3602.249) (-3593.357) * (-3597.999) (-3602.054) [-3592.704] (-3602.392) -- 0:07:22 153500 -- (-3592.145) (-3594.662) (-3600.030) [-3593.661] * (-3594.311) [-3595.128] (-3605.298) (-3605.227) -- 0:07:21 154000 -- (-3590.732) [-3600.846] (-3597.095) (-3592.145) * [-3594.760] (-3599.336) (-3598.284) (-3596.413) -- 0:07:19 154500 -- (-3591.684) [-3593.800] (-3591.827) (-3592.524) * [-3593.577] (-3598.581) (-3600.295) (-3588.255) -- 0:07:23 155000 -- (-3592.890) [-3594.290] (-3588.145) (-3597.753) * (-3599.553) (-3602.891) [-3592.445] (-3598.361) -- 0:07:21 Average standard deviation of split frequencies: 0.010576 155500 -- (-3592.647) (-3597.624) (-3591.357) [-3591.708] * (-3596.669) (-3601.773) [-3585.274] (-3594.607) -- 0:07:19 156000 -- [-3594.696] (-3594.727) (-3599.263) (-3594.381) * (-3601.700) (-3596.309) (-3586.181) [-3589.864] -- 0:07:18 156500 -- (-3588.648) (-3594.126) (-3588.780) [-3603.484] * (-3602.795) (-3599.021) [-3592.839] (-3599.475) -- 0:07:21 157000 -- (-3603.197) [-3596.633] (-3606.487) (-3601.936) * (-3605.771) (-3602.864) (-3599.705) [-3591.120] -- 0:07:20 157500 -- [-3593.102] (-3597.000) (-3591.779) (-3591.729) * (-3603.157) (-3592.387) (-3591.744) [-3588.756] -- 0:07:18 158000 -- (-3599.535) (-3595.018) [-3588.522] (-3603.269) * (-3600.352) [-3593.807] (-3601.386) (-3593.584) -- 0:07:16 158500 -- (-3594.102) (-3606.994) (-3599.785) [-3592.061] * (-3596.816) [-3589.910] (-3598.445) (-3592.852) -- 0:07:20 159000 -- [-3594.003] (-3594.680) (-3592.277) (-3598.572) * (-3594.787) (-3593.106) [-3596.594] (-3599.114) -- 0:07:19 159500 -- [-3600.694] (-3592.329) (-3601.883) (-3593.153) * (-3601.636) (-3589.445) [-3593.118] (-3596.352) -- 0:07:17 160000 -- (-3600.297) [-3595.613] (-3601.723) (-3600.263) * (-3589.619) (-3601.565) (-3605.109) [-3593.055] -- 0:07:21 Average standard deviation of split frequencies: 0.012030 160500 -- [-3596.600] (-3597.182) (-3592.875) (-3602.628) * [-3600.369] (-3602.244) (-3598.880) (-3596.452) -- 0:07:19 161000 -- (-3591.966) (-3609.793) [-3588.430] (-3597.736) * (-3601.077) (-3596.329) (-3598.855) [-3592.848] -- 0:07:17 161500 -- (-3587.479) [-3598.519] (-3592.326) (-3611.699) * (-3599.212) (-3591.762) [-3593.477] (-3601.818) -- 0:07:16 162000 -- [-3594.067] (-3611.353) (-3600.819) (-3598.421) * (-3587.488) (-3596.770) (-3600.953) [-3592.273] -- 0:07:19 162500 -- (-3590.842) (-3607.817) [-3594.042] (-3608.715) * [-3595.161] (-3600.802) (-3601.118) (-3592.634) -- 0:07:18 163000 -- (-3598.006) [-3598.229] (-3600.056) (-3599.841) * (-3598.780) (-3597.224) [-3599.638] (-3600.566) -- 0:07:16 163500 -- (-3602.081) [-3599.889] (-3600.868) (-3612.554) * (-3596.372) (-3591.007) (-3593.225) [-3593.759] -- 0:07:14 164000 -- (-3598.799) [-3600.804] (-3597.356) (-3591.882) * (-3594.587) (-3599.305) (-3595.303) [-3599.200] -- 0:07:18 164500 -- (-3588.221) (-3596.531) [-3591.360] (-3597.637) * (-3600.408) (-3590.035) (-3597.441) [-3595.357] -- 0:07:16 165000 -- (-3601.461) (-3599.436) (-3596.818) [-3597.272] * [-3598.340] (-3590.640) (-3601.157) (-3598.659) -- 0:07:15 Average standard deviation of split frequencies: 0.013347 165500 -- (-3590.658) (-3593.124) (-3597.013) [-3587.892] * (-3597.044) (-3592.093) (-3594.583) [-3594.057] -- 0:07:13 166000 -- (-3594.789) [-3588.391] (-3594.009) (-3591.759) * (-3591.694) (-3592.611) [-3591.484] (-3598.669) -- 0:07:17 166500 -- (-3601.197) (-3593.028) [-3598.044] (-3595.003) * (-3595.200) (-3599.833) [-3591.778] (-3590.700) -- 0:07:15 167000 -- (-3597.746) (-3604.496) [-3590.955] (-3588.438) * (-3600.063) (-3601.278) (-3593.127) [-3590.823] -- 0:07:13 167500 -- [-3593.089] (-3599.902) (-3599.690) (-3597.998) * (-3597.978) [-3593.944] (-3594.060) (-3595.990) -- 0:07:12 168000 -- [-3598.858] (-3603.072) (-3599.496) (-3601.672) * (-3595.380) [-3590.799] (-3589.274) (-3597.185) -- 0:07:15 168500 -- (-3599.785) (-3598.386) [-3592.279] (-3604.010) * (-3588.552) (-3594.098) [-3596.577] (-3594.938) -- 0:07:14 169000 -- (-3604.413) [-3590.950] (-3594.261) (-3600.737) * [-3590.876] (-3587.532) (-3600.196) (-3603.083) -- 0:07:12 169500 -- (-3598.428) (-3589.557) (-3603.158) [-3590.212] * (-3595.538) [-3591.417] (-3593.543) (-3602.174) -- 0:07:11 170000 -- [-3596.814] (-3599.743) (-3600.201) (-3602.020) * (-3599.976) [-3590.950] (-3596.198) (-3606.898) -- 0:07:14 Average standard deviation of split frequencies: 0.012982 170500 -- [-3597.688] (-3592.361) (-3594.013) (-3603.123) * (-3593.514) (-3592.604) [-3589.754] (-3602.520) -- 0:07:12 171000 -- (-3594.573) (-3598.085) [-3591.364] (-3595.959) * (-3601.300) (-3599.206) (-3593.514) [-3589.206] -- 0:07:11 171500 -- [-3598.706] (-3596.160) (-3594.333) (-3595.269) * (-3601.259) (-3599.342) [-3597.346] (-3599.047) -- 0:07:09 172000 -- (-3590.637) (-3598.605) [-3601.062] (-3597.979) * (-3596.599) (-3598.697) (-3594.167) [-3598.583] -- 0:07:13 172500 -- (-3593.508) [-3589.375] (-3594.951) (-3595.697) * (-3598.022) [-3590.672] (-3595.272) (-3589.990) -- 0:07:11 173000 -- (-3599.272) (-3595.854) (-3593.762) [-3597.300] * (-3592.876) (-3603.640) (-3596.877) [-3592.373] -- 0:07:10 173500 -- [-3592.867] (-3596.749) (-3599.687) (-3603.597) * (-3592.988) (-3606.429) [-3589.631] (-3597.223) -- 0:07:08 174000 -- (-3597.523) [-3599.643] (-3597.771) (-3598.328) * (-3594.007) (-3603.938) (-3596.244) [-3594.120] -- 0:07:11 174500 -- (-3595.599) (-3595.480) (-3594.707) [-3588.708] * (-3596.026) [-3597.389] (-3590.298) (-3588.862) -- 0:07:10 175000 -- [-3596.378] (-3594.733) (-3590.286) (-3588.856) * (-3591.399) (-3600.765) [-3597.753] (-3590.878) -- 0:07:08 Average standard deviation of split frequencies: 0.012856 175500 -- (-3594.242) (-3597.253) (-3604.969) [-3596.558] * (-3595.560) (-3608.746) (-3595.943) [-3605.718] -- 0:07:12 176000 -- [-3598.115] (-3589.926) (-3590.764) (-3592.805) * [-3605.634] (-3597.924) (-3586.082) (-3601.396) -- 0:07:10 176500 -- [-3591.143] (-3606.448) (-3596.337) (-3592.510) * (-3603.957) [-3596.465] (-3595.038) (-3590.475) -- 0:07:09 177000 -- (-3597.172) (-3599.805) [-3589.534] (-3599.209) * (-3601.898) (-3587.969) (-3595.812) [-3588.274] -- 0:07:07 177500 -- [-3592.782] (-3598.789) (-3602.268) (-3597.409) * [-3591.726] (-3596.692) (-3600.883) (-3597.974) -- 0:07:10 178000 -- [-3587.055] (-3596.183) (-3597.398) (-3598.703) * [-3601.256] (-3595.028) (-3589.204) (-3599.922) -- 0:07:09 178500 -- [-3589.659] (-3594.313) (-3605.090) (-3611.194) * (-3594.970) (-3596.260) (-3595.613) [-3593.519] -- 0:07:08 179000 -- [-3584.430] (-3598.807) (-3596.621) (-3593.710) * [-3590.106] (-3595.371) (-3593.165) (-3601.875) -- 0:07:06 179500 -- (-3600.785) (-3602.249) [-3589.750] (-3597.972) * (-3595.549) (-3591.955) (-3593.020) [-3593.710] -- 0:07:09 180000 -- (-3603.439) (-3591.688) [-3593.193] (-3594.145) * [-3592.793] (-3590.793) (-3596.107) (-3586.754) -- 0:07:08 Average standard deviation of split frequencies: 0.011742 180500 -- [-3588.694] (-3594.799) (-3597.359) (-3599.163) * [-3588.059] (-3596.555) (-3595.237) (-3596.273) -- 0:07:06 181000 -- (-3599.010) (-3597.306) [-3588.371] (-3601.387) * (-3597.102) [-3599.097] (-3598.055) (-3594.392) -- 0:07:05 181500 -- [-3597.285] (-3590.929) (-3589.846) (-3598.653) * (-3602.412) [-3595.040] (-3598.411) (-3593.363) -- 0:07:08 182000 -- [-3595.457] (-3589.203) (-3589.573) (-3594.571) * (-3613.450) (-3592.582) [-3593.287] (-3595.878) -- 0:07:06 182500 -- (-3601.598) (-3603.457) (-3587.027) [-3593.252] * (-3594.674) (-3598.582) (-3599.744) [-3593.134] -- 0:07:05 183000 -- (-3602.380) (-3593.491) [-3584.986] (-3598.468) * [-3597.258] (-3597.591) (-3593.735) (-3591.660) -- 0:07:04 183500 -- (-3591.612) (-3594.461) (-3595.154) [-3595.990] * [-3593.875] (-3598.350) (-3602.129) (-3602.394) -- 0:07:07 184000 -- (-3614.201) (-3593.210) (-3594.993) [-3594.723] * (-3591.729) (-3594.082) (-3593.642) [-3595.877] -- 0:07:05 184500 -- (-3601.780) [-3589.910] (-3601.526) (-3590.789) * [-3589.289] (-3603.940) (-3589.981) (-3595.636) -- 0:07:04 185000 -- (-3600.369) (-3601.285) [-3589.985] (-3598.894) * (-3596.145) (-3597.772) (-3600.633) [-3594.290] -- 0:07:02 Average standard deviation of split frequencies: 0.011912 185500 -- (-3593.245) (-3592.089) (-3599.636) [-3594.649] * (-3599.828) (-3595.612) [-3597.713] (-3596.062) -- 0:07:05 186000 -- (-3600.658) (-3590.725) (-3607.011) [-3590.074] * (-3594.071) (-3594.208) [-3600.266] (-3598.168) -- 0:07:04 186500 -- (-3588.411) (-3597.631) (-3605.167) [-3594.757] * (-3602.547) (-3596.798) [-3595.585] (-3597.312) -- 0:07:03 187000 -- (-3598.309) (-3595.161) [-3588.669] (-3589.976) * (-3598.817) (-3596.585) [-3593.426] (-3592.220) -- 0:07:01 187500 -- [-3593.584] (-3607.998) (-3595.507) (-3601.003) * (-3597.916) (-3589.693) (-3601.582) [-3595.571] -- 0:07:04 188000 -- (-3589.673) (-3602.179) (-3606.184) [-3594.034] * (-3601.924) (-3601.678) (-3595.604) [-3602.208] -- 0:07:03 188500 -- (-3596.235) (-3601.599) (-3596.327) [-3598.694] * (-3599.953) (-3599.111) [-3590.218] (-3592.335) -- 0:07:01 189000 -- (-3594.773) (-3595.224) [-3588.338] (-3597.949) * (-3597.079) [-3598.457] (-3598.304) (-3595.598) -- 0:07:04 189500 -- (-3603.705) [-3597.469] (-3599.834) (-3601.692) * (-3595.354) (-3598.462) [-3590.061] (-3592.820) -- 0:07:03 190000 -- (-3602.059) (-3599.386) [-3591.181] (-3600.290) * (-3601.191) [-3597.946] (-3586.217) (-3601.292) -- 0:07:02 Average standard deviation of split frequencies: 0.011620 190500 -- (-3601.809) (-3598.363) (-3593.627) [-3594.546] * (-3594.627) (-3592.468) [-3592.874] (-3592.677) -- 0:07:00 191000 -- (-3595.565) [-3589.645] (-3600.055) (-3596.740) * (-3601.618) (-3593.241) (-3596.114) [-3590.726] -- 0:07:03 191500 -- (-3597.813) (-3595.101) (-3598.454) [-3597.074] * (-3592.875) (-3594.228) [-3593.307] (-3587.897) -- 0:07:02 192000 -- (-3592.608) (-3594.438) (-3602.742) [-3596.762] * [-3600.983] (-3594.174) (-3597.594) (-3592.529) -- 0:07:00 192500 -- (-3598.402) (-3602.752) [-3594.025] (-3597.989) * (-3599.005) (-3601.400) [-3589.030] (-3599.286) -- 0:06:59 193000 -- (-3592.099) (-3591.995) [-3595.482] (-3602.933) * (-3586.303) (-3600.252) (-3597.761) [-3589.844] -- 0:07:02 193500 -- [-3593.981] (-3597.190) (-3607.888) (-3586.714) * (-3598.050) (-3600.739) (-3596.073) [-3592.219] -- 0:07:00 194000 -- (-3591.054) [-3593.848] (-3611.559) (-3603.917) * (-3606.142) (-3593.250) (-3594.755) [-3594.720] -- 0:06:59 194500 -- (-3597.839) [-3593.740] (-3591.315) (-3596.090) * (-3605.961) (-3604.251) (-3598.657) [-3593.008] -- 0:06:58 195000 -- (-3603.867) (-3596.506) (-3595.782) [-3586.142] * (-3601.478) (-3595.523) (-3610.818) [-3594.535] -- 0:07:01 Average standard deviation of split frequencies: 0.010342 195500 -- [-3592.370] (-3596.889) (-3603.194) (-3595.760) * (-3592.220) [-3594.243] (-3598.940) (-3599.125) -- 0:06:59 196000 -- (-3594.869) (-3602.608) [-3603.559] (-3600.237) * [-3592.781] (-3591.574) (-3594.701) (-3592.434) -- 0:06:58 196500 -- [-3597.469] (-3591.688) (-3591.317) (-3604.682) * (-3603.223) (-3596.881) [-3598.055] (-3593.016) -- 0:06:57 197000 -- (-3598.917) [-3592.593] (-3597.146) (-3601.963) * (-3599.799) (-3602.742) (-3595.276) [-3595.703] -- 0:06:59 197500 -- [-3597.206] (-3593.136) (-3607.778) (-3596.061) * [-3591.271] (-3590.469) (-3596.131) (-3609.485) -- 0:06:58 198000 -- (-3601.150) (-3591.142) [-3599.530] (-3592.155) * (-3599.796) [-3591.816] (-3587.500) (-3611.351) -- 0:06:57 198500 -- (-3596.334) (-3593.790) (-3592.073) [-3593.641] * (-3599.017) (-3587.066) [-3588.516] (-3602.448) -- 0:06:55 199000 -- (-3602.998) (-3593.967) (-3588.944) [-3601.193] * (-3598.124) (-3601.692) (-3595.841) [-3593.717] -- 0:06:58 199500 -- [-3592.499] (-3588.594) (-3596.476) (-3597.196) * (-3592.109) (-3595.810) (-3598.179) [-3590.086] -- 0:06:57 200000 -- (-3597.216) (-3589.520) [-3591.019] (-3596.556) * [-3597.405] (-3594.535) (-3592.685) (-3603.907) -- 0:06:55 Average standard deviation of split frequencies: 0.011746 200500 -- (-3595.400) (-3606.337) [-3587.866] (-3592.957) * (-3609.252) (-3603.064) (-3598.964) [-3590.248] -- 0:06:58 201000 -- [-3595.468] (-3594.305) (-3595.209) (-3600.589) * (-3602.522) (-3589.234) (-3591.151) [-3593.097] -- 0:06:57 201500 -- (-3600.151) (-3593.308) [-3592.233] (-3593.432) * (-3599.034) (-3597.019) (-3596.764) [-3589.863] -- 0:06:56 202000 -- [-3596.902] (-3588.780) (-3610.440) (-3594.118) * (-3600.743) [-3594.172] (-3596.369) (-3590.048) -- 0:06:54 202500 -- [-3601.929] (-3593.165) (-3599.488) (-3596.318) * (-3602.306) [-3594.721] (-3592.205) (-3590.247) -- 0:06:57 203000 -- (-3603.738) (-3593.456) (-3594.058) [-3597.753] * (-3593.116) [-3593.697] (-3588.162) (-3593.493) -- 0:06:56 203500 -- (-3587.810) (-3599.839) [-3587.959] (-3593.747) * (-3591.695) (-3600.869) (-3604.048) [-3597.302] -- 0:06:54 204000 -- [-3588.609] (-3595.093) (-3598.435) (-3588.641) * [-3592.798] (-3596.166) (-3599.162) (-3594.018) -- 0:06:53 204500 -- (-3595.318) (-3595.680) (-3598.292) [-3590.673] * (-3599.246) (-3596.588) (-3600.108) [-3594.477] -- 0:06:56 205000 -- (-3594.260) (-3594.653) (-3597.811) [-3588.514] * [-3597.145] (-3591.709) (-3599.163) (-3593.288) -- 0:06:54 Average standard deviation of split frequencies: 0.016247 205500 -- (-3600.502) [-3598.340] (-3596.613) (-3598.396) * [-3591.521] (-3604.061) (-3594.012) (-3594.174) -- 0:06:53 206000 -- (-3599.466) [-3589.109] (-3598.325) (-3592.442) * [-3592.577] (-3591.718) (-3591.097) (-3599.813) -- 0:06:52 206500 -- (-3598.127) (-3599.437) (-3585.293) [-3595.201] * (-3599.438) (-3590.519) [-3596.892] (-3596.319) -- 0:06:55 207000 -- (-3596.129) (-3593.264) (-3594.638) [-3597.592] * [-3586.315] (-3590.828) (-3599.609) (-3614.484) -- 0:06:53 207500 -- (-3594.429) [-3593.886] (-3593.216) (-3606.749) * (-3590.895) [-3592.422] (-3596.593) (-3586.545) -- 0:06:52 208000 -- [-3591.699] (-3589.883) (-3594.089) (-3594.069) * (-3596.721) [-3597.816] (-3595.012) (-3594.742) -- 0:06:51 208500 -- (-3597.787) (-3591.426) [-3594.672] (-3598.795) * (-3602.126) [-3594.925] (-3596.665) (-3586.766) -- 0:06:53 209000 -- (-3593.199) (-3607.200) (-3597.826) [-3597.752] * (-3604.356) (-3592.717) (-3589.257) [-3591.537] -- 0:06:52 209500 -- [-3596.362] (-3594.014) (-3594.622) (-3603.501) * (-3596.800) (-3591.714) [-3600.818] (-3604.584) -- 0:06:51 210000 -- (-3597.719) (-3594.983) (-3603.238) [-3597.897] * (-3594.729) (-3595.353) (-3595.088) [-3591.519] -- 0:06:53 Average standard deviation of split frequencies: 0.018125 210500 -- [-3598.717] (-3594.094) (-3596.533) (-3593.665) * (-3598.974) (-3594.066) [-3600.510] (-3595.612) -- 0:06:52 211000 -- [-3590.853] (-3603.723) (-3596.967) (-3595.174) * [-3591.603] (-3604.512) (-3592.440) (-3593.237) -- 0:06:51 211500 -- (-3602.657) (-3593.194) (-3602.699) [-3598.550] * (-3595.019) (-3598.826) (-3602.666) [-3591.357] -- 0:06:50 212000 -- (-3599.455) (-3596.375) (-3593.322) [-3598.519] * [-3594.557] (-3592.000) (-3600.830) (-3597.352) -- 0:06:52 212500 -- (-3598.282) (-3598.293) [-3593.460] (-3590.963) * (-3596.110) (-3594.468) (-3605.066) [-3597.728] -- 0:06:51 213000 -- (-3607.222) (-3602.427) [-3598.784] (-3596.703) * (-3595.461) (-3602.407) [-3602.734] (-3606.778) -- 0:06:50 213500 -- (-3595.983) (-3594.239) [-3590.704] (-3597.164) * (-3596.448) (-3599.734) (-3597.779) [-3593.998] -- 0:06:48 214000 -- (-3596.508) (-3589.171) (-3592.348) [-3601.017] * [-3592.466] (-3591.238) (-3605.451) (-3598.344) -- 0:06:51 214500 -- [-3592.580] (-3588.565) (-3595.800) (-3594.232) * (-3599.805) (-3588.865) [-3590.959] (-3598.459) -- 0:06:50 215000 -- (-3596.571) (-3592.953) (-3598.527) [-3589.496] * (-3600.386) (-3589.210) [-3598.867] (-3600.375) -- 0:06:48 Average standard deviation of split frequencies: 0.014841 215500 -- (-3604.504) [-3588.249] (-3612.096) (-3589.383) * [-3602.328] (-3593.777) (-3592.345) (-3597.592) -- 0:06:47 216000 -- (-3599.344) (-3587.539) [-3604.919] (-3595.970) * (-3600.761) (-3593.688) [-3600.144] (-3597.442) -- 0:06:50 216500 -- (-3599.064) (-3598.402) [-3601.323] (-3596.604) * (-3594.911) (-3594.227) (-3601.742) [-3596.840] -- 0:06:48 217000 -- (-3591.828) [-3598.050] (-3595.762) (-3605.899) * (-3596.353) [-3597.191] (-3595.422) (-3598.400) -- 0:06:47 217500 -- [-3599.305] (-3594.337) (-3595.234) (-3600.154) * (-3598.263) [-3605.998] (-3590.267) (-3594.156) -- 0:06:46 218000 -- (-3597.577) (-3596.361) [-3594.498] (-3591.447) * [-3592.940] (-3601.411) (-3594.807) (-3602.077) -- 0:06:48 218500 -- [-3596.932] (-3595.614) (-3596.451) (-3603.143) * (-3600.810) (-3595.212) [-3593.891] (-3601.428) -- 0:06:47 219000 -- [-3600.887] (-3620.674) (-3598.470) (-3590.815) * (-3605.101) [-3598.805] (-3592.374) (-3606.946) -- 0:06:46 219500 -- (-3595.743) (-3600.727) (-3605.345) [-3598.590] * [-3596.000] (-3594.994) (-3600.127) (-3607.987) -- 0:06:45 220000 -- (-3590.227) (-3607.652) (-3596.996) [-3603.355] * (-3607.897) [-3592.291] (-3596.871) (-3595.288) -- 0:06:47 Average standard deviation of split frequencies: 0.013459 220500 -- [-3596.329] (-3599.686) (-3589.614) (-3593.230) * (-3591.717) [-3591.122] (-3587.906) (-3597.726) -- 0:06:46 221000 -- (-3595.601) (-3594.770) (-3593.397) [-3593.251] * [-3593.818] (-3594.430) (-3591.038) (-3591.411) -- 0:06:45 221500 -- (-3599.131) [-3589.051] (-3592.969) (-3599.837) * (-3600.579) (-3602.724) (-3594.032) [-3591.540] -- 0:06:47 222000 -- (-3593.931) (-3593.976) (-3597.180) [-3596.573] * [-3596.530] (-3590.475) (-3593.048) (-3592.999) -- 0:06:46 222500 -- (-3607.897) [-3595.673] (-3605.221) (-3596.204) * (-3592.511) (-3593.554) (-3605.166) [-3598.197] -- 0:06:45 223000 -- (-3597.161) (-3598.172) [-3597.020] (-3594.971) * (-3604.231) (-3602.330) [-3588.895] (-3604.976) -- 0:06:44 223500 -- [-3592.013] (-3595.853) (-3600.073) (-3595.727) * [-3591.443] (-3602.223) (-3595.360) (-3594.277) -- 0:06:46 224000 -- (-3591.772) (-3601.873) [-3597.334] (-3597.003) * (-3603.108) (-3605.300) (-3592.173) [-3594.192] -- 0:06:45 224500 -- (-3593.383) (-3596.786) (-3605.724) [-3598.842] * [-3594.526] (-3594.809) (-3592.902) (-3598.418) -- 0:06:44 225000 -- (-3593.974) (-3599.756) (-3591.851) [-3593.362] * (-3598.806) [-3592.078] (-3591.203) (-3598.367) -- 0:06:42 Average standard deviation of split frequencies: 0.012307 225500 -- (-3592.123) (-3601.688) [-3592.815] (-3596.458) * (-3604.511) (-3611.098) (-3595.033) [-3596.492] -- 0:06:45 226000 -- (-3596.917) (-3598.262) [-3589.104] (-3591.598) * [-3593.755] (-3601.178) (-3608.242) (-3608.403) -- 0:06:44 226500 -- (-3595.646) (-3598.225) [-3596.722] (-3594.046) * [-3595.972] (-3589.316) (-3594.905) (-3601.432) -- 0:06:42 227000 -- (-3607.853) (-3608.650) [-3597.573] (-3592.090) * (-3590.646) [-3591.256] (-3593.769) (-3601.473) -- 0:06:41 227500 -- (-3600.461) [-3607.227] (-3590.801) (-3593.909) * (-3599.270) (-3591.981) [-3588.730] (-3600.888) -- 0:06:44 228000 -- [-3588.746] (-3595.743) (-3589.022) (-3596.447) * (-3592.710) (-3596.803) [-3588.794] (-3598.072) -- 0:06:42 228500 -- (-3595.561) (-3599.589) [-3593.596] (-3601.205) * (-3589.208) (-3594.628) [-3587.835] (-3592.233) -- 0:06:41 229000 -- (-3598.975) (-3602.717) (-3599.729) [-3594.604] * (-3595.776) [-3596.616] (-3588.424) (-3601.651) -- 0:06:40 229500 -- (-3602.561) (-3592.705) (-3590.459) [-3594.003] * [-3591.019] (-3592.140) (-3597.504) (-3597.226) -- 0:06:42 230000 -- [-3600.502] (-3596.720) (-3592.797) (-3593.854) * (-3602.962) (-3590.425) [-3590.225] (-3593.938) -- 0:06:41 Average standard deviation of split frequencies: 0.010831 230500 -- [-3592.780] (-3590.950) (-3601.127) (-3600.818) * (-3594.177) (-3596.623) [-3589.120] (-3596.354) -- 0:06:40 231000 -- (-3592.045) (-3597.931) [-3591.924] (-3599.142) * (-3602.517) (-3595.880) [-3592.842] (-3591.603) -- 0:06:39 231500 -- [-3590.566] (-3592.056) (-3596.284) (-3592.741) * [-3597.184] (-3589.947) (-3600.483) (-3592.679) -- 0:06:41 232000 -- (-3593.381) [-3590.754] (-3587.843) (-3601.515) * (-3594.567) (-3588.170) (-3600.841) [-3596.484] -- 0:06:40 232500 -- (-3592.251) (-3592.008) (-3595.389) [-3600.402] * [-3590.951] (-3589.992) (-3592.184) (-3597.890) -- 0:06:39 233000 -- [-3602.102] (-3582.627) (-3602.563) (-3600.660) * (-3596.651) (-3608.641) [-3593.026] (-3601.220) -- 0:06:38 233500 -- (-3598.314) [-3592.495] (-3595.382) (-3603.708) * (-3596.572) [-3590.964] (-3599.828) (-3597.227) -- 0:06:40 234000 -- (-3605.170) (-3596.794) (-3602.641) [-3588.721] * (-3596.742) (-3590.208) (-3598.060) [-3597.577] -- 0:06:39 234500 -- (-3593.451) (-3593.528) [-3597.412] (-3601.642) * (-3594.150) (-3599.987) (-3595.713) [-3590.610] -- 0:06:38 235000 -- (-3597.237) (-3600.314) [-3597.234] (-3593.055) * [-3593.755] (-3596.177) (-3594.284) (-3602.671) -- 0:06:40 Average standard deviation of split frequencies: 0.013183 235500 -- (-3591.470) (-3603.373) [-3592.319] (-3589.113) * (-3592.385) (-3594.648) (-3591.091) [-3597.277] -- 0:06:39 236000 -- (-3591.956) [-3592.112] (-3610.145) (-3591.368) * (-3592.515) (-3598.241) [-3590.677] (-3597.715) -- 0:06:38 236500 -- (-3590.335) (-3590.046) (-3594.064) [-3591.129] * (-3603.889) (-3600.057) [-3594.748] (-3594.831) -- 0:06:37 237000 -- (-3588.846) (-3593.881) (-3594.446) [-3592.773] * (-3592.547) (-3602.679) (-3594.240) [-3593.578] -- 0:06:39 237500 -- (-3594.944) (-3599.804) (-3602.185) [-3596.515] * (-3597.554) [-3587.833] (-3596.881) (-3597.045) -- 0:06:38 238000 -- (-3597.199) (-3587.316) (-3592.579) [-3595.365] * (-3602.109) [-3589.973] (-3601.941) (-3597.735) -- 0:06:37 238500 -- (-3599.167) [-3592.662] (-3595.947) (-3593.548) * [-3599.356] (-3605.653) (-3592.791) (-3605.955) -- 0:06:35 239000 -- [-3593.447] (-3594.504) (-3595.443) (-3598.750) * (-3590.773) (-3605.452) [-3597.077] (-3597.465) -- 0:06:38 239500 -- [-3595.907] (-3593.695) (-3592.519) (-3596.352) * (-3594.526) [-3595.727] (-3592.063) (-3602.137) -- 0:06:36 240000 -- (-3602.486) [-3589.825] (-3592.582) (-3600.772) * (-3597.965) (-3591.873) [-3589.480] (-3594.357) -- 0:06:35 Average standard deviation of split frequencies: 0.013711 240500 -- (-3598.930) (-3597.367) [-3585.748] (-3596.472) * (-3593.312) [-3594.189] (-3595.414) (-3591.103) -- 0:06:34 241000 -- (-3599.699) (-3605.808) (-3596.316) [-3592.930] * [-3597.297] (-3603.035) (-3598.405) (-3591.705) -- 0:06:36 241500 -- (-3607.246) (-3601.675) (-3596.354) [-3594.731] * [-3596.476] (-3593.476) (-3598.375) (-3585.941) -- 0:06:35 242000 -- (-3601.823) (-3588.977) [-3591.289] (-3592.697) * (-3592.170) [-3595.238] (-3609.969) (-3601.499) -- 0:06:34 242500 -- (-3593.754) (-3592.638) [-3595.102] (-3589.831) * (-3600.898) [-3594.332] (-3595.972) (-3595.631) -- 0:06:33 243000 -- (-3591.187) [-3588.534] (-3602.855) (-3589.938) * (-3610.179) (-3602.691) (-3591.183) [-3593.266] -- 0:06:35 243500 -- (-3592.611) [-3600.952] (-3599.914) (-3596.993) * (-3615.355) (-3598.079) (-3595.128) [-3594.026] -- 0:06:34 244000 -- [-3598.885] (-3590.274) (-3593.612) (-3598.745) * [-3598.366] (-3601.653) (-3594.682) (-3598.087) -- 0:06:33 244500 -- [-3592.687] (-3603.345) (-3595.751) (-3606.674) * (-3598.854) [-3593.710] (-3605.449) (-3603.647) -- 0:06:32 245000 -- (-3597.487) (-3596.447) (-3589.389) [-3592.457] * [-3588.522] (-3595.405) (-3593.646) (-3604.213) -- 0:06:34 Average standard deviation of split frequencies: 0.015139 245500 -- [-3599.138] (-3601.565) (-3593.992) (-3595.084) * (-3605.163) (-3591.819) [-3594.721] (-3601.541) -- 0:06:33 246000 -- (-3594.937) (-3597.900) (-3600.386) [-3591.528] * (-3598.505) (-3603.640) (-3593.473) [-3596.658] -- 0:06:32 246500 -- (-3598.243) (-3596.748) (-3597.921) [-3596.954] * [-3595.819] (-3593.636) (-3592.658) (-3590.211) -- 0:06:34 247000 -- [-3589.948] (-3599.391) (-3596.080) (-3608.951) * (-3594.774) (-3600.106) (-3596.795) [-3596.145] -- 0:06:33 247500 -- [-3597.397] (-3596.704) (-3597.137) (-3602.670) * (-3596.624) [-3594.316] (-3588.319) (-3598.746) -- 0:06:32 248000 -- (-3593.847) [-3593.782] (-3595.842) (-3596.578) * (-3596.956) (-3602.915) [-3587.297] (-3603.811) -- 0:06:31 248500 -- (-3591.541) (-3601.780) [-3589.612] (-3598.575) * (-3603.595) (-3604.778) [-3599.580] (-3594.370) -- 0:06:33 249000 -- (-3592.620) [-3596.338] (-3597.163) (-3601.093) * [-3596.273] (-3594.609) (-3592.479) (-3594.609) -- 0:06:32 249500 -- [-3594.005] (-3601.502) (-3599.319) (-3592.921) * (-3599.436) [-3598.947] (-3599.423) (-3596.100) -- 0:06:31 250000 -- (-3594.148) [-3587.605] (-3600.391) (-3596.095) * (-3590.533) (-3592.483) (-3595.669) [-3593.771] -- 0:06:29 Average standard deviation of split frequencies: 0.019182 250500 -- (-3600.135) (-3603.016) (-3590.582) [-3589.117] * (-3587.190) (-3596.705) (-3595.170) [-3589.521] -- 0:06:31 251000 -- [-3588.983] (-3594.387) (-3594.332) (-3593.645) * (-3603.073) (-3590.225) [-3588.806] (-3597.605) -- 0:06:30 251500 -- [-3589.337] (-3596.671) (-3599.108) (-3588.210) * (-3590.087) (-3592.632) [-3593.628] (-3591.877) -- 0:06:29 252000 -- (-3594.848) (-3598.890) [-3594.046] (-3591.141) * (-3593.513) (-3591.926) [-3594.362] (-3593.838) -- 0:06:28 252500 -- (-3603.929) (-3590.721) (-3606.819) [-3590.451] * [-3599.346] (-3606.827) (-3589.065) (-3596.251) -- 0:06:30 253000 -- (-3600.362) [-3591.430] (-3595.253) (-3592.568) * [-3599.881] (-3599.343) (-3596.936) (-3596.471) -- 0:06:29 253500 -- (-3593.807) [-3591.904] (-3594.103) (-3594.571) * (-3598.003) (-3599.415) (-3602.028) [-3590.062] -- 0:06:28 254000 -- (-3590.397) [-3593.195] (-3597.231) (-3614.278) * [-3600.802] (-3601.659) (-3598.011) (-3597.598) -- 0:06:27 254500 -- (-3598.679) [-3597.841] (-3602.405) (-3603.593) * (-3592.925) [-3593.496] (-3591.588) (-3595.106) -- 0:06:29 255000 -- (-3591.893) [-3590.626] (-3599.606) (-3600.142) * (-3599.804) (-3590.727) (-3591.243) [-3597.873] -- 0:06:28 Average standard deviation of split frequencies: 0.017678 255500 -- (-3594.900) (-3596.010) (-3601.719) [-3599.984] * [-3600.018] (-3596.454) (-3592.623) (-3593.670) -- 0:06:27 256000 -- [-3596.830] (-3597.931) (-3602.506) (-3605.186) * (-3592.169) (-3597.857) [-3591.629] (-3594.932) -- 0:06:26 256500 -- (-3599.102) [-3595.693] (-3603.068) (-3597.697) * [-3596.794] (-3595.048) (-3587.837) (-3603.921) -- 0:06:28 257000 -- (-3601.030) [-3587.866] (-3596.248) (-3596.279) * (-3595.475) [-3592.341] (-3599.915) (-3607.718) -- 0:06:27 257500 -- (-3602.876) (-3593.287) [-3587.401] (-3597.242) * (-3606.227) [-3596.331] (-3595.824) (-3598.781) -- 0:06:26 258000 -- (-3600.477) (-3599.340) (-3603.972) [-3589.997] * (-3601.959) [-3593.844] (-3595.119) (-3592.462) -- 0:06:25 258500 -- (-3595.059) [-3598.710] (-3592.306) (-3596.457) * [-3600.299] (-3598.841) (-3597.848) (-3596.825) -- 0:06:27 259000 -- (-3594.347) (-3605.427) [-3588.900] (-3596.736) * (-3598.628) (-3596.769) (-3594.666) [-3594.510] -- 0:06:26 259500 -- [-3598.677] (-3588.240) (-3594.862) (-3603.363) * [-3596.148] (-3604.261) (-3599.947) (-3592.085) -- 0:06:25 260000 -- [-3598.205] (-3602.395) (-3602.940) (-3594.637) * (-3600.987) (-3598.044) [-3604.609] (-3603.897) -- 0:06:27 Average standard deviation of split frequencies: 0.015914 260500 -- (-3597.175) (-3595.739) (-3597.706) [-3595.308] * (-3602.771) [-3593.537] (-3601.211) (-3596.913) -- 0:06:26 261000 -- (-3604.475) [-3594.017] (-3602.333) (-3590.226) * (-3605.441) (-3598.820) [-3590.377] (-3593.039) -- 0:06:25 261500 -- (-3595.257) (-3605.722) (-3592.663) [-3597.647] * (-3603.554) [-3603.274] (-3594.224) (-3599.277) -- 0:06:24 262000 -- (-3591.690) [-3596.786] (-3600.772) (-3603.133) * (-3597.466) (-3592.679) [-3586.740] (-3590.774) -- 0:06:25 262500 -- (-3602.114) (-3603.008) [-3593.920] (-3597.248) * (-3597.462) [-3592.709] (-3592.455) (-3586.483) -- 0:06:24 263000 -- (-3591.794) (-3601.478) [-3589.840] (-3593.943) * [-3593.776] (-3604.129) (-3601.864) (-3594.051) -- 0:06:23 263500 -- (-3602.138) (-3593.893) [-3606.239] (-3592.018) * [-3600.148] (-3594.168) (-3596.859) (-3594.434) -- 0:06:22 264000 -- (-3601.981) (-3598.336) [-3588.622] (-3593.364) * (-3601.317) [-3598.701] (-3596.208) (-3595.949) -- 0:06:24 264500 -- (-3596.261) (-3601.447) [-3594.925] (-3599.174) * (-3603.342) (-3596.919) (-3592.298) [-3594.936] -- 0:06:23 265000 -- (-3598.022) (-3597.256) [-3593.977] (-3593.327) * (-3605.910) (-3595.617) [-3586.720] (-3605.281) -- 0:06:22 Average standard deviation of split frequencies: 0.016836 265500 -- (-3599.095) [-3593.236] (-3587.707) (-3594.868) * (-3604.844) [-3592.908] (-3589.524) (-3600.222) -- 0:06:21 266000 -- [-3588.556] (-3604.043) (-3595.309) (-3595.435) * [-3594.821] (-3601.431) (-3609.924) (-3606.374) -- 0:06:23 266500 -- (-3594.620) (-3596.493) (-3601.545) [-3592.579] * (-3589.352) (-3600.810) (-3610.191) [-3597.366] -- 0:06:22 267000 -- (-3590.499) (-3624.244) (-3597.592) [-3591.026] * (-3593.218) (-3600.151) (-3605.519) [-3595.042] -- 0:06:21 267500 -- (-3592.490) (-3602.450) [-3595.915] (-3614.285) * (-3596.879) [-3591.779] (-3597.060) (-3601.841) -- 0:06:20 268000 -- (-3604.473) (-3597.992) [-3588.719] (-3600.419) * (-3592.546) (-3594.187) [-3588.122] (-3602.189) -- 0:06:22 268500 -- (-3596.761) (-3614.545) [-3591.418] (-3602.387) * (-3606.849) [-3589.602] (-3591.482) (-3611.625) -- 0:06:21 269000 -- (-3599.277) (-3590.404) [-3589.359] (-3604.706) * (-3606.439) (-3595.997) [-3589.250] (-3600.303) -- 0:06:20 269500 -- (-3596.941) (-3614.600) (-3599.028) [-3591.289] * [-3603.211] (-3594.042) (-3596.248) (-3594.829) -- 0:06:19 270000 -- (-3598.203) [-3592.525] (-3593.210) (-3597.427) * (-3602.585) (-3592.269) [-3591.868] (-3592.190) -- 0:06:21 Average standard deviation of split frequencies: 0.015152 270500 -- (-3598.898) [-3588.242] (-3591.944) (-3592.854) * [-3585.391] (-3606.265) (-3598.378) (-3594.694) -- 0:06:20 271000 -- (-3599.124) (-3594.563) [-3597.380] (-3591.799) * (-3601.649) (-3605.260) [-3597.809] (-3594.666) -- 0:06:19 271500 -- (-3600.014) (-3597.608) (-3603.082) [-3595.923] * (-3601.050) (-3600.371) [-3589.407] (-3596.735) -- 0:06:18 272000 -- [-3608.676] (-3595.450) (-3595.272) (-3605.006) * (-3597.936) (-3599.725) [-3594.344] (-3594.302) -- 0:06:20 272500 -- [-3591.550] (-3591.824) (-3588.172) (-3598.590) * (-3608.186) (-3588.898) (-3596.679) [-3594.703] -- 0:06:19 273000 -- [-3592.372] (-3597.330) (-3597.912) (-3594.666) * (-3606.407) (-3586.948) (-3597.676) [-3585.985] -- 0:06:18 273500 -- (-3589.821) [-3587.802] (-3598.301) (-3601.915) * (-3602.953) (-3589.467) [-3603.707] (-3588.675) -- 0:06:19 274000 -- (-3590.503) (-3600.349) (-3598.071) [-3587.302] * (-3598.586) [-3589.664] (-3591.482) (-3593.786) -- 0:06:18 274500 -- [-3591.135] (-3592.784) (-3592.710) (-3593.787) * (-3600.896) (-3594.766) [-3592.660] (-3593.884) -- 0:06:17 275000 -- [-3587.546] (-3594.155) (-3599.416) (-3594.800) * (-3596.153) [-3586.964] (-3599.218) (-3590.700) -- 0:06:16 Average standard deviation of split frequencies: 0.016397 275500 -- (-3596.956) (-3598.671) (-3589.944) [-3586.315] * (-3599.875) [-3586.338] (-3597.210) (-3590.390) -- 0:06:18 276000 -- (-3596.982) [-3589.456] (-3597.054) (-3601.488) * [-3597.902] (-3591.548) (-3593.191) (-3588.253) -- 0:06:17 276500 -- (-3615.281) (-3595.160) [-3592.355] (-3594.106) * (-3592.577) (-3599.996) [-3603.024] (-3600.635) -- 0:06:16 277000 -- (-3595.553) (-3595.314) [-3597.919] (-3593.914) * [-3588.530] (-3601.027) (-3594.948) (-3597.243) -- 0:06:15 277500 -- [-3602.328] (-3594.330) (-3600.761) (-3595.891) * (-3591.658) [-3589.388] (-3608.071) (-3604.534) -- 0:06:17 278000 -- [-3596.043] (-3590.823) (-3604.695) (-3596.243) * (-3600.421) (-3599.095) [-3594.821] (-3597.283) -- 0:06:16 278500 -- (-3603.406) (-3599.318) (-3600.072) [-3594.944] * [-3597.534] (-3593.962) (-3591.396) (-3591.165) -- 0:06:15 279000 -- (-3595.490) (-3594.602) [-3592.128] (-3600.311) * (-3594.186) [-3596.746] (-3591.336) (-3600.137) -- 0:06:14 279500 -- [-3595.020] (-3592.035) (-3598.889) (-3598.468) * (-3600.886) [-3596.148] (-3598.066) (-3594.648) -- 0:06:16 280000 -- (-3589.572) (-3593.926) (-3600.736) [-3591.047] * (-3597.320) [-3597.798] (-3597.445) (-3591.325) -- 0:06:15 Average standard deviation of split frequencies: 0.018979 280500 -- (-3593.913) [-3592.370] (-3607.252) (-3594.733) * (-3592.655) (-3590.938) (-3596.065) [-3588.394] -- 0:06:14 281000 -- (-3594.516) (-3597.595) (-3604.848) [-3601.217] * (-3595.112) (-3588.142) [-3588.441] (-3600.425) -- 0:06:13 281500 -- [-3592.385] (-3599.520) (-3593.994) (-3603.207) * (-3608.284) (-3596.521) [-3588.893] (-3594.559) -- 0:06:15 282000 -- [-3591.177] (-3600.361) (-3592.335) (-3595.861) * (-3592.590) (-3601.622) (-3597.421) [-3602.342] -- 0:06:14 282500 -- (-3597.870) [-3598.754] (-3590.294) (-3596.882) * [-3592.012] (-3589.243) (-3590.556) (-3597.464) -- 0:06:13 283000 -- [-3591.679] (-3590.604) (-3592.222) (-3597.625) * (-3590.813) [-3599.103] (-3592.266) (-3602.991) -- 0:06:14 283500 -- (-3593.136) [-3590.576] (-3591.241) (-3596.572) * (-3596.557) (-3595.116) (-3599.577) [-3583.965] -- 0:06:14 284000 -- (-3591.890) [-3590.443] (-3591.402) (-3593.071) * [-3597.048] (-3596.076) (-3596.813) (-3590.131) -- 0:06:13 284500 -- [-3596.551] (-3594.340) (-3602.899) (-3595.356) * [-3588.749] (-3604.478) (-3587.694) (-3589.521) -- 0:06:12 285000 -- (-3595.516) (-3598.955) (-3603.238) [-3594.710] * (-3588.971) (-3602.225) (-3594.906) [-3585.679] -- 0:06:13 Average standard deviation of split frequencies: 0.018461 285500 -- [-3591.210] (-3598.178) (-3595.952) (-3605.232) * [-3600.161] (-3596.106) (-3597.189) (-3595.894) -- 0:06:12 286000 -- (-3604.273) [-3590.258] (-3595.821) (-3595.331) * [-3602.182] (-3598.818) (-3593.948) (-3590.127) -- 0:06:11 286500 -- (-3603.113) (-3596.206) [-3601.965] (-3598.530) * (-3595.753) (-3596.525) (-3604.011) [-3590.820] -- 0:06:11 287000 -- (-3593.784) [-3589.723] (-3594.041) (-3598.743) * (-3598.653) (-3595.080) [-3597.848] (-3597.325) -- 0:06:12 287500 -- (-3589.087) [-3585.692] (-3607.626) (-3594.845) * (-3588.351) (-3594.315) [-3591.220] (-3603.071) -- 0:06:11 288000 -- (-3593.888) (-3589.632) [-3596.058] (-3596.952) * (-3598.827) [-3595.112] (-3594.445) (-3603.921) -- 0:06:10 288500 -- (-3595.103) (-3592.774) [-3596.462] (-3602.679) * (-3597.814) (-3591.966) (-3593.975) [-3595.797] -- 0:06:09 289000 -- (-3595.698) (-3591.644) (-3594.692) [-3595.606] * (-3596.854) [-3596.148] (-3596.834) (-3606.808) -- 0:06:11 289500 -- [-3590.038] (-3599.026) (-3605.031) (-3597.978) * [-3600.187] (-3599.593) (-3598.170) (-3598.149) -- 0:06:10 290000 -- (-3592.813) [-3589.973] (-3592.870) (-3606.891) * (-3613.576) (-3604.590) [-3596.587] (-3603.472) -- 0:06:09 Average standard deviation of split frequencies: 0.017353 290500 -- (-3600.891) [-3595.231] (-3592.144) (-3601.626) * (-3601.621) (-3593.103) [-3594.382] (-3599.126) -- 0:06:08 291000 -- (-3593.444) (-3595.172) (-3595.046) [-3594.162] * (-3611.197) [-3593.657] (-3591.790) (-3592.046) -- 0:06:10 291500 -- (-3596.084) (-3599.954) [-3592.275] (-3593.210) * [-3596.416] (-3600.318) (-3596.889) (-3597.448) -- 0:06:09 292000 -- [-3591.264] (-3594.376) (-3597.721) (-3596.351) * [-3593.355] (-3593.738) (-3596.488) (-3598.682) -- 0:06:08 292500 -- [-3594.242] (-3597.305) (-3595.100) (-3604.740) * (-3608.477) (-3600.450) (-3597.368) [-3601.522] -- 0:06:07 293000 -- (-3597.382) (-3605.430) [-3596.328] (-3596.961) * [-3594.629] (-3598.674) (-3599.467) (-3592.462) -- 0:06:09 293500 -- (-3592.146) [-3599.682] (-3588.972) (-3599.923) * (-3590.799) (-3589.615) [-3589.051] (-3592.367) -- 0:06:08 294000 -- (-3603.409) (-3593.510) (-3591.791) [-3593.980] * (-3592.934) (-3591.971) [-3598.175] (-3594.546) -- 0:06:07 294500 -- [-3590.126] (-3598.191) (-3590.065) (-3597.828) * [-3592.220] (-3603.420) (-3589.604) (-3589.872) -- 0:06:08 295000 -- [-3596.522] (-3597.335) (-3597.982) (-3592.400) * [-3593.807] (-3602.091) (-3595.068) (-3591.082) -- 0:06:08 Average standard deviation of split frequencies: 0.018155 295500 -- [-3596.821] (-3591.781) (-3600.547) (-3607.962) * (-3595.539) (-3592.582) (-3603.732) [-3597.482] -- 0:06:07 296000 -- (-3594.261) (-3606.323) [-3594.533] (-3591.356) * [-3595.540] (-3596.783) (-3600.123) (-3592.878) -- 0:06:06 296500 -- [-3599.392] (-3600.453) (-3604.411) (-3599.944) * (-3598.402) [-3604.482] (-3598.947) (-3599.586) -- 0:06:07 297000 -- [-3592.693] (-3589.124) (-3599.285) (-3603.886) * (-3592.753) [-3588.065] (-3595.914) (-3588.764) -- 0:06:06 297500 -- (-3596.456) [-3598.077] (-3594.547) (-3595.158) * [-3593.325] (-3599.560) (-3603.155) (-3589.250) -- 0:06:06 298000 -- (-3598.613) [-3585.686] (-3607.134) (-3606.308) * [-3589.015] (-3595.487) (-3593.366) (-3595.462) -- 0:06:05 298500 -- [-3589.962] (-3593.684) (-3600.834) (-3596.731) * (-3591.614) [-3598.879] (-3592.416) (-3600.977) -- 0:06:06 299000 -- [-3588.370] (-3596.042) (-3598.555) (-3594.486) * (-3602.911) (-3608.378) (-3596.137) [-3597.367] -- 0:06:05 299500 -- (-3603.886) (-3601.727) (-3598.357) [-3595.309] * (-3587.074) (-3605.236) (-3598.778) [-3587.163] -- 0:06:04 300000 -- (-3601.361) (-3595.973) [-3596.597] (-3594.201) * [-3587.872] (-3600.675) (-3605.040) (-3599.538) -- 0:06:03 Average standard deviation of split frequencies: 0.018344 300500 -- [-3599.700] (-3597.909) (-3604.546) (-3604.316) * (-3593.969) (-3601.964) [-3595.251] (-3595.756) -- 0:06:05 301000 -- (-3587.604) (-3598.419) (-3596.779) [-3597.167] * (-3602.356) [-3594.522] (-3597.953) (-3597.525) -- 0:06:04 301500 -- (-3592.973) (-3607.212) (-3601.410) [-3588.537] * (-3597.610) [-3591.320] (-3592.524) (-3603.783) -- 0:06:03 302000 -- (-3603.690) (-3595.101) (-3599.906) [-3591.103] * [-3592.076] (-3596.695) (-3602.796) (-3597.053) -- 0:06:02 302500 -- (-3589.631) (-3590.383) [-3602.549] (-3595.690) * (-3592.028) (-3600.060) (-3606.034) [-3593.073] -- 0:06:04 303000 -- [-3593.877] (-3600.350) (-3595.212) (-3590.895) * (-3598.281) (-3610.919) (-3602.981) [-3596.729] -- 0:06:03 303500 -- [-3593.816] (-3592.497) (-3600.940) (-3592.124) * [-3591.316] (-3599.207) (-3603.479) (-3591.434) -- 0:06:02 304000 -- (-3601.975) (-3594.958) [-3598.792] (-3591.054) * (-3600.290) (-3589.427) [-3594.534] (-3593.425) -- 0:06:01 304500 -- (-3590.796) [-3594.736] (-3598.530) (-3590.188) * (-3605.571) (-3589.907) [-3592.824] (-3597.020) -- 0:06:03 305000 -- (-3600.562) (-3599.593) (-3595.451) [-3586.378] * (-3603.075) (-3595.788) (-3606.679) [-3593.378] -- 0:06:02 Average standard deviation of split frequencies: 0.018949 305500 -- (-3602.894) (-3597.203) (-3604.151) [-3594.152] * [-3594.719] (-3600.652) (-3605.003) (-3598.246) -- 0:06:01 306000 -- (-3593.745) (-3597.598) (-3604.271) [-3595.387] * (-3600.052) (-3603.264) [-3597.804] (-3592.963) -- 0:06:02 306500 -- (-3588.624) (-3598.180) (-3594.593) [-3588.024] * (-3591.293) (-3608.216) [-3588.740] (-3600.834) -- 0:06:02 307000 -- (-3595.750) (-3592.146) (-3590.761) [-3596.900] * [-3597.076] (-3605.927) (-3594.349) (-3594.726) -- 0:06:01 307500 -- [-3594.203] (-3604.766) (-3593.729) (-3595.988) * (-3599.722) (-3603.638) [-3598.401] (-3598.350) -- 0:06:00 308000 -- (-3593.103) (-3590.141) (-3596.059) [-3585.981] * [-3593.172] (-3592.480) (-3593.311) (-3596.274) -- 0:06:01 308500 -- [-3589.040] (-3596.101) (-3592.822) (-3598.188) * (-3587.226) [-3601.578] (-3597.873) (-3594.183) -- 0:06:00 309000 -- (-3597.283) (-3592.336) [-3595.446] (-3599.294) * [-3591.919] (-3607.609) (-3595.009) (-3596.550) -- 0:06:00 309500 -- (-3596.619) (-3601.699) [-3594.333] (-3595.508) * (-3592.841) (-3597.759) (-3592.983) [-3600.848] -- 0:05:59 310000 -- [-3600.313] (-3594.787) (-3607.562) (-3604.212) * (-3591.911) (-3588.561) (-3591.001) [-3602.113] -- 0:06:00 Average standard deviation of split frequencies: 0.017602 310500 -- (-3594.551) (-3599.554) [-3591.786] (-3608.040) * (-3592.371) (-3594.085) [-3587.892] (-3593.928) -- 0:05:59 311000 -- (-3598.691) [-3590.093] (-3596.287) (-3590.209) * (-3593.432) (-3597.425) (-3598.195) [-3595.431] -- 0:05:58 311500 -- (-3594.005) [-3588.760] (-3600.839) (-3588.592) * (-3593.125) (-3591.342) (-3591.738) [-3594.346] -- 0:05:58 312000 -- (-3603.032) [-3589.666] (-3592.792) (-3592.444) * [-3593.996] (-3598.578) (-3595.432) (-3607.599) -- 0:05:59 312500 -- [-3591.252] (-3591.747) (-3604.209) (-3597.983) * [-3593.311] (-3599.489) (-3595.841) (-3593.227) -- 0:05:58 313000 -- (-3591.269) [-3603.732] (-3599.445) (-3599.181) * [-3595.233] (-3594.554) (-3592.856) (-3591.137) -- 0:05:57 313500 -- (-3584.502) (-3593.244) (-3597.889) [-3592.906] * (-3588.774) [-3597.426] (-3592.343) (-3590.996) -- 0:05:56 314000 -- (-3590.310) [-3592.604] (-3601.184) (-3593.578) * [-3590.964] (-3591.461) (-3601.123) (-3601.445) -- 0:05:58 314500 -- (-3593.632) (-3609.863) (-3590.099) [-3593.664] * [-3592.713] (-3594.199) (-3593.731) (-3594.239) -- 0:05:57 315000 -- (-3596.386) (-3599.062) (-3589.649) [-3593.930] * [-3593.270] (-3592.706) (-3593.264) (-3612.738) -- 0:05:56 Average standard deviation of split frequencies: 0.016410 315500 -- (-3590.035) (-3596.076) [-3592.310] (-3598.614) * (-3594.263) [-3596.886] (-3597.662) (-3590.638) -- 0:05:55 316000 -- (-3592.540) [-3597.933] (-3604.727) (-3596.640) * [-3603.502] (-3597.451) (-3604.821) (-3598.760) -- 0:05:57 316500 -- [-3590.291] (-3595.519) (-3609.126) (-3604.143) * (-3601.265) (-3598.847) (-3593.902) [-3591.177] -- 0:05:56 317000 -- (-3592.644) [-3589.136] (-3605.537) (-3597.752) * (-3593.958) (-3589.647) (-3604.399) [-3590.442] -- 0:05:55 317500 -- (-3596.285) (-3593.678) (-3591.712) [-3595.161] * (-3598.870) (-3598.883) [-3596.681] (-3597.600) -- 0:05:56 318000 -- (-3596.838) (-3599.110) [-3600.327] (-3601.243) * [-3600.908] (-3591.179) (-3590.654) (-3596.548) -- 0:05:56 318500 -- (-3597.352) [-3594.580] (-3605.773) (-3599.253) * [-3601.135] (-3592.030) (-3607.146) (-3599.154) -- 0:05:55 319000 -- (-3589.207) (-3589.723) [-3591.122] (-3606.852) * (-3598.070) (-3589.935) [-3591.197] (-3602.987) -- 0:05:54 319500 -- (-3602.413) [-3594.705] (-3594.044) (-3605.581) * (-3600.968) (-3609.125) [-3592.708] (-3595.181) -- 0:05:55 320000 -- (-3602.181) (-3594.572) (-3592.506) [-3600.121] * (-3605.086) (-3597.947) (-3594.306) [-3590.871] -- 0:05:54 Average standard deviation of split frequencies: 0.016906 320500 -- (-3597.203) [-3606.392] (-3598.364) (-3604.292) * (-3590.069) [-3596.765] (-3598.939) (-3602.000) -- 0:05:54 321000 -- [-3595.789] (-3598.650) (-3593.103) (-3599.561) * (-3593.612) [-3595.333] (-3601.890) (-3591.131) -- 0:05:53 321500 -- (-3598.698) (-3594.250) (-3598.012) [-3591.670] * (-3594.936) [-3593.280] (-3598.371) (-3590.337) -- 0:05:54 322000 -- (-3596.527) [-3588.220] (-3605.176) (-3594.522) * (-3593.174) (-3590.112) (-3599.350) [-3589.928] -- 0:05:53 322500 -- (-3599.745) (-3596.716) (-3598.614) [-3594.416] * (-3593.389) [-3594.342] (-3593.826) (-3595.849) -- 0:05:52 323000 -- [-3592.005] (-3589.984) (-3594.361) (-3604.118) * [-3593.230] (-3596.717) (-3595.691) (-3602.628) -- 0:05:54 323500 -- [-3594.207] (-3594.959) (-3600.541) (-3593.815) * (-3599.477) (-3594.625) [-3589.408] (-3593.714) -- 0:05:53 324000 -- [-3597.452] (-3602.365) (-3597.488) (-3593.811) * [-3600.517] (-3604.335) (-3603.873) (-3606.813) -- 0:05:52 324500 -- (-3595.502) (-3593.419) (-3601.974) [-3589.898] * (-3594.661) (-3613.264) (-3595.802) [-3597.750] -- 0:05:51 325000 -- [-3591.279] (-3603.178) (-3596.199) (-3593.101) * (-3595.421) (-3596.045) (-3596.680) [-3596.310] -- 0:05:53 Average standard deviation of split frequencies: 0.016629 325500 -- (-3594.838) (-3596.589) (-3588.877) [-3589.969] * (-3597.259) (-3592.025) [-3596.210] (-3600.071) -- 0:05:52 326000 -- (-3602.354) (-3601.631) [-3594.138] (-3590.822) * (-3593.436) [-3598.911] (-3597.372) (-3591.501) -- 0:05:51 326500 -- (-3597.740) [-3592.320] (-3596.184) (-3598.914) * (-3597.941) [-3593.971] (-3598.550) (-3597.390) -- 0:05:50 327000 -- (-3601.003) (-3592.571) [-3588.234] (-3600.295) * (-3596.201) [-3594.553] (-3596.092) (-3598.746) -- 0:05:51 327500 -- [-3594.190] (-3611.232) (-3593.333) (-3593.883) * (-3606.089) (-3597.446) [-3595.022] (-3601.012) -- 0:05:51 328000 -- (-3596.178) [-3598.998] (-3589.745) (-3598.645) * (-3592.367) (-3593.674) (-3602.194) [-3589.189] -- 0:05:50 328500 -- (-3591.570) [-3590.709] (-3599.417) (-3596.284) * (-3602.566) [-3591.164] (-3600.143) (-3594.659) -- 0:05:51 329000 -- (-3599.703) [-3597.844] (-3597.980) (-3603.120) * (-3598.960) [-3591.878] (-3609.723) (-3596.995) -- 0:05:50 329500 -- [-3604.968] (-3598.875) (-3593.736) (-3590.616) * [-3591.556] (-3595.119) (-3598.739) (-3600.574) -- 0:05:50 330000 -- (-3597.255) (-3592.505) (-3592.474) [-3594.541] * (-3599.697) (-3605.108) (-3593.600) [-3592.054] -- 0:05:49 Average standard deviation of split frequencies: 0.014114 330500 -- (-3598.112) (-3594.887) [-3591.128] (-3598.172) * (-3602.446) (-3593.943) [-3596.223] (-3590.663) -- 0:05:50 331000 -- [-3593.879] (-3602.096) (-3604.452) (-3601.940) * (-3600.880) [-3595.989] (-3600.569) (-3599.129) -- 0:05:49 331500 -- (-3603.285) [-3592.113] (-3605.893) (-3595.055) * (-3599.964) [-3590.665] (-3594.249) (-3594.578) -- 0:05:48 332000 -- (-3595.888) [-3595.679] (-3596.696) (-3596.905) * [-3590.349] (-3595.152) (-3591.279) (-3601.114) -- 0:05:48 332500 -- (-3598.583) [-3594.140] (-3593.488) (-3594.466) * [-3593.205] (-3596.517) (-3601.101) (-3596.013) -- 0:05:49 333000 -- (-3591.850) (-3594.131) [-3601.277] (-3596.373) * (-3594.771) [-3590.247] (-3592.585) (-3596.003) -- 0:05:48 333500 -- (-3594.301) [-3594.931] (-3596.624) (-3592.687) * (-3588.832) [-3585.841] (-3605.524) (-3594.352) -- 0:05:47 334000 -- (-3610.125) (-3591.398) [-3592.924] (-3595.339) * (-3594.059) [-3593.293] (-3598.306) (-3606.707) -- 0:05:46 334500 -- (-3599.590) [-3588.867] (-3595.069) (-3595.551) * (-3597.325) [-3597.382] (-3600.263) (-3596.006) -- 0:05:48 335000 -- [-3608.967] (-3592.901) (-3601.329) (-3601.183) * (-3596.774) (-3597.090) [-3598.060] (-3595.383) -- 0:05:47 Average standard deviation of split frequencies: 0.014451 335500 -- (-3602.122) (-3605.810) [-3593.776] (-3591.397) * (-3594.416) [-3591.228] (-3602.424) (-3604.249) -- 0:05:46 336000 -- (-3605.076) (-3598.484) (-3592.434) [-3591.092] * (-3605.661) (-3595.589) (-3596.621) [-3597.910] -- 0:05:47 336500 -- (-3609.000) (-3598.116) (-3595.776) [-3592.498] * [-3592.598] (-3602.635) (-3590.300) (-3594.571) -- 0:05:47 337000 -- (-3601.571) (-3612.089) (-3595.605) [-3597.411] * [-3587.356] (-3591.552) (-3588.536) (-3594.046) -- 0:05:46 337500 -- (-3602.639) (-3596.475) (-3595.606) [-3596.665] * [-3593.026] (-3599.703) (-3596.331) (-3595.068) -- 0:05:45 338000 -- (-3601.954) (-3588.476) (-3603.322) [-3601.738] * (-3593.657) (-3597.745) (-3596.519) [-3594.348] -- 0:05:46 338500 -- (-3597.753) (-3592.006) (-3597.410) [-3599.949] * (-3595.086) (-3587.962) [-3588.374] (-3606.892) -- 0:05:45 339000 -- (-3596.356) (-3604.947) (-3595.984) [-3605.229] * (-3601.384) (-3593.871) (-3588.572) [-3593.533] -- 0:05:45 339500 -- [-3591.732] (-3597.952) (-3589.054) (-3601.264) * (-3600.093) (-3598.875) [-3594.000] (-3596.756) -- 0:05:46 340000 -- (-3601.024) (-3591.628) [-3588.663] (-3594.737) * (-3598.328) (-3591.696) [-3595.576] (-3593.011) -- 0:05:45 Average standard deviation of split frequencies: 0.014114 340500 -- [-3598.753] (-3585.441) (-3606.003) (-3611.790) * (-3612.041) (-3586.762) [-3590.332] (-3597.564) -- 0:05:44 341000 -- (-3599.923) [-3595.166] (-3595.724) (-3593.388) * (-3603.890) (-3590.721) [-3596.602] (-3591.617) -- 0:05:43 341500 -- [-3591.989] (-3600.330) (-3596.305) (-3591.015) * (-3605.202) (-3600.618) (-3602.623) [-3591.055] -- 0:05:45 342000 -- (-3597.344) (-3600.731) (-3589.641) [-3589.457] * (-3601.692) (-3590.650) (-3601.345) [-3594.434] -- 0:05:44 342500 -- (-3602.588) (-3598.557) [-3594.109] (-3586.864) * (-3593.484) (-3594.018) (-3597.435) [-3593.531] -- 0:05:43 343000 -- (-3596.421) [-3596.417] (-3607.735) (-3601.263) * (-3591.289) [-3586.975] (-3601.258) (-3597.346) -- 0:05:44 343500 -- (-3595.622) (-3592.534) (-3600.137) [-3594.014] * (-3602.386) [-3593.371] (-3596.544) (-3606.528) -- 0:05:44 344000 -- [-3590.078] (-3598.282) (-3600.155) (-3600.396) * [-3591.261] (-3598.482) (-3596.348) (-3591.971) -- 0:05:43 344500 -- [-3593.449] (-3596.594) (-3595.568) (-3602.013) * [-3593.292] (-3602.325) (-3594.447) (-3598.801) -- 0:05:42 345000 -- (-3611.568) (-3603.422) [-3593.309] (-3596.801) * [-3588.051] (-3593.376) (-3596.347) (-3593.563) -- 0:05:43 Average standard deviation of split frequencies: 0.012943 345500 -- [-3604.750] (-3602.508) (-3597.013) (-3596.638) * [-3592.582] (-3589.510) (-3597.420) (-3601.866) -- 0:05:42 346000 -- (-3595.779) (-3605.895) (-3589.100) [-3590.528] * [-3598.506] (-3593.564) (-3597.446) (-3599.808) -- 0:05:42 346500 -- (-3600.391) [-3601.544] (-3590.470) (-3600.621) * (-3596.940) (-3597.106) [-3599.576] (-3589.787) -- 0:05:41 347000 -- (-3595.315) [-3594.899] (-3598.259) (-3597.161) * (-3599.902) [-3589.069] (-3588.967) (-3587.219) -- 0:05:42 347500 -- (-3595.857) (-3598.926) [-3598.431] (-3596.687) * (-3594.003) (-3593.044) [-3590.316] (-3601.684) -- 0:05:41 348000 -- (-3609.232) (-3590.550) (-3600.165) [-3590.415] * (-3593.712) (-3600.138) [-3592.060] (-3600.496) -- 0:05:40 348500 -- (-3600.948) (-3589.291) (-3593.766) [-3591.880] * [-3594.770] (-3590.649) (-3599.457) (-3616.636) -- 0:05:40 349000 -- (-3600.130) (-3597.627) [-3601.651] (-3592.586) * [-3592.264] (-3590.253) (-3594.923) (-3595.643) -- 0:05:41 349500 -- (-3592.926) (-3596.945) [-3598.005] (-3601.402) * [-3592.473] (-3592.424) (-3596.908) (-3607.384) -- 0:05:40 350000 -- [-3595.319] (-3598.837) (-3603.075) (-3593.300) * [-3591.459] (-3596.435) (-3601.328) (-3595.550) -- 0:05:39 Average standard deviation of split frequencies: 0.011427 350500 -- (-3602.861) (-3609.949) [-3589.943] (-3591.620) * (-3612.104) [-3592.379] (-3588.998) (-3598.115) -- 0:05:40 351000 -- (-3596.533) (-3599.066) [-3591.337] (-3587.966) * (-3600.280) (-3595.060) [-3592.819] (-3604.263) -- 0:05:40 351500 -- (-3604.934) (-3595.061) [-3591.599] (-3600.936) * (-3598.349) [-3594.775] (-3593.612) (-3594.230) -- 0:05:39 352000 -- (-3600.144) [-3597.940] (-3604.510) (-3589.562) * (-3594.399) (-3597.865) [-3592.189] (-3588.674) -- 0:05:38 352500 -- (-3602.589) (-3587.581) [-3600.452] (-3594.905) * (-3603.578) [-3591.393] (-3601.444) (-3607.011) -- 0:05:39 353000 -- (-3592.541) [-3591.512] (-3594.053) (-3594.297) * (-3593.264) (-3592.387) (-3593.224) [-3601.269] -- 0:05:39 353500 -- (-3593.709) (-3601.834) [-3592.530] (-3597.929) * (-3596.588) (-3597.547) (-3591.670) [-3592.575] -- 0:05:38 354000 -- (-3594.289) [-3591.528] (-3592.898) (-3600.605) * (-3600.627) (-3595.973) [-3586.010] (-3602.292) -- 0:05:37 354500 -- [-3604.262] (-3591.536) (-3594.465) (-3593.258) * (-3599.130) (-3597.490) [-3591.751] (-3596.880) -- 0:05:38 355000 -- (-3597.655) [-3594.701] (-3601.268) (-3592.590) * (-3602.149) (-3595.430) [-3594.054] (-3596.653) -- 0:05:37 Average standard deviation of split frequencies: 0.013109 355500 -- (-3601.431) [-3588.648] (-3596.452) (-3603.119) * (-3589.653) [-3602.881] (-3598.634) (-3600.118) -- 0:05:37 356000 -- (-3603.141) (-3604.607) [-3588.595] (-3607.125) * [-3597.474] (-3598.560) (-3589.916) (-3593.438) -- 0:05:36 356500 -- [-3593.661] (-3592.431) (-3593.693) (-3606.079) * (-3595.110) (-3597.770) (-3598.723) [-3594.585] -- 0:05:37 357000 -- [-3591.346] (-3592.324) (-3600.387) (-3597.867) * (-3596.183) [-3589.299] (-3587.548) (-3598.741) -- 0:05:36 357500 -- (-3597.507) (-3595.059) (-3595.049) [-3597.327] * (-3586.738) [-3587.121] (-3592.821) (-3600.960) -- 0:05:36 358000 -- (-3592.084) (-3590.650) (-3596.849) [-3603.697] * (-3596.165) [-3593.278] (-3595.596) (-3595.939) -- 0:05:37 358500 -- (-3593.651) (-3590.002) (-3595.383) [-3594.442] * (-3595.606) [-3587.201] (-3597.290) (-3598.144) -- 0:05:36 359000 -- (-3587.765) (-3595.718) [-3588.050] (-3597.886) * (-3596.085) [-3594.405] (-3592.168) (-3602.790) -- 0:05:35 359500 -- (-3599.163) [-3588.755] (-3589.802) (-3607.210) * (-3594.779) (-3593.544) (-3599.450) [-3598.783] -- 0:05:34 360000 -- (-3587.511) (-3604.377) (-3594.957) [-3587.433] * (-3594.185) (-3592.499) [-3591.723] (-3603.235) -- 0:05:36 Average standard deviation of split frequencies: 0.013593 360500 -- (-3601.126) [-3595.694] (-3597.668) (-3593.449) * (-3597.391) (-3594.325) (-3598.915) [-3598.156] -- 0:05:35 361000 -- (-3597.197) [-3601.810] (-3594.102) (-3593.611) * [-3592.171] (-3592.202) (-3589.051) (-3608.024) -- 0:05:34 361500 -- (-3598.206) (-3590.061) (-3598.471) [-3595.527] * (-3590.997) [-3594.432] (-3595.527) (-3593.559) -- 0:05:33 362000 -- (-3598.457) [-3593.386] (-3594.790) (-3602.477) * [-3593.944] (-3597.391) (-3592.269) (-3591.376) -- 0:05:34 362500 -- [-3589.342] (-3597.221) (-3600.688) (-3600.993) * (-3590.227) (-3592.039) [-3600.479] (-3596.453) -- 0:05:34 363000 -- [-3591.644] (-3594.894) (-3602.933) (-3595.996) * (-3599.024) (-3601.360) [-3593.461] (-3588.503) -- 0:05:33 363500 -- (-3587.284) (-3600.781) (-3595.605) [-3602.311] * (-3597.665) [-3593.325] (-3594.387) (-3609.329) -- 0:05:32 364000 -- (-3597.615) (-3598.266) [-3590.735] (-3592.338) * [-3595.834] (-3587.976) (-3595.454) (-3596.571) -- 0:05:33 364500 -- (-3597.253) (-3598.092) (-3595.505) [-3593.093] * [-3597.277] (-3594.210) (-3599.088) (-3591.638) -- 0:05:33 365000 -- (-3594.234) (-3592.837) [-3592.959] (-3600.764) * (-3600.514) [-3594.162] (-3602.480) (-3596.627) -- 0:05:32 Average standard deviation of split frequencies: 0.011978 365500 -- (-3600.344) (-3594.269) [-3588.827] (-3602.874) * [-3598.807] (-3601.042) (-3600.110) (-3597.113) -- 0:05:31 366000 -- (-3596.635) [-3587.689] (-3594.096) (-3595.085) * [-3600.997] (-3596.719) (-3607.765) (-3592.266) -- 0:05:32 366500 -- (-3591.666) [-3594.126] (-3594.748) (-3593.313) * (-3593.665) [-3600.579] (-3597.152) (-3608.009) -- 0:05:31 367000 -- (-3587.468) (-3598.315) (-3606.458) [-3592.417] * (-3593.407) (-3604.299) (-3599.158) [-3590.634] -- 0:05:31 367500 -- (-3588.772) [-3600.269] (-3599.930) (-3597.024) * [-3594.127] (-3607.777) (-3595.858) (-3587.987) -- 0:05:32 368000 -- (-3598.169) (-3593.760) (-3606.718) [-3600.924] * (-3606.863) (-3597.657) (-3600.851) [-3589.779] -- 0:05:31 368500 -- (-3607.779) [-3594.730] (-3606.634) (-3600.502) * [-3599.664] (-3600.366) (-3592.719) (-3595.509) -- 0:05:30 369000 -- (-3598.399) [-3598.514] (-3603.062) (-3588.469) * (-3608.304) [-3592.659] (-3596.920) (-3595.682) -- 0:05:30 369500 -- [-3592.769] (-3599.531) (-3595.499) (-3594.806) * [-3600.592] (-3588.668) (-3594.929) (-3596.722) -- 0:05:31 370000 -- (-3596.687) (-3600.420) [-3595.159] (-3593.501) * (-3603.214) (-3599.494) (-3593.001) [-3591.854] -- 0:05:30 Average standard deviation of split frequencies: 0.011064 370500 -- (-3599.959) (-3599.095) [-3592.726] (-3592.943) * (-3605.162) [-3593.003] (-3598.447) (-3593.442) -- 0:05:29 371000 -- (-3593.260) (-3595.870) [-3593.173] (-3596.305) * (-3594.616) (-3604.671) (-3592.476) [-3597.235] -- 0:05:28 371500 -- (-3600.188) [-3593.647] (-3603.778) (-3604.578) * (-3597.207) (-3591.905) (-3603.430) [-3591.048] -- 0:05:29 372000 -- (-3600.901) (-3597.853) (-3607.761) [-3589.647] * [-3593.593] (-3596.835) (-3603.012) (-3589.966) -- 0:05:29 372500 -- (-3606.436) (-3599.157) (-3592.953) [-3595.891] * (-3593.462) [-3593.197] (-3593.112) (-3597.800) -- 0:05:28 373000 -- (-3613.832) (-3588.619) [-3590.738] (-3598.996) * [-3596.438] (-3602.601) (-3597.019) (-3590.292) -- 0:05:29 373500 -- (-3602.481) [-3595.006] (-3602.598) (-3591.117) * [-3597.293] (-3603.197) (-3597.804) (-3595.219) -- 0:05:28 374000 -- (-3603.486) (-3597.797) (-3600.991) [-3589.697] * (-3600.722) (-3594.281) [-3593.433] (-3594.209) -- 0:05:28 374500 -- (-3596.893) [-3595.923] (-3595.489) (-3592.686) * (-3600.583) [-3597.949] (-3597.996) (-3600.312) -- 0:05:29 375000 -- (-3587.784) (-3594.117) [-3593.846] (-3592.145) * (-3600.483) (-3599.553) (-3591.833) [-3593.248] -- 0:05:28 Average standard deviation of split frequencies: 0.009779 375500 -- (-3592.062) [-3590.969] (-3599.697) (-3601.764) * [-3600.444] (-3593.952) (-3601.928) (-3599.417) -- 0:05:27 376000 -- (-3606.714) [-3591.180] (-3594.041) (-3592.069) * (-3596.366) (-3587.839) [-3597.818] (-3599.192) -- 0:05:26 376500 -- (-3606.135) (-3590.154) (-3603.673) [-3595.110] * (-3592.718) (-3605.734) (-3601.839) [-3589.161] -- 0:05:27 377000 -- (-3608.931) (-3601.505) (-3602.987) [-3599.752] * (-3598.215) (-3605.914) [-3602.233] (-3590.456) -- 0:05:27 377500 -- (-3611.202) (-3597.267) [-3600.119] (-3603.711) * (-3600.139) [-3593.791] (-3594.668) (-3592.856) -- 0:05:26 378000 -- (-3594.452) (-3602.225) (-3604.044) [-3591.078] * (-3603.537) (-3599.724) [-3593.482] (-3593.425) -- 0:05:25 378500 -- [-3593.075] (-3601.353) (-3598.870) (-3594.424) * [-3599.330] (-3601.667) (-3605.429) (-3597.354) -- 0:05:26 379000 -- (-3594.451) (-3597.794) [-3594.716] (-3599.269) * (-3596.287) (-3600.624) (-3597.253) [-3596.408] -- 0:05:26 379500 -- (-3599.599) [-3596.331] (-3600.758) (-3595.754) * (-3602.055) [-3590.652] (-3597.258) (-3599.486) -- 0:05:25 380000 -- (-3599.358) [-3587.253] (-3591.832) (-3592.555) * (-3600.231) [-3596.714] (-3595.234) (-3609.927) -- 0:05:24 Average standard deviation of split frequencies: 0.008545 380500 -- (-3599.776) (-3595.902) [-3592.357] (-3600.046) * [-3588.844] (-3592.070) (-3595.882) (-3607.768) -- 0:05:25 381000 -- (-3599.471) (-3600.341) (-3607.877) [-3593.034] * [-3590.878] (-3603.463) (-3592.590) (-3606.151) -- 0:05:24 381500 -- [-3598.810] (-3597.983) (-3598.747) (-3595.503) * (-3591.477) (-3597.936) [-3602.462] (-3597.486) -- 0:05:24 382000 -- [-3594.620] (-3596.298) (-3593.863) (-3597.232) * (-3595.021) [-3602.474] (-3599.591) (-3596.742) -- 0:05:23 382500 -- (-3601.699) (-3594.854) [-3591.446] (-3599.715) * [-3596.526] (-3606.720) (-3595.934) (-3592.716) -- 0:05:24 383000 -- [-3594.717] (-3591.239) (-3591.398) (-3598.119) * (-3594.557) (-3611.042) (-3599.546) [-3586.761] -- 0:05:23 383500 -- (-3592.596) [-3596.572] (-3597.903) (-3601.807) * (-3593.712) (-3605.357) (-3590.524) [-3596.088] -- 0:05:23 384000 -- (-3594.286) (-3595.601) [-3595.707] (-3601.058) * [-3589.553] (-3590.923) (-3603.513) (-3597.649) -- 0:05:24 384500 -- [-3592.470] (-3597.452) (-3601.564) (-3592.029) * [-3591.977] (-3592.080) (-3592.394) (-3594.197) -- 0:05:23 385000 -- (-3598.077) [-3598.722] (-3606.954) (-3592.660) * (-3603.361) (-3596.993) [-3598.652] (-3603.892) -- 0:05:22 Average standard deviation of split frequencies: 0.008915 385500 -- (-3597.345) (-3595.247) (-3590.317) [-3583.896] * (-3601.930) (-3593.034) [-3594.866] (-3593.019) -- 0:05:21 386000 -- (-3601.784) [-3590.339] (-3596.557) (-3591.477) * (-3594.430) (-3592.916) (-3598.539) [-3594.187] -- 0:05:22 386500 -- [-3592.306] (-3592.797) (-3586.859) (-3589.454) * (-3595.041) [-3596.292] (-3597.220) (-3594.550) -- 0:05:22 387000 -- (-3598.271) [-3590.038] (-3589.906) (-3594.654) * (-3596.879) (-3592.070) (-3591.873) [-3590.347] -- 0:05:21 387500 -- (-3597.873) (-3596.571) (-3594.672) [-3597.569] * (-3598.993) (-3595.241) [-3587.339] (-3600.249) -- 0:05:20 388000 -- (-3593.943) (-3589.466) [-3596.382] (-3602.752) * (-3602.487) [-3598.082] (-3591.336) (-3596.372) -- 0:05:21 388500 -- (-3595.765) [-3587.893] (-3596.613) (-3600.818) * (-3598.949) (-3591.917) (-3602.149) [-3592.876] -- 0:05:21 389000 -- (-3591.029) [-3595.316] (-3599.394) (-3594.031) * [-3593.653] (-3598.739) (-3592.611) (-3600.563) -- 0:05:20 389500 -- [-3598.722] (-3606.647) (-3599.093) (-3589.555) * (-3591.087) (-3600.982) (-3606.388) [-3598.086] -- 0:05:19 390000 -- (-3602.024) (-3603.803) [-3600.748] (-3593.193) * (-3603.684) (-3595.678) (-3593.057) [-3590.511] -- 0:05:20 Average standard deviation of split frequencies: 0.008688 390500 -- (-3600.605) (-3603.597) [-3596.510] (-3588.320) * (-3604.465) (-3596.603) (-3594.995) [-3590.965] -- 0:05:19 391000 -- (-3601.036) (-3595.758) (-3588.369) [-3590.372] * (-3592.669) (-3597.786) [-3597.035] (-3594.587) -- 0:05:19 391500 -- (-3598.198) (-3595.244) [-3591.381] (-3600.698) * (-3592.791) (-3597.842) (-3590.787) [-3597.043] -- 0:05:18 392000 -- (-3595.035) [-3595.203] (-3594.013) (-3590.434) * (-3594.712) [-3595.415] (-3598.291) (-3594.882) -- 0:05:19 392500 -- [-3600.547] (-3595.075) (-3594.169) (-3599.478) * (-3599.717) [-3588.733] (-3599.197) (-3604.757) -- 0:05:18 393000 -- [-3584.146] (-3603.294) (-3609.999) (-3596.858) * [-3604.820] (-3590.877) (-3599.172) (-3598.634) -- 0:05:18 393500 -- [-3587.674] (-3591.826) (-3610.504) (-3595.735) * (-3594.345) [-3592.429] (-3595.293) (-3599.166) -- 0:05:19 394000 -- (-3603.237) (-3593.271) (-3601.030) [-3598.859] * (-3596.902) (-3604.509) (-3593.399) [-3590.466] -- 0:05:18 394500 -- (-3598.840) (-3606.169) [-3602.251] (-3608.177) * (-3598.337) (-3592.517) (-3596.052) [-3588.252] -- 0:05:17 395000 -- (-3606.772) (-3603.431) [-3593.550] (-3592.216) * (-3611.263) (-3597.746) (-3599.656) [-3596.479] -- 0:05:17 Average standard deviation of split frequencies: 0.008571 395500 -- (-3594.376) (-3605.080) (-3596.607) [-3592.663] * (-3596.981) (-3587.648) [-3596.293] (-3598.775) -- 0:05:17 396000 -- [-3596.168] (-3593.262) (-3601.518) (-3595.580) * (-3597.612) (-3599.212) [-3590.633] (-3606.165) -- 0:05:17 396500 -- (-3588.796) (-3597.749) [-3591.732] (-3602.393) * [-3597.074] (-3594.628) (-3597.855) (-3591.423) -- 0:05:16 397000 -- (-3601.945) (-3601.334) (-3595.731) [-3595.425] * [-3593.210] (-3598.879) (-3597.329) (-3598.666) -- 0:05:15 397500 -- [-3592.685] (-3601.448) (-3590.892) (-3593.667) * [-3592.465] (-3592.423) (-3598.453) (-3600.681) -- 0:05:16 398000 -- (-3604.241) (-3589.102) (-3599.126) [-3591.131] * (-3605.537) [-3592.779] (-3602.016) (-3590.641) -- 0:05:16 398500 -- [-3595.705] (-3602.795) (-3594.990) (-3588.541) * (-3597.336) (-3593.155) [-3588.435] (-3606.919) -- 0:05:15 399000 -- [-3590.155] (-3594.782) (-3603.681) (-3597.914) * (-3594.879) [-3588.927] (-3589.880) (-3601.632) -- 0:05:14 399500 -- (-3597.581) (-3589.691) (-3603.922) [-3592.181] * (-3610.253) [-3591.983] (-3593.297) (-3593.901) -- 0:05:15 400000 -- (-3600.443) (-3589.885) (-3597.735) [-3601.280] * [-3591.958] (-3593.801) (-3591.762) (-3596.273) -- 0:05:15 Average standard deviation of split frequencies: 0.009295 400500 -- (-3592.155) [-3596.088] (-3591.546) (-3597.348) * (-3594.980) [-3596.475] (-3596.267) (-3592.855) -- 0:05:14 401000 -- (-3588.871) [-3592.052] (-3597.067) (-3601.586) * (-3605.441) (-3598.820) [-3596.202] (-3595.012) -- 0:05:15 401500 -- (-3590.825) (-3601.363) (-3589.256) [-3591.546] * [-3594.908] (-3597.580) (-3587.699) (-3599.686) -- 0:05:14 402000 -- (-3596.803) (-3597.955) (-3598.342) [-3590.281] * (-3592.436) [-3598.590] (-3598.579) (-3601.457) -- 0:05:13 402500 -- (-3595.907) (-3592.380) (-3591.068) [-3591.502] * (-3590.630) (-3596.311) [-3594.471] (-3610.364) -- 0:05:13 403000 -- (-3600.393) (-3591.692) [-3594.217] (-3592.879) * (-3591.624) [-3599.509] (-3591.831) (-3599.614) -- 0:05:14 403500 -- (-3592.433) (-3597.687) (-3599.324) [-3592.279] * (-3596.130) [-3591.318] (-3605.622) (-3605.727) -- 0:05:13 404000 -- [-3593.638] (-3595.438) (-3587.940) (-3591.078) * [-3593.698] (-3588.318) (-3595.446) (-3593.752) -- 0:05:12 404500 -- (-3593.215) (-3595.045) (-3588.507) [-3594.629] * [-3591.358] (-3590.276) (-3605.152) (-3593.242) -- 0:05:12 405000 -- [-3591.177] (-3594.361) (-3606.280) (-3610.153) * (-3596.477) [-3594.929] (-3592.184) (-3601.968) -- 0:05:12 Average standard deviation of split frequencies: 0.007895 405500 -- (-3592.716) (-3599.476) (-3596.161) [-3587.770] * [-3592.306] (-3602.804) (-3594.678) (-3597.277) -- 0:05:12 406000 -- [-3594.156] (-3599.563) (-3593.909) (-3597.921) * (-3598.334) (-3594.254) [-3595.240] (-3597.641) -- 0:05:11 406500 -- (-3601.942) (-3603.561) [-3594.514] (-3593.182) * [-3597.741] (-3598.868) (-3608.353) (-3588.745) -- 0:05:10 407000 -- (-3596.370) (-3604.396) (-3601.253) [-3590.306] * [-3596.498] (-3597.928) (-3594.007) (-3593.696) -- 0:05:11 407500 -- [-3593.317] (-3589.409) (-3601.673) (-3597.852) * (-3594.537) [-3595.935] (-3593.891) (-3594.948) -- 0:05:11 408000 -- [-3596.983] (-3600.031) (-3594.699) (-3589.070) * (-3589.168) (-3606.493) (-3597.665) [-3592.641] -- 0:05:10 408500 -- (-3594.113) (-3603.605) [-3593.901] (-3596.763) * (-3600.103) [-3598.349] (-3596.888) (-3600.030) -- 0:05:09 409000 -- (-3595.005) [-3597.129] (-3603.296) (-3605.273) * (-3592.101) (-3599.152) (-3596.002) [-3603.203] -- 0:05:10 409500 -- [-3587.461] (-3598.385) (-3601.394) (-3600.216) * (-3594.938) (-3599.888) (-3595.505) [-3588.184] -- 0:05:10 410000 -- (-3600.911) (-3598.123) (-3594.309) [-3609.869] * (-3595.867) [-3594.337] (-3599.070) (-3597.911) -- 0:05:09 Average standard deviation of split frequencies: 0.008150 410500 -- [-3590.174] (-3605.297) (-3594.224) (-3594.491) * [-3608.797] (-3609.493) (-3600.066) (-3607.048) -- 0:05:10 411000 -- (-3600.598) (-3595.787) [-3595.794] (-3599.132) * (-3602.445) [-3595.559] (-3601.709) (-3588.648) -- 0:05:09 411500 -- (-3591.655) (-3595.077) [-3593.844] (-3598.784) * (-3598.812) (-3599.246) [-3591.770] (-3586.925) -- 0:05:08 412000 -- (-3594.916) (-3597.064) (-3596.662) [-3599.371] * (-3591.162) [-3593.472] (-3603.712) (-3595.045) -- 0:05:08 412500 -- [-3594.879] (-3595.296) (-3584.387) (-3593.952) * (-3591.375) [-3590.257] (-3599.193) (-3603.330) -- 0:05:09 413000 -- [-3591.410] (-3592.853) (-3594.983) (-3596.109) * [-3592.739] (-3597.237) (-3597.661) (-3608.438) -- 0:05:08 413500 -- (-3594.993) (-3596.641) (-3608.143) [-3590.414] * (-3599.676) (-3598.895) (-3594.540) [-3591.165] -- 0:05:07 414000 -- (-3604.529) [-3598.108] (-3597.969) (-3593.805) * (-3592.127) [-3592.091] (-3590.419) (-3594.763) -- 0:05:07 414500 -- (-3605.090) (-3606.453) (-3594.234) [-3595.293] * (-3593.572) (-3592.101) [-3603.898] (-3601.562) -- 0:05:07 415000 -- (-3596.327) [-3597.049] (-3603.011) (-3600.331) * (-3602.638) (-3598.149) [-3596.057] (-3599.533) -- 0:05:07 Average standard deviation of split frequencies: 0.006459 415500 -- (-3594.124) [-3592.008] (-3598.637) (-3590.997) * (-3596.783) [-3602.221] (-3593.497) (-3600.315) -- 0:05:06 416000 -- (-3592.189) (-3595.908) (-3597.882) [-3591.172] * [-3590.412] (-3597.812) (-3600.339) (-3597.297) -- 0:05:06 416500 -- [-3592.161] (-3592.124) (-3591.680) (-3590.818) * (-3599.950) [-3594.794] (-3598.157) (-3599.392) -- 0:05:06 417000 -- [-3590.074] (-3597.770) (-3595.390) (-3595.625) * (-3602.065) (-3604.056) (-3594.911) [-3594.547] -- 0:05:06 417500 -- (-3602.304) (-3595.353) [-3589.189] (-3593.349) * (-3592.606) (-3601.226) (-3590.581) [-3594.453] -- 0:05:05 418000 -- (-3597.937) [-3586.518] (-3595.708) (-3608.844) * (-3595.675) (-3599.861) (-3606.995) [-3593.658] -- 0:05:04 418500 -- [-3589.761] (-3594.285) (-3592.424) (-3604.479) * [-3587.974] (-3598.523) (-3598.691) (-3594.895) -- 0:05:05 419000 -- (-3591.892) [-3591.486] (-3590.513) (-3587.707) * (-3588.610) [-3600.075] (-3592.135) (-3598.710) -- 0:05:05 419500 -- (-3599.876) (-3600.814) (-3594.963) [-3599.202] * [-3593.332] (-3597.333) (-3596.844) (-3602.588) -- 0:05:04 420000 -- [-3597.509] (-3594.180) (-3591.638) (-3602.802) * (-3604.459) [-3596.427] (-3600.935) (-3606.933) -- 0:05:03 Average standard deviation of split frequencies: 0.006612 420500 -- (-3593.118) (-3589.975) (-3594.778) [-3601.422] * (-3611.829) (-3585.885) [-3596.681] (-3599.735) -- 0:05:04 421000 -- (-3593.907) (-3600.367) (-3605.523) [-3596.768] * (-3595.600) [-3590.066] (-3606.659) (-3604.101) -- 0:05:03 421500 -- (-3592.458) (-3590.096) [-3593.470] (-3595.637) * (-3599.828) (-3593.029) [-3605.619] (-3599.474) -- 0:05:03 422000 -- (-3592.020) [-3590.008] (-3598.089) (-3594.795) * (-3602.978) (-3596.840) [-3598.750] (-3589.108) -- 0:05:04 422500 -- (-3587.154) (-3594.099) [-3597.978] (-3598.836) * (-3595.090) [-3598.378] (-3592.889) (-3589.839) -- 0:05:03 423000 -- [-3609.816] (-3598.442) (-3597.982) (-3600.618) * (-3594.227) [-3593.567] (-3601.779) (-3598.392) -- 0:05:02 423500 -- [-3593.785] (-3596.933) (-3595.129) (-3595.331) * (-3600.015) (-3597.474) [-3597.301] (-3597.075) -- 0:05:02 424000 -- [-3591.729] (-3594.786) (-3595.180) (-3595.044) * (-3597.586) [-3591.868] (-3602.109) (-3604.565) -- 0:05:02 424500 -- (-3593.004) (-3602.200) (-3605.606) [-3606.421] * (-3597.145) (-3592.572) (-3593.895) [-3596.578] -- 0:05:02 425000 -- (-3591.428) [-3600.557] (-3602.111) (-3599.318) * (-3593.571) (-3591.239) (-3590.875) [-3592.945] -- 0:05:01 Average standard deviation of split frequencies: 0.006197 425500 -- (-3592.486) (-3597.105) [-3592.984] (-3597.307) * (-3603.609) (-3597.817) [-3594.379] (-3594.586) -- 0:05:01 426000 -- [-3590.053] (-3599.313) (-3593.160) (-3605.824) * (-3600.440) (-3589.472) [-3595.330] (-3593.553) -- 0:05:01 426500 -- [-3593.426] (-3599.035) (-3589.930) (-3597.890) * (-3593.040) (-3595.497) (-3597.586) [-3598.476] -- 0:05:01 427000 -- (-3595.093) (-3593.131) [-3589.937] (-3594.464) * [-3594.278] (-3590.178) (-3593.131) (-3596.675) -- 0:05:00 427500 -- (-3594.492) (-3599.435) (-3595.924) [-3593.021] * (-3590.787) (-3593.998) (-3596.887) [-3600.748] -- 0:04:59 428000 -- (-3592.350) (-3596.620) (-3611.517) [-3601.470] * [-3593.660] (-3598.407) (-3590.624) (-3603.107) -- 0:05:00 428500 -- (-3601.311) [-3593.602] (-3604.598) (-3597.270) * (-3595.788) [-3589.485] (-3594.326) (-3596.101) -- 0:05:00 429000 -- (-3596.336) (-3601.618) (-3607.145) [-3591.753] * [-3596.021] (-3599.460) (-3588.532) (-3592.485) -- 0:04:59 429500 -- (-3599.274) (-3588.268) (-3598.312) [-3594.307] * (-3603.888) (-3597.847) (-3592.184) [-3588.101] -- 0:04:58 430000 -- [-3598.558] (-3600.010) (-3592.643) (-3592.827) * (-3600.397) (-3599.206) [-3590.380] (-3600.410) -- 0:04:59 Average standard deviation of split frequencies: 0.005035 430500 -- (-3600.239) [-3595.187] (-3601.519) (-3591.220) * (-3595.594) (-3602.299) (-3596.421) [-3591.733] -- 0:04:58 431000 -- [-3596.680] (-3598.501) (-3607.815) (-3597.880) * (-3600.051) [-3606.416] (-3588.972) (-3598.895) -- 0:04:58 431500 -- (-3589.340) (-3592.191) (-3599.072) [-3587.071] * (-3593.286) [-3590.870] (-3600.495) (-3595.725) -- 0:04:59 432000 -- [-3597.038] (-3588.220) (-3601.382) (-3592.304) * (-3596.453) (-3596.496) [-3596.772] (-3594.827) -- 0:04:58 432500 -- (-3594.626) (-3597.584) (-3596.792) [-3588.457] * (-3592.621) (-3594.198) (-3591.070) [-3595.188] -- 0:04:57 433000 -- [-3588.365] (-3593.174) (-3597.032) (-3595.804) * (-3589.285) [-3589.537] (-3593.279) (-3591.684) -- 0:04:57 433500 -- [-3595.690] (-3589.906) (-3605.082) (-3594.624) * (-3610.491) (-3586.954) [-3592.694] (-3592.737) -- 0:04:57 434000 -- (-3589.878) (-3600.936) [-3598.138] (-3609.209) * (-3597.107) [-3589.825] (-3594.901) (-3590.456) -- 0:04:57 434500 -- (-3597.790) [-3590.946] (-3603.052) (-3592.356) * (-3601.779) (-3604.130) (-3590.461) [-3591.071] -- 0:04:56 435000 -- [-3591.603] (-3596.110) (-3596.868) (-3597.651) * (-3592.112) [-3591.334] (-3593.064) (-3597.744) -- 0:04:56 Average standard deviation of split frequencies: 0.006163 435500 -- (-3594.341) (-3596.322) (-3595.979) [-3594.236] * [-3594.750] (-3604.281) (-3598.824) (-3597.398) -- 0:04:56 436000 -- (-3602.694) [-3592.481] (-3594.005) (-3589.041) * [-3587.568] (-3598.352) (-3613.637) (-3591.591) -- 0:04:56 436500 -- (-3601.144) (-3599.250) (-3603.600) [-3599.501] * (-3591.401) (-3592.359) (-3602.346) [-3598.166] -- 0:04:55 437000 -- [-3593.026] (-3593.762) (-3604.742) (-3593.152) * [-3592.042] (-3594.189) (-3591.802) (-3594.420) -- 0:04:55 437500 -- (-3595.198) (-3592.909) [-3591.034] (-3597.697) * [-3607.320] (-3594.741) (-3588.757) (-3599.197) -- 0:04:55 438000 -- [-3593.298] (-3591.424) (-3602.489) (-3594.291) * [-3595.965] (-3593.182) (-3598.938) (-3608.476) -- 0:04:55 438500 -- (-3594.424) [-3591.245] (-3597.957) (-3590.545) * [-3589.763] (-3595.704) (-3600.956) (-3599.031) -- 0:04:54 439000 -- (-3603.101) [-3590.579] (-3597.400) (-3596.893) * (-3591.597) (-3601.275) [-3590.881] (-3597.137) -- 0:04:53 439500 -- (-3600.229) [-3593.894] (-3597.270) (-3595.897) * (-3587.967) (-3593.609) (-3596.561) [-3595.186] -- 0:04:54 440000 -- (-3600.489) (-3603.215) (-3592.669) [-3595.549] * (-3588.834) (-3593.126) (-3605.978) [-3593.370] -- 0:04:54 Average standard deviation of split frequencies: 0.005777 440500 -- (-3594.996) (-3597.430) [-3591.498] (-3598.503) * [-3597.117] (-3604.644) (-3597.162) (-3594.630) -- 0:04:53 441000 -- [-3589.801] (-3595.319) (-3600.751) (-3608.140) * (-3593.440) (-3597.562) [-3591.407] (-3590.250) -- 0:04:54 441500 -- [-3592.166] (-3592.090) (-3603.363) (-3595.881) * [-3594.071] (-3601.908) (-3592.210) (-3594.613) -- 0:04:53 442000 -- (-3589.929) (-3602.707) [-3593.044] (-3603.394) * [-3598.323] (-3593.938) (-3596.297) (-3596.755) -- 0:04:52 442500 -- [-3595.781] (-3588.795) (-3595.365) (-3601.564) * (-3594.688) (-3598.655) [-3602.070] (-3592.957) -- 0:04:52 443000 -- [-3593.607] (-3594.831) (-3597.160) (-3610.875) * [-3598.312] (-3601.391) (-3591.736) (-3594.443) -- 0:04:52 443500 -- (-3603.519) (-3599.725) [-3590.827] (-3597.691) * (-3596.469) (-3605.310) [-3591.390] (-3590.924) -- 0:04:52 444000 -- (-3590.883) (-3590.251) (-3599.491) [-3595.851] * (-3597.042) [-3594.598] (-3596.613) (-3594.205) -- 0:04:51 444500 -- (-3597.831) (-3596.871) (-3592.557) [-3588.520] * (-3597.050) [-3594.956] (-3598.991) (-3592.414) -- 0:04:51 445000 -- [-3597.603] (-3598.983) (-3589.618) (-3592.992) * (-3594.877) (-3602.858) (-3587.694) [-3587.957] -- 0:04:51 Average standard deviation of split frequencies: 0.005813 445500 -- [-3595.456] (-3594.324) (-3590.138) (-3590.568) * (-3598.502) (-3591.509) (-3598.362) [-3593.447] -- 0:04:51 446000 -- [-3592.516] (-3594.741) (-3594.131) (-3592.688) * (-3599.710) (-3605.387) (-3598.942) [-3599.969] -- 0:04:50 446500 -- [-3596.455] (-3593.341) (-3599.212) (-3603.623) * (-3600.545) [-3599.905] (-3597.355) (-3598.950) -- 0:04:50 447000 -- [-3594.878] (-3601.457) (-3591.865) (-3592.460) * [-3596.590] (-3602.621) (-3598.251) (-3604.911) -- 0:04:50 447500 -- [-3602.449] (-3593.062) (-3596.916) (-3595.894) * (-3596.707) (-3593.322) [-3600.958] (-3600.632) -- 0:04:50 448000 -- (-3594.236) [-3598.029] (-3602.043) (-3596.457) * (-3594.213) (-3598.306) [-3599.457] (-3595.592) -- 0:04:49 448500 -- [-3593.240] (-3597.946) (-3593.515) (-3594.151) * (-3603.739) (-3602.657) (-3596.867) [-3593.860] -- 0:04:48 449000 -- [-3597.750] (-3595.268) (-3595.843) (-3595.585) * [-3592.899] (-3604.588) (-3594.701) (-3591.981) -- 0:04:49 449500 -- [-3597.642] (-3593.147) (-3589.383) (-3591.456) * (-3593.981) (-3596.594) (-3602.679) [-3589.076] -- 0:04:49 450000 -- [-3598.588] (-3589.926) (-3596.558) (-3594.320) * (-3596.864) [-3592.162] (-3599.437) (-3592.404) -- 0:04:48 Average standard deviation of split frequencies: 0.005962 450500 -- (-3603.774) (-3591.716) [-3593.282] (-3592.867) * (-3594.158) [-3595.655] (-3606.762) (-3591.979) -- 0:04:49 451000 -- [-3594.279] (-3596.067) (-3597.984) (-3591.808) * (-3592.075) [-3589.035] (-3614.131) (-3596.403) -- 0:04:48 451500 -- (-3592.104) [-3593.287] (-3597.574) (-3602.290) * (-3594.409) [-3594.475] (-3593.008) (-3593.662) -- 0:04:47 452000 -- (-3597.249) [-3587.798] (-3597.100) (-3598.287) * (-3599.394) (-3594.086) [-3599.496] (-3593.931) -- 0:04:47 452500 -- (-3609.468) [-3596.971] (-3593.836) (-3593.044) * (-3593.135) [-3597.767] (-3601.184) (-3602.823) -- 0:04:47 453000 -- [-3596.036] (-3601.275) (-3605.909) (-3602.302) * [-3594.456] (-3599.152) (-3597.106) (-3595.538) -- 0:04:47 453500 -- (-3587.006) [-3590.075] (-3592.897) (-3600.165) * [-3594.499] (-3596.784) (-3606.368) (-3596.177) -- 0:04:46 454000 -- (-3592.671) [-3594.331] (-3592.570) (-3593.900) * (-3590.364) [-3594.376] (-3598.582) (-3593.531) -- 0:04:46 454500 -- (-3604.161) [-3588.788] (-3602.319) (-3595.538) * (-3594.429) [-3596.168] (-3592.287) (-3590.027) -- 0:04:46 455000 -- (-3598.643) [-3595.770] (-3599.308) (-3600.240) * [-3589.383] (-3600.682) (-3593.966) (-3600.670) -- 0:04:46 Average standard deviation of split frequencies: 0.006409 455500 -- (-3593.087) (-3591.629) (-3593.021) [-3600.764] * (-3599.397) (-3595.689) [-3600.891] (-3588.490) -- 0:04:45 456000 -- (-3597.889) (-3598.069) (-3594.648) [-3589.822] * (-3595.392) (-3596.589) [-3591.166] (-3599.588) -- 0:04:45 456500 -- (-3596.001) (-3604.314) (-3595.974) [-3586.233] * [-3597.846] (-3606.903) (-3595.655) (-3603.477) -- 0:04:45 457000 -- [-3591.796] (-3593.883) (-3609.268) (-3589.719) * (-3607.933) [-3600.440] (-3591.068) (-3604.540) -- 0:04:45 457500 -- (-3597.162) (-3593.144) (-3593.235) [-3589.344] * (-3596.828) (-3609.726) [-3589.055] (-3607.399) -- 0:04:44 458000 -- [-3594.074] (-3597.565) (-3596.788) (-3596.892) * [-3589.531] (-3612.170) (-3598.165) (-3607.379) -- 0:04:44 458500 -- (-3600.847) (-3601.259) [-3593.976] (-3610.948) * [-3590.929] (-3597.301) (-3611.143) (-3605.009) -- 0:04:44 459000 -- [-3591.478] (-3594.486) (-3598.664) (-3595.365) * (-3599.667) (-3597.480) [-3600.687] (-3597.223) -- 0:04:44 459500 -- [-3584.482] (-3594.817) (-3596.592) (-3596.826) * [-3594.771] (-3598.737) (-3606.072) (-3600.856) -- 0:04:43 460000 -- [-3596.020] (-3593.439) (-3594.824) (-3600.376) * (-3590.245) [-3603.144] (-3599.953) (-3602.112) -- 0:04:42 Average standard deviation of split frequencies: 0.005424 460500 -- [-3590.953] (-3600.226) (-3594.554) (-3602.889) * (-3599.342) [-3588.841] (-3599.830) (-3596.581) -- 0:04:43 461000 -- (-3602.200) (-3593.904) (-3597.885) [-3591.017] * (-3599.491) [-3596.583] (-3602.989) (-3592.666) -- 0:04:42 461500 -- (-3596.986) (-3607.782) (-3591.790) [-3595.195] * (-3594.679) [-3595.612] (-3604.471) (-3589.657) -- 0:04:42 462000 -- (-3590.438) [-3597.711] (-3598.438) (-3602.360) * (-3592.517) (-3592.934) [-3590.483] (-3594.704) -- 0:04:42 462500 -- [-3600.082] (-3600.631) (-3604.685) (-3600.657) * (-3605.014) [-3593.350] (-3592.063) (-3594.025) -- 0:04:42 463000 -- [-3595.708] (-3606.413) (-3604.598) (-3596.287) * [-3591.441] (-3594.249) (-3596.605) (-3600.164) -- 0:04:41 463500 -- (-3592.773) [-3601.902] (-3592.299) (-3591.140) * (-3599.652) [-3588.566] (-3594.668) (-3606.389) -- 0:04:41 464000 -- (-3606.251) [-3601.738] (-3594.682) (-3595.578) * (-3599.613) (-3598.684) [-3591.902] (-3591.395) -- 0:04:41 464500 -- [-3593.510] (-3601.340) (-3588.839) (-3592.823) * (-3603.535) [-3592.172] (-3594.465) (-3587.544) -- 0:04:41 465000 -- (-3598.100) (-3600.523) (-3595.337) [-3592.516] * (-3606.546) (-3596.538) (-3596.431) [-3598.454] -- 0:04:40 Average standard deviation of split frequencies: 0.004350 465500 -- (-3596.274) (-3589.111) (-3599.241) [-3598.594] * (-3592.850) (-3604.251) (-3600.133) [-3589.445] -- 0:04:40 466000 -- [-3590.605] (-3593.101) (-3606.139) (-3596.927) * [-3586.813] (-3593.656) (-3594.669) (-3590.268) -- 0:04:40 466500 -- (-3599.889) (-3602.527) [-3592.890] (-3599.551) * (-3606.789) (-3597.739) (-3601.572) [-3596.038] -- 0:04:40 467000 -- (-3590.937) [-3592.377] (-3600.787) (-3593.786) * (-3600.337) [-3594.428] (-3596.713) (-3604.810) -- 0:04:39 467500 -- (-3588.843) (-3592.473) (-3597.349) [-3594.974] * (-3601.950) (-3599.585) (-3593.521) [-3590.701] -- 0:04:39 468000 -- (-3602.241) (-3597.444) (-3597.331) [-3599.153] * (-3594.751) (-3596.803) [-3593.782] (-3602.047) -- 0:04:39 468500 -- (-3594.676) [-3596.176] (-3599.892) (-3601.578) * (-3599.450) [-3592.531] (-3596.640) (-3603.219) -- 0:04:39 469000 -- (-3599.911) (-3595.389) [-3591.212] (-3595.402) * (-3608.735) (-3601.942) [-3601.640] (-3604.507) -- 0:04:38 469500 -- (-3596.339) (-3595.148) (-3593.988) [-3594.074] * (-3597.680) [-3602.244] (-3588.764) (-3592.761) -- 0:04:37 470000 -- (-3600.841) (-3593.172) (-3594.330) [-3593.367] * [-3594.057] (-3599.397) (-3600.668) (-3603.295) -- 0:04:38 Average standard deviation of split frequencies: 0.003806 470500 -- (-3596.942) (-3596.963) (-3593.557) [-3598.932] * (-3603.482) (-3607.065) [-3593.990] (-3612.650) -- 0:04:37 471000 -- (-3599.388) (-3598.868) (-3596.868) [-3604.459] * [-3599.795] (-3601.610) (-3608.223) (-3603.245) -- 0:04:37 471500 -- (-3592.238) (-3592.953) [-3589.773] (-3604.000) * [-3600.200] (-3595.699) (-3596.792) (-3600.941) -- 0:04:36 472000 -- [-3598.138] (-3591.901) (-3607.005) (-3597.140) * (-3600.028) (-3595.385) (-3600.906) [-3600.904] -- 0:04:37 472500 -- (-3595.696) (-3602.890) [-3590.922] (-3596.538) * [-3587.532] (-3595.163) (-3594.911) (-3592.362) -- 0:04:36 473000 -- (-3607.455) [-3594.347] (-3592.500) (-3597.275) * (-3603.548) (-3594.758) [-3599.451] (-3599.773) -- 0:04:36 473500 -- (-3605.898) (-3595.149) (-3594.510) [-3588.328] * (-3596.230) (-3597.411) [-3604.623] (-3593.814) -- 0:04:36 474000 -- (-3599.142) [-3592.542] (-3596.543) (-3592.006) * [-3592.409] (-3600.872) (-3603.303) (-3596.369) -- 0:04:36 474500 -- (-3601.987) [-3596.720] (-3591.964) (-3598.698) * (-3595.914) (-3594.162) (-3598.022) [-3595.740] -- 0:04:35 475000 -- [-3594.516] (-3601.192) (-3601.061) (-3597.054) * (-3599.460) (-3593.799) (-3597.257) [-3588.506] -- 0:04:35 Average standard deviation of split frequencies: 0.002971 475500 -- (-3600.853) [-3596.048] (-3603.376) (-3597.977) * [-3592.999] (-3597.528) (-3607.713) (-3597.832) -- 0:04:35 476000 -- (-3594.607) (-3591.130) (-3589.276) [-3596.085] * [-3590.526] (-3598.988) (-3598.702) (-3591.983) -- 0:04:35 476500 -- (-3588.589) (-3600.532) [-3587.732] (-3601.410) * (-3593.718) [-3598.592] (-3595.734) (-3615.580) -- 0:04:34 477000 -- [-3593.187] (-3592.926) (-3599.820) (-3594.005) * [-3590.102] (-3602.083) (-3596.538) (-3592.864) -- 0:04:34 477500 -- (-3594.470) [-3594.036] (-3596.614) (-3591.694) * (-3589.888) (-3593.319) [-3603.231] (-3590.503) -- 0:04:34 478000 -- (-3602.335) [-3589.944] (-3608.911) (-3592.984) * (-3590.213) (-3589.759) (-3592.288) [-3593.837] -- 0:04:34 478500 -- (-3593.918) (-3594.979) (-3595.365) [-3593.485] * (-3590.318) [-3595.845] (-3600.022) (-3598.514) -- 0:04:33 479000 -- [-3597.304] (-3597.498) (-3601.472) (-3597.314) * (-3599.852) (-3590.528) (-3595.611) [-3591.273] -- 0:04:33 479500 -- (-3598.046) (-3596.768) [-3590.079] (-3596.852) * (-3591.096) (-3595.750) (-3601.092) [-3589.573] -- 0:04:33 480000 -- [-3595.280] (-3594.884) (-3590.119) (-3599.019) * (-3590.948) (-3596.452) (-3605.614) [-3597.691] -- 0:04:33 Average standard deviation of split frequencies: 0.003236 480500 -- [-3591.077] (-3599.135) (-3597.636) (-3595.483) * (-3611.548) (-3591.423) (-3601.150) [-3585.718] -- 0:04:32 481000 -- (-3598.816) (-3598.217) (-3607.886) [-3587.034] * (-3597.429) (-3593.380) (-3596.473) [-3593.817] -- 0:04:31 481500 -- (-3601.361) (-3593.400) [-3599.583] (-3592.601) * (-3596.370) (-3600.947) [-3594.180] (-3607.735) -- 0:04:32 482000 -- (-3598.723) (-3591.575) [-3587.347] (-3596.691) * (-3597.157) [-3592.332] (-3599.651) (-3602.266) -- 0:04:31 482500 -- [-3595.856] (-3588.735) (-3597.094) (-3596.435) * [-3592.706] (-3600.543) (-3594.548) (-3590.288) -- 0:04:31 483000 -- (-3596.546) [-3587.718] (-3595.736) (-3602.802) * (-3594.383) [-3592.866] (-3595.910) (-3598.017) -- 0:04:30 483500 -- (-3597.171) [-3591.900] (-3595.443) (-3588.707) * (-3608.384) [-3589.401] (-3591.665) (-3597.121) -- 0:04:31 484000 -- [-3594.196] (-3595.580) (-3603.446) (-3597.507) * [-3595.277] (-3587.322) (-3596.098) (-3599.251) -- 0:04:30 484500 -- [-3593.857] (-3594.385) (-3599.276) (-3596.105) * (-3589.622) [-3596.431] (-3593.696) (-3591.837) -- 0:04:30 485000 -- (-3592.015) (-3594.215) [-3594.317] (-3592.473) * (-3597.487) (-3597.216) [-3595.001] (-3601.656) -- 0:04:30 Average standard deviation of split frequencies: 0.003104 485500 -- [-3590.539] (-3588.614) (-3591.696) (-3594.643) * (-3593.507) [-3600.921] (-3605.533) (-3596.605) -- 0:04:30 486000 -- (-3601.900) (-3596.363) (-3591.871) [-3585.504] * [-3593.383] (-3605.766) (-3598.761) (-3591.423) -- 0:04:29 486500 -- (-3591.007) [-3593.083] (-3588.286) (-3591.357) * (-3598.716) (-3606.887) [-3593.242] (-3595.463) -- 0:04:29 487000 -- (-3591.586) [-3589.168] (-3598.443) (-3594.725) * (-3591.845) (-3602.057) (-3601.796) [-3595.742] -- 0:04:29 487500 -- (-3599.084) [-3592.695] (-3612.129) (-3599.272) * (-3589.370) (-3596.470) (-3601.012) [-3592.387] -- 0:04:29 488000 -- (-3601.939) [-3597.759] (-3598.107) (-3601.110) * [-3592.595] (-3594.087) (-3600.860) (-3604.444) -- 0:04:28 488500 -- (-3602.357) (-3595.302) (-3597.069) [-3590.547] * (-3602.642) (-3589.323) [-3591.691] (-3602.400) -- 0:04:28 489000 -- (-3590.527) (-3600.875) (-3599.775) [-3596.282] * (-3597.174) (-3597.691) [-3591.140] (-3594.709) -- 0:04:28 489500 -- [-3591.383] (-3606.186) (-3590.912) (-3598.714) * (-3601.916) (-3595.326) [-3595.178] (-3594.492) -- 0:04:28 490000 -- (-3600.529) (-3593.419) (-3594.854) [-3589.459] * (-3599.810) (-3597.147) (-3605.785) [-3592.427] -- 0:04:27 Average standard deviation of split frequencies: 0.004804 490500 -- [-3590.721] (-3591.523) (-3590.924) (-3596.959) * (-3598.156) (-3593.496) (-3597.248) [-3591.607] -- 0:04:26 491000 -- [-3594.691] (-3592.927) (-3593.094) (-3599.527) * (-3602.897) [-3594.916] (-3596.356) (-3590.509) -- 0:04:27 491500 -- [-3594.943] (-3593.454) (-3591.827) (-3593.487) * (-3605.512) (-3590.301) (-3599.202) [-3588.115] -- 0:04:26 492000 -- (-3594.759) [-3593.241] (-3591.362) (-3594.250) * (-3603.629) (-3600.834) [-3596.231] (-3592.229) -- 0:04:26 492500 -- [-3592.949] (-3596.868) (-3600.327) (-3588.739) * (-3607.844) (-3602.311) (-3594.778) [-3594.644] -- 0:04:25 493000 -- (-3600.223) [-3598.612] (-3594.650) (-3589.218) * [-3599.142] (-3594.729) (-3606.179) (-3592.499) -- 0:04:26 493500 -- (-3599.812) [-3591.494] (-3589.565) (-3599.364) * (-3590.552) [-3598.621] (-3595.534) (-3602.038) -- 0:04:25 494000 -- (-3603.536) (-3602.062) [-3588.786] (-3599.099) * (-3594.785) (-3591.975) (-3600.975) [-3587.261] -- 0:04:25 494500 -- (-3593.116) [-3594.122] (-3599.040) (-3591.718) * (-3593.239) [-3591.857] (-3595.867) (-3587.651) -- 0:04:25 495000 -- (-3597.225) [-3589.443] (-3594.284) (-3600.177) * (-3589.534) [-3589.311] (-3597.423) (-3590.352) -- 0:04:25 Average standard deviation of split frequencies: 0.003802 495500 -- (-3600.641) (-3590.935) (-3593.779) [-3597.868] * (-3600.973) (-3593.515) [-3598.562] (-3592.527) -- 0:04:24 496000 -- [-3595.033] (-3596.197) (-3592.113) (-3603.492) * (-3598.691) (-3593.471) [-3602.108] (-3596.728) -- 0:04:24 496500 -- (-3600.572) [-3590.245] (-3592.974) (-3585.002) * (-3605.362) (-3596.416) (-3592.253) [-3596.554] -- 0:04:24 497000 -- (-3604.592) (-3598.201) [-3594.112] (-3597.789) * (-3602.105) (-3591.001) [-3592.923] (-3597.022) -- 0:04:24 497500 -- [-3601.223] (-3592.963) (-3591.367) (-3591.017) * (-3591.897) (-3596.245) [-3591.384] (-3594.167) -- 0:04:23 498000 -- (-3596.585) (-3589.566) (-3594.638) [-3594.210] * (-3590.281) [-3600.749] (-3594.412) (-3598.322) -- 0:04:23 498500 -- (-3590.168) [-3595.766] (-3591.540) (-3591.469) * (-3601.047) (-3591.702) (-3595.200) [-3591.861] -- 0:04:23 499000 -- [-3588.849] (-3601.154) (-3588.724) (-3600.931) * [-3591.449] (-3608.083) (-3608.881) (-3596.354) -- 0:04:23 499500 -- [-3598.491] (-3607.535) (-3604.603) (-3592.049) * (-3606.712) [-3599.176] (-3595.772) (-3593.439) -- 0:04:22 500000 -- (-3592.634) (-3598.935) (-3600.000) [-3589.820] * (-3591.780) (-3592.591) [-3591.089] (-3599.061) -- 0:04:22 Average standard deviation of split frequencies: 0.004708 500500 -- (-3593.029) [-3593.204] (-3598.419) (-3599.373) * (-3598.843) (-3597.918) (-3607.250) [-3594.150] -- 0:04:22 501000 -- [-3594.701] (-3599.903) (-3600.618) (-3597.185) * (-3593.630) (-3592.607) [-3600.833] (-3593.347) -- 0:04:21 501500 -- (-3595.785) [-3591.395] (-3595.161) (-3598.002) * (-3608.867) [-3595.116] (-3597.197) (-3605.481) -- 0:04:21 502000 -- (-3598.028) [-3593.792] (-3595.955) (-3602.519) * [-3604.954] (-3589.582) (-3607.377) (-3594.956) -- 0:04:20 502500 -- (-3601.343) (-3598.073) [-3592.791] (-3604.815) * (-3597.913) (-3591.617) [-3599.495] (-3608.505) -- 0:04:21 503000 -- [-3604.434] (-3601.340) (-3599.091) (-3591.384) * [-3588.872] (-3610.714) (-3602.366) (-3591.138) -- 0:04:20 503500 -- [-3596.375] (-3596.843) (-3588.709) (-3592.236) * [-3601.372] (-3593.704) (-3597.458) (-3600.938) -- 0:04:20 504000 -- (-3597.275) (-3592.139) [-3594.334] (-3606.995) * (-3590.965) (-3602.976) [-3591.309] (-3601.293) -- 0:04:19 504500 -- (-3601.531) (-3592.256) [-3593.589] (-3599.760) * [-3588.678] (-3600.309) (-3591.876) (-3614.448) -- 0:04:20 505000 -- (-3608.659) (-3586.956) [-3596.610] (-3589.169) * [-3595.847] (-3602.646) (-3600.970) (-3602.958) -- 0:04:19 Average standard deviation of split frequencies: 0.005497 505500 -- (-3598.708) (-3591.997) (-3586.438) [-3599.030] * [-3594.862] (-3601.189) (-3608.472) (-3592.950) -- 0:04:19 506000 -- (-3599.952) [-3591.891] (-3603.578) (-3597.978) * (-3600.705) [-3592.102] (-3590.451) (-3594.038) -- 0:04:19 506500 -- (-3601.108) [-3593.367] (-3601.529) (-3594.956) * (-3597.620) (-3595.023) [-3597.916] (-3593.721) -- 0:04:19 507000 -- (-3595.529) (-3599.888) [-3590.701] (-3598.878) * (-3602.656) (-3595.072) [-3593.956] (-3593.213) -- 0:04:18 507500 -- (-3602.090) [-3587.711] (-3603.030) (-3597.730) * (-3602.877) [-3593.084] (-3596.919) (-3591.478) -- 0:04:18 508000 -- [-3601.986] (-3594.481) (-3595.986) (-3598.625) * (-3597.008) (-3593.713) [-3587.716] (-3591.562) -- 0:04:18 508500 -- [-3598.199] (-3588.568) (-3599.390) (-3591.558) * (-3593.469) (-3594.144) [-3597.558] (-3596.110) -- 0:04:18 509000 -- (-3593.770) (-3597.017) (-3616.473) [-3595.341] * [-3590.404] (-3597.568) (-3595.711) (-3602.101) -- 0:04:17 509500 -- [-3595.477] (-3592.890) (-3603.441) (-3592.532) * (-3595.591) [-3597.492] (-3593.237) (-3595.662) -- 0:04:17 510000 -- [-3592.703] (-3595.717) (-3595.271) (-3593.240) * (-3598.108) (-3603.250) [-3597.316] (-3598.917) -- 0:04:17 Average standard deviation of split frequencies: 0.004616 510500 -- [-3594.910] (-3595.459) (-3594.966) (-3594.667) * (-3603.795) [-3599.381] (-3601.807) (-3591.534) -- 0:04:16 511000 -- (-3590.780) (-3592.235) (-3593.219) [-3597.155] * [-3598.102] (-3592.421) (-3589.664) (-3599.118) -- 0:04:16 511500 -- [-3594.352] (-3595.061) (-3594.285) (-3596.647) * (-3588.915) [-3594.874] (-3595.189) (-3601.150) -- 0:04:15 512000 -- [-3589.819] (-3600.346) (-3594.506) (-3592.390) * (-3592.830) (-3596.455) (-3594.037) [-3594.502] -- 0:04:16 512500 -- (-3598.682) (-3597.955) (-3589.406) [-3596.566] * (-3600.499) (-3595.307) [-3588.200] (-3602.409) -- 0:04:15 513000 -- (-3595.534) (-3592.020) (-3594.027) [-3590.683] * (-3597.136) (-3592.077) [-3597.862] (-3595.945) -- 0:04:15 513500 -- (-3591.866) [-3595.729] (-3597.681) (-3597.644) * (-3590.256) (-3599.738) [-3593.835] (-3599.163) -- 0:04:14 514000 -- (-3592.112) (-3602.222) (-3596.327) [-3595.271] * (-3598.959) [-3591.555] (-3604.422) (-3602.375) -- 0:04:15 514500 -- (-3608.794) [-3591.444] (-3593.722) (-3598.653) * (-3595.161) [-3587.386] (-3595.337) (-3592.788) -- 0:04:14 515000 -- [-3598.670] (-3599.122) (-3592.609) (-3592.398) * [-3589.571] (-3611.166) (-3598.756) (-3594.999) -- 0:04:14 Average standard deviation of split frequencies: 0.004842 515500 -- [-3587.785] (-3589.188) (-3595.314) (-3589.846) * [-3596.187] (-3604.184) (-3604.358) (-3596.117) -- 0:04:13 516000 -- (-3591.554) [-3589.691] (-3593.619) (-3589.113) * (-3589.691) (-3599.592) [-3598.493] (-3593.637) -- 0:04:14 516500 -- (-3591.520) (-3590.700) [-3597.131] (-3594.469) * (-3596.310) [-3592.863] (-3608.824) (-3600.824) -- 0:04:13 517000 -- (-3586.502) [-3596.328] (-3590.146) (-3592.838) * [-3594.161] (-3598.299) (-3596.779) (-3593.662) -- 0:04:13 517500 -- (-3608.357) (-3608.273) (-3603.265) [-3586.803] * [-3590.166] (-3596.594) (-3599.588) (-3592.147) -- 0:04:12 518000 -- (-3590.652) [-3593.643] (-3603.587) (-3592.529) * (-3597.564) (-3602.305) [-3592.897] (-3590.130) -- 0:04:13 518500 -- [-3592.859] (-3590.631) (-3601.907) (-3596.420) * [-3593.505] (-3598.413) (-3608.606) (-3588.495) -- 0:04:12 519000 -- (-3596.686) (-3593.611) (-3599.742) [-3595.909] * (-3590.173) (-3584.096) (-3595.066) [-3589.154] -- 0:04:12 519500 -- [-3600.840] (-3592.569) (-3597.457) (-3604.963) * [-3592.766] (-3594.760) (-3598.946) (-3592.253) -- 0:04:12 520000 -- (-3598.433) (-3608.379) [-3587.286] (-3592.358) * (-3605.915) (-3594.648) (-3592.754) [-3595.756] -- 0:04:11 Average standard deviation of split frequencies: 0.005432 520500 -- (-3595.154) (-3594.121) [-3598.447] (-3597.260) * (-3595.774) [-3590.784] (-3601.501) (-3615.174) -- 0:04:11 521000 -- (-3595.135) (-3587.028) [-3602.831] (-3604.272) * (-3593.968) (-3593.994) [-3593.870] (-3599.943) -- 0:04:10 521500 -- (-3591.058) (-3597.409) [-3600.474] (-3599.978) * (-3596.938) [-3596.621] (-3592.240) (-3600.943) -- 0:04:11 522000 -- [-3589.151] (-3601.307) (-3607.489) (-3594.582) * (-3590.895) [-3597.503] (-3595.805) (-3599.769) -- 0:04:10 522500 -- [-3588.732] (-3594.256) (-3603.182) (-3601.027) * (-3595.722) [-3589.536] (-3597.600) (-3593.256) -- 0:04:10 523000 -- [-3595.400] (-3593.440) (-3598.755) (-3602.574) * (-3585.721) (-3584.884) (-3596.658) [-3589.408] -- 0:04:09 523500 -- (-3604.610) (-3596.322) [-3595.183] (-3596.670) * (-3593.689) [-3590.426] (-3599.928) (-3592.296) -- 0:04:10 524000 -- (-3602.251) [-3593.898] (-3600.233) (-3600.130) * (-3598.454) (-3590.613) [-3588.634] (-3599.937) -- 0:04:09 524500 -- (-3611.746) (-3589.389) [-3595.815] (-3609.845) * (-3597.752) [-3594.523] (-3594.034) (-3601.851) -- 0:04:09 525000 -- (-3602.081) (-3605.602) (-3604.197) [-3598.241] * (-3603.225) (-3598.306) (-3603.537) [-3591.573] -- 0:04:08 Average standard deviation of split frequencies: 0.005825 525500 -- (-3601.603) (-3593.564) (-3597.303) [-3595.084] * (-3594.907) (-3591.260) (-3597.858) [-3596.799] -- 0:04:09 526000 -- (-3598.856) (-3595.817) [-3594.982] (-3596.484) * [-3591.711] (-3598.724) (-3594.908) (-3594.774) -- 0:04:08 526500 -- (-3593.090) (-3589.544) (-3590.889) [-3591.332] * (-3591.656) (-3597.717) (-3596.034) [-3594.756] -- 0:04:08 527000 -- (-3594.767) (-3590.781) (-3603.157) [-3589.468] * (-3596.951) (-3599.102) [-3588.838] (-3593.652) -- 0:04:07 527500 -- [-3597.280] (-3599.154) (-3593.169) (-3600.341) * (-3590.519) [-3594.632] (-3591.060) (-3598.600) -- 0:04:08 528000 -- (-3601.950) (-3602.059) (-3591.929) [-3593.318] * (-3603.414) (-3592.587) [-3591.578] (-3594.439) -- 0:04:07 528500 -- (-3592.429) (-3598.640) (-3591.595) [-3594.532] * (-3605.111) (-3596.604) (-3592.159) [-3595.481] -- 0:04:07 529000 -- [-3587.800] (-3596.103) (-3604.415) (-3602.017) * (-3604.128) (-3593.441) [-3598.621] (-3597.148) -- 0:04:06 529500 -- [-3594.575] (-3601.641) (-3595.542) (-3597.784) * (-3592.743) (-3603.392) (-3593.966) [-3592.081] -- 0:04:07 530000 -- (-3592.205) [-3592.145] (-3595.586) (-3598.663) * (-3591.071) (-3599.082) (-3601.758) [-3593.605] -- 0:04:06 Average standard deviation of split frequencies: 0.005685 530500 -- (-3604.967) [-3589.561] (-3604.017) (-3589.366) * (-3596.156) [-3591.792] (-3597.102) (-3594.001) -- 0:04:06 531000 -- (-3595.836) (-3602.370) [-3595.419] (-3603.135) * [-3599.743] (-3602.552) (-3600.772) (-3602.047) -- 0:04:05 531500 -- (-3598.212) (-3598.700) (-3595.539) [-3595.494] * [-3596.473] (-3589.837) (-3594.482) (-3612.607) -- 0:04:05 532000 -- (-3593.250) [-3595.843] (-3592.093) (-3602.700) * (-3592.901) (-3595.575) [-3595.271] (-3599.068) -- 0:04:05 532500 -- (-3593.990) (-3601.664) [-3590.064] (-3601.815) * (-3598.402) [-3590.867] (-3607.137) (-3599.192) -- 0:04:04 533000 -- (-3599.988) [-3590.364] (-3593.107) (-3606.221) * [-3595.218] (-3590.628) (-3597.991) (-3594.370) -- 0:04:05 533500 -- (-3600.713) [-3589.234] (-3600.161) (-3604.054) * (-3600.083) (-3594.999) (-3594.838) [-3594.326] -- 0:04:04 534000 -- (-3591.054) (-3593.819) [-3592.533] (-3598.879) * [-3595.317] (-3597.389) (-3589.695) (-3597.749) -- 0:04:04 534500 -- (-3589.308) (-3597.230) [-3598.280] (-3593.431) * [-3590.101] (-3598.693) (-3596.582) (-3601.646) -- 0:04:03 535000 -- (-3599.460) (-3592.273) [-3595.911] (-3587.848) * (-3594.394) (-3599.790) (-3601.358) [-3596.549] -- 0:04:04 Average standard deviation of split frequencies: 0.005277 535500 -- (-3601.585) [-3589.299] (-3602.231) (-3598.352) * (-3599.897) (-3594.298) (-3603.506) [-3596.342] -- 0:04:03 536000 -- [-3607.038] (-3598.736) (-3598.583) (-3602.901) * [-3592.918] (-3599.023) (-3595.017) (-3603.796) -- 0:04:03 536500 -- [-3592.951] (-3610.014) (-3616.860) (-3598.558) * [-3590.792] (-3602.943) (-3594.310) (-3604.400) -- 0:04:02 537000 -- (-3601.255) (-3595.396) (-3595.838) [-3589.154] * (-3597.337) (-3603.029) [-3587.910] (-3596.149) -- 0:04:03 537500 -- [-3591.454] (-3606.821) (-3591.063) (-3597.516) * (-3592.659) (-3604.331) [-3590.396] (-3600.687) -- 0:04:02 538000 -- (-3592.240) (-3600.694) (-3592.562) [-3594.158] * (-3593.167) (-3594.545) [-3593.644] (-3597.556) -- 0:04:02 538500 -- [-3595.090] (-3591.096) (-3594.876) (-3604.848) * (-3597.144) [-3600.454] (-3603.621) (-3599.141) -- 0:04:01 539000 -- [-3591.318] (-3597.993) (-3604.253) (-3610.489) * (-3592.277) (-3603.394) (-3599.082) [-3601.057] -- 0:04:02 539500 -- (-3602.552) [-3598.496] (-3595.095) (-3599.346) * [-3596.864] (-3610.353) (-3610.964) (-3600.410) -- 0:04:01 540000 -- (-3598.172) (-3592.239) (-3594.056) [-3591.269] * (-3590.931) (-3594.616) [-3592.606] (-3602.601) -- 0:04:01 Average standard deviation of split frequencies: 0.005580 540500 -- (-3602.807) (-3593.113) (-3595.600) [-3593.582] * (-3600.583) (-3602.746) [-3596.411] (-3598.893) -- 0:04:00 541000 -- (-3602.700) (-3594.252) [-3598.530] (-3594.738) * (-3600.512) (-3599.430) (-3601.273) [-3594.233] -- 0:04:00 541500 -- (-3593.867) [-3590.703] (-3595.606) (-3596.331) * [-3591.645] (-3593.372) (-3598.311) (-3590.301) -- 0:04:00 542000 -- (-3592.581) [-3599.631] (-3601.073) (-3593.389) * (-3593.672) (-3594.068) (-3591.740) [-3601.382] -- 0:03:59 542500 -- (-3595.491) [-3602.236] (-3601.852) (-3593.584) * (-3591.823) [-3593.920] (-3597.145) (-3593.753) -- 0:03:59 543000 -- (-3594.389) (-3606.156) [-3596.722] (-3594.434) * [-3593.254] (-3596.674) (-3597.960) (-3590.014) -- 0:03:59 543500 -- (-3592.351) [-3597.545] (-3601.386) (-3603.416) * (-3592.959) (-3604.555) [-3591.262] (-3610.395) -- 0:03:59 544000 -- (-3593.064) (-3593.564) [-3591.490] (-3592.196) * (-3593.692) [-3593.755] (-3599.643) (-3594.961) -- 0:03:58 544500 -- (-3597.691) (-3592.584) (-3596.129) [-3593.915] * (-3595.436) (-3593.191) [-3604.275] (-3598.531) -- 0:03:59 545000 -- (-3592.396) (-3592.659) [-3597.703] (-3590.432) * (-3587.611) [-3596.352] (-3591.694) (-3605.006) -- 0:03:58 Average standard deviation of split frequencies: 0.005439 545500 -- (-3593.459) (-3592.327) (-3589.313) [-3592.096] * [-3592.323] (-3592.280) (-3604.041) (-3596.956) -- 0:03:58 546000 -- (-3590.201) [-3593.613] (-3596.423) (-3603.182) * (-3594.011) (-3603.532) [-3598.633] (-3597.009) -- 0:03:57 546500 -- (-3593.614) (-3592.835) [-3596.960] (-3604.558) * [-3589.495] (-3604.966) (-3596.620) (-3598.113) -- 0:03:58 547000 -- [-3591.718] (-3598.722) (-3591.161) (-3603.308) * (-3594.665) [-3603.163] (-3599.217) (-3603.015) -- 0:03:57 547500 -- [-3588.579] (-3600.854) (-3595.222) (-3603.962) * [-3590.532] (-3598.373) (-3598.374) (-3598.485) -- 0:03:57 548000 -- (-3593.876) (-3594.676) (-3598.473) [-3596.172] * (-3601.872) (-3616.940) [-3590.894] (-3590.750) -- 0:03:56 548500 -- (-3601.742) (-3608.927) [-3597.395] (-3613.573) * (-3596.197) (-3607.632) [-3588.242] (-3598.546) -- 0:03:57 549000 -- (-3593.406) (-3599.609) (-3600.070) [-3595.397] * [-3595.688] (-3607.018) (-3596.920) (-3595.383) -- 0:03:56 549500 -- (-3591.688) (-3587.687) (-3600.825) [-3591.019] * (-3597.885) (-3601.545) (-3587.087) [-3591.341] -- 0:03:56 550000 -- (-3592.596) (-3598.463) [-3591.875] (-3596.761) * (-3593.808) (-3601.645) (-3597.791) [-3595.708] -- 0:03:55 Average standard deviation of split frequencies: 0.005564 550500 -- [-3592.634] (-3600.264) (-3591.850) (-3598.887) * [-3598.907] (-3593.557) (-3606.578) (-3603.630) -- 0:03:55 551000 -- (-3590.763) (-3595.608) [-3590.843] (-3600.006) * (-3601.592) [-3593.903] (-3598.553) (-3593.868) -- 0:03:55 551500 -- (-3595.404) (-3594.894) [-3586.812] (-3606.698) * (-3597.687) [-3590.184] (-3593.930) (-3592.284) -- 0:03:55 552000 -- (-3596.955) [-3588.432] (-3591.363) (-3599.721) * [-3589.657] (-3595.234) (-3600.942) (-3598.571) -- 0:03:54 552500 -- (-3596.576) (-3597.230) [-3597.740] (-3592.530) * (-3592.730) (-3593.269) (-3597.436) [-3595.194] -- 0:03:54 553000 -- [-3592.784] (-3590.504) (-3589.039) (-3596.597) * [-3597.146] (-3600.537) (-3605.697) (-3593.241) -- 0:03:54 553500 -- (-3590.304) (-3593.938) (-3591.860) [-3594.061] * (-3597.010) (-3596.785) [-3605.088] (-3596.627) -- 0:03:53 554000 -- [-3589.782] (-3599.610) (-3604.248) (-3600.261) * (-3604.636) [-3587.763] (-3594.182) (-3599.248) -- 0:03:53 554500 -- [-3590.621] (-3601.861) (-3601.140) (-3598.168) * (-3594.648) (-3596.695) [-3599.185] (-3598.529) -- 0:03:53 555000 -- (-3590.414) (-3592.180) [-3593.029] (-3595.799) * (-3598.554) (-3596.874) (-3592.365) [-3591.310] -- 0:03:53 Average standard deviation of split frequencies: 0.005765 555500 -- [-3585.404] (-3593.759) (-3592.865) (-3603.691) * (-3589.975) (-3601.905) [-3594.170] (-3604.566) -- 0:03:52 556000 -- (-3602.079) (-3593.793) (-3597.741) [-3591.606] * (-3592.662) (-3589.184) [-3599.296] (-3605.720) -- 0:03:52 556500 -- (-3591.904) (-3592.492) [-3595.233] (-3588.711) * (-3597.946) (-3605.212) [-3593.379] (-3600.232) -- 0:03:52 557000 -- [-3591.043] (-3594.221) (-3609.871) (-3602.071) * (-3597.253) [-3597.772] (-3594.072) (-3596.815) -- 0:03:52 557500 -- [-3590.907] (-3594.205) (-3592.113) (-3610.354) * (-3613.581) (-3600.008) [-3596.641] (-3609.441) -- 0:03:51 558000 -- (-3596.307) [-3590.761] (-3592.601) (-3603.567) * [-3596.393] (-3594.560) (-3595.292) (-3602.030) -- 0:03:52 558500 -- (-3592.380) (-3596.626) [-3591.988] (-3598.049) * [-3599.249] (-3593.294) (-3596.539) (-3591.569) -- 0:03:51 559000 -- (-3597.020) [-3592.713] (-3596.130) (-3597.346) * [-3594.801] (-3592.503) (-3592.796) (-3594.608) -- 0:03:51 559500 -- [-3591.290] (-3606.275) (-3591.256) (-3595.135) * [-3593.605] (-3601.782) (-3593.874) (-3594.329) -- 0:03:50 560000 -- (-3599.874) (-3604.155) (-3593.230) [-3590.878] * (-3591.357) (-3593.409) (-3601.504) [-3598.402] -- 0:03:50 Average standard deviation of split frequencies: 0.006390 560500 -- (-3600.799) [-3597.615] (-3597.118) (-3593.451) * (-3602.764) (-3594.519) (-3601.240) [-3594.006] -- 0:03:50 561000 -- (-3597.892) [-3595.804] (-3596.307) (-3594.311) * (-3590.380) (-3594.538) (-3597.396) [-3592.201] -- 0:03:50 561500 -- (-3602.399) [-3596.665] (-3594.990) (-3588.461) * (-3595.387) [-3589.068] (-3598.759) (-3584.689) -- 0:03:49 562000 -- (-3594.833) (-3589.758) [-3600.815] (-3591.895) * (-3593.661) (-3596.984) (-3600.396) [-3590.632] -- 0:03:49 562500 -- (-3601.900) [-3594.217] (-3598.143) (-3593.897) * (-3593.688) (-3594.750) (-3595.029) [-3599.112] -- 0:03:49 563000 -- (-3594.927) [-3606.814] (-3600.051) (-3589.860) * (-3589.893) (-3587.022) [-3601.356] (-3588.236) -- 0:03:48 563500 -- [-3596.517] (-3606.038) (-3600.691) (-3596.851) * (-3597.680) [-3588.528] (-3597.074) (-3601.170) -- 0:03:48 564000 -- [-3590.051] (-3596.128) (-3605.132) (-3599.724) * [-3589.164] (-3605.411) (-3596.938) (-3594.368) -- 0:03:48 564500 -- [-3591.103] (-3604.259) (-3603.739) (-3596.722) * (-3593.463) [-3589.498] (-3588.430) (-3601.934) -- 0:03:48 565000 -- [-3592.708] (-3592.145) (-3596.272) (-3599.550) * (-3593.822) (-3596.548) [-3594.753] (-3596.622) -- 0:03:47 Average standard deviation of split frequencies: 0.006830 565500 -- (-3594.677) (-3590.424) [-3587.746] (-3599.147) * [-3597.840] (-3599.762) (-3604.170) (-3601.992) -- 0:03:47 566000 -- [-3588.951] (-3595.732) (-3597.851) (-3590.269) * (-3593.457) [-3594.769] (-3596.974) (-3592.214) -- 0:03:47 566500 -- (-3593.451) [-3596.409] (-3592.676) (-3602.605) * [-3594.043] (-3600.105) (-3593.680) (-3598.669) -- 0:03:47 567000 -- (-3598.719) [-3593.427] (-3588.722) (-3592.976) * (-3606.259) (-3609.023) [-3591.321] (-3589.221) -- 0:03:46 567500 -- (-3602.168) (-3594.994) (-3597.064) [-3591.282] * [-3590.522] (-3606.144) (-3592.121) (-3595.225) -- 0:03:47 568000 -- (-3604.499) (-3598.041) (-3606.266) [-3597.266] * (-3593.751) (-3604.066) [-3594.919] (-3596.013) -- 0:03:46 568500 -- (-3593.759) (-3595.298) (-3606.355) [-3593.712] * [-3596.514] (-3591.182) (-3594.388) (-3604.523) -- 0:03:46 569000 -- [-3588.107] (-3598.534) (-3599.582) (-3601.247) * [-3593.138] (-3606.665) (-3599.532) (-3603.750) -- 0:03:45 569500 -- (-3590.226) [-3595.620] (-3596.609) (-3596.613) * [-3596.496] (-3602.337) (-3596.261) (-3598.030) -- 0:03:46 570000 -- (-3603.432) (-3601.081) (-3590.402) [-3591.534] * (-3604.074) (-3608.043) [-3598.006] (-3596.918) -- 0:03:45 Average standard deviation of split frequencies: 0.005700 570500 -- (-3588.867) (-3601.026) (-3597.856) [-3593.210] * (-3589.623) (-3607.184) (-3590.513) [-3594.402] -- 0:03:45 571000 -- [-3593.020] (-3599.621) (-3590.904) (-3593.220) * (-3594.138) (-3592.348) [-3592.870] (-3593.870) -- 0:03:44 571500 -- (-3589.424) [-3598.771] (-3596.711) (-3594.618) * (-3597.451) [-3598.219] (-3598.559) (-3601.379) -- 0:03:44 572000 -- [-3590.688] (-3593.020) (-3593.776) (-3598.900) * [-3595.781] (-3589.299) (-3594.204) (-3596.346) -- 0:03:44 572500 -- [-3594.625] (-3600.915) (-3600.030) (-3598.357) * (-3596.389) [-3594.567] (-3601.981) (-3598.828) -- 0:03:44 573000 -- [-3589.364] (-3597.666) (-3593.830) (-3595.407) * (-3600.050) (-3600.082) (-3603.277) [-3591.425] -- 0:03:43 573500 -- [-3600.322] (-3597.731) (-3596.710) (-3590.402) * (-3590.680) (-3591.684) (-3593.583) [-3592.967] -- 0:03:43 574000 -- [-3592.721] (-3603.400) (-3602.155) (-3591.290) * [-3592.799] (-3597.269) (-3600.632) (-3606.441) -- 0:03:43 574500 -- [-3604.322] (-3597.977) (-3598.052) (-3590.510) * (-3596.442) [-3590.069] (-3590.284) (-3601.995) -- 0:03:42 575000 -- (-3600.872) (-3597.149) [-3594.848] (-3591.320) * (-3591.619) (-3598.035) [-3589.272] (-3599.609) -- 0:03:42 Average standard deviation of split frequencies: 0.007038 575500 -- [-3591.909] (-3593.385) (-3600.530) (-3588.967) * (-3595.433) (-3600.662) [-3586.101] (-3595.121) -- 0:03:42 576000 -- (-3608.360) [-3586.692] (-3596.581) (-3600.220) * (-3592.595) [-3599.345] (-3604.152) (-3593.013) -- 0:03:42 576500 -- (-3591.599) [-3589.567] (-3592.853) (-3590.075) * (-3600.416) (-3594.188) [-3591.752] (-3588.253) -- 0:03:41 577000 -- [-3594.028] (-3590.484) (-3600.269) (-3600.161) * (-3602.068) (-3595.749) [-3588.886] (-3598.203) -- 0:03:41 577500 -- [-3597.406] (-3593.911) (-3595.676) (-3601.933) * (-3593.112) (-3602.533) (-3596.290) [-3591.031] -- 0:03:41 578000 -- (-3597.073) [-3596.489] (-3593.614) (-3601.479) * [-3594.204] (-3617.571) (-3594.760) (-3600.703) -- 0:03:41 578500 -- (-3592.903) (-3597.373) [-3593.688] (-3597.514) * (-3610.817) (-3597.552) (-3595.883) [-3593.806] -- 0:03:40 579000 -- (-3597.260) [-3589.499] (-3587.448) (-3592.861) * (-3593.609) [-3590.299] (-3597.990) (-3593.910) -- 0:03:41 579500 -- (-3604.803) [-3594.370] (-3600.920) (-3601.798) * [-3594.481] (-3597.878) (-3593.388) (-3593.953) -- 0:03:40 580000 -- (-3591.249) (-3599.247) (-3598.020) [-3603.949] * (-3613.175) [-3600.006] (-3587.460) (-3605.869) -- 0:03:40 Average standard deviation of split frequencies: 0.005845 580500 -- (-3598.708) [-3592.339] (-3605.652) (-3591.723) * (-3598.308) (-3598.029) (-3595.510) [-3595.773] -- 0:03:39 581000 -- (-3585.298) (-3603.305) (-3592.408) [-3596.941] * [-3597.418] (-3604.802) (-3609.555) (-3599.648) -- 0:03:39 581500 -- [-3599.646] (-3595.901) (-3601.835) (-3596.838) * [-3594.949] (-3595.037) (-3589.879) (-3593.123) -- 0:03:39 582000 -- [-3593.988] (-3598.873) (-3601.547) (-3609.124) * [-3590.533] (-3588.601) (-3594.261) (-3598.428) -- 0:03:39 582500 -- (-3590.152) (-3597.044) [-3598.262] (-3596.247) * (-3596.383) [-3591.892] (-3594.735) (-3593.490) -- 0:03:38 583000 -- (-3600.398) [-3587.409] (-3592.962) (-3596.589) * (-3599.385) (-3596.826) (-3593.289) [-3591.456] -- 0:03:38 583500 -- (-3604.399) [-3588.493] (-3600.172) (-3600.058) * (-3606.847) [-3594.818] (-3595.736) (-3594.939) -- 0:03:38 584000 -- [-3609.685] (-3604.371) (-3590.804) (-3595.219) * (-3603.880) (-3603.332) [-3595.878] (-3603.430) -- 0:03:37 584500 -- (-3598.462) (-3601.586) [-3595.251] (-3596.515) * (-3599.252) (-3594.635) (-3601.188) [-3594.109] -- 0:03:37 585000 -- [-3596.276] (-3602.784) (-3606.102) (-3594.936) * (-3611.253) (-3594.546) (-3595.247) [-3590.765] -- 0:03:37 Average standard deviation of split frequencies: 0.006194 585500 -- [-3598.406] (-3597.542) (-3594.646) (-3601.254) * (-3602.795) (-3605.823) [-3595.357] (-3597.665) -- 0:03:37 586000 -- (-3597.735) (-3600.825) (-3591.733) [-3590.470] * (-3599.361) (-3598.883) (-3593.789) [-3596.560] -- 0:03:36 586500 -- [-3589.234] (-3597.935) (-3605.626) (-3599.507) * (-3597.215) (-3596.943) [-3599.269] (-3593.215) -- 0:03:36 587000 -- (-3596.473) [-3594.574] (-3600.742) (-3599.802) * (-3598.335) [-3594.415] (-3607.862) (-3598.758) -- 0:03:36 587500 -- [-3592.392] (-3596.661) (-3599.777) (-3594.561) * [-3593.812] (-3594.959) (-3594.781) (-3606.228) -- 0:03:36 588000 -- [-3588.639] (-3598.392) (-3592.810) (-3593.080) * (-3605.356) (-3607.336) [-3592.540] (-3602.404) -- 0:03:35 588500 -- (-3592.395) (-3597.269) (-3594.173) [-3592.346] * [-3591.413] (-3599.538) (-3587.400) (-3595.243) -- 0:03:35 589000 -- [-3591.966] (-3596.864) (-3598.560) (-3595.270) * (-3599.172) (-3605.685) [-3593.280] (-3596.624) -- 0:03:35 589500 -- (-3603.492) (-3600.327) (-3595.367) [-3595.261] * [-3598.180] (-3595.436) (-3590.854) (-3597.848) -- 0:03:35 590000 -- (-3604.310) [-3591.834] (-3594.686) (-3595.407) * (-3598.138) (-3592.883) [-3591.030] (-3598.025) -- 0:03:34 Average standard deviation of split frequencies: 0.007023 590500 -- [-3592.742] (-3597.543) (-3591.599) (-3589.751) * (-3599.619) [-3593.886] (-3592.948) (-3590.523) -- 0:03:34 591000 -- (-3602.304) (-3597.693) [-3589.522] (-3593.317) * [-3596.217] (-3599.078) (-3591.069) (-3593.218) -- 0:03:34 591500 -- [-3591.167] (-3597.080) (-3596.239) (-3594.781) * (-3596.581) (-3594.055) (-3598.551) [-3595.216] -- 0:03:34 592000 -- [-3598.515] (-3610.129) (-3604.574) (-3594.382) * (-3596.452) (-3597.628) (-3591.424) [-3586.849] -- 0:03:33 592500 -- (-3599.925) (-3605.657) (-3594.011) [-3594.171] * (-3598.240) [-3591.040] (-3596.879) (-3588.128) -- 0:03:33 593000 -- [-3599.187] (-3604.786) (-3600.914) (-3595.103) * (-3590.022) (-3597.376) (-3596.726) [-3594.184] -- 0:03:33 593500 -- (-3588.864) (-3603.860) [-3591.586] (-3596.728) * [-3594.220] (-3599.023) (-3599.381) (-3592.641) -- 0:03:33 594000 -- (-3596.213) (-3606.658) [-3593.447] (-3602.547) * [-3592.971] (-3598.098) (-3596.381) (-3586.291) -- 0:03:32 594500 -- (-3601.757) (-3596.025) (-3602.527) [-3591.394] * (-3605.028) [-3601.189] (-3589.440) (-3598.030) -- 0:03:32 595000 -- (-3588.616) (-3594.653) (-3598.508) [-3593.524] * (-3601.536) (-3600.790) [-3598.411] (-3597.491) -- 0:03:32 Average standard deviation of split frequencies: 0.006328 595500 -- [-3598.009] (-3592.621) (-3596.676) (-3596.882) * (-3601.537) (-3588.945) [-3597.308] (-3592.790) -- 0:03:31 596000 -- (-3594.586) [-3592.601] (-3600.374) (-3592.566) * (-3592.458) (-3595.985) [-3600.615] (-3601.289) -- 0:03:31 596500 -- [-3594.748] (-3593.598) (-3596.141) (-3593.779) * (-3592.115) (-3587.538) [-3600.323] (-3596.447) -- 0:03:31 597000 -- (-3593.161) (-3606.435) (-3599.949) [-3597.994] * (-3597.334) [-3594.317] (-3599.248) (-3593.252) -- 0:03:31 597500 -- (-3594.617) [-3592.822] (-3594.422) (-3600.539) * (-3596.017) [-3593.958] (-3594.000) (-3602.963) -- 0:03:30 598000 -- (-3597.742) (-3595.162) [-3605.234] (-3608.958) * [-3597.491] (-3599.626) (-3600.706) (-3589.557) -- 0:03:30 598500 -- (-3594.061) (-3593.625) [-3587.976] (-3605.520) * (-3595.852) [-3596.517] (-3596.150) (-3594.140) -- 0:03:30 599000 -- [-3588.073] (-3602.779) (-3607.099) (-3596.584) * (-3593.212) (-3598.478) [-3602.619] (-3601.188) -- 0:03:30 599500 -- (-3602.312) [-3597.438] (-3597.037) (-3594.120) * (-3602.611) (-3598.133) [-3592.121] (-3599.487) -- 0:03:29 600000 -- (-3600.147) (-3596.440) (-3604.743) [-3601.398] * (-3593.392) (-3594.012) [-3598.958] (-3610.489) -- 0:03:30 Average standard deviation of split frequencies: 0.005651 600500 -- (-3600.185) [-3589.452] (-3594.608) (-3596.548) * (-3595.586) (-3595.163) (-3595.227) [-3595.278] -- 0:03:29 601000 -- (-3591.767) (-3596.218) (-3589.167) [-3592.349] * [-3589.783] (-3595.280) (-3593.355) (-3590.388) -- 0:03:29 601500 -- (-3597.814) (-3599.057) (-3593.143) [-3588.666] * [-3593.760] (-3600.964) (-3600.568) (-3595.582) -- 0:03:28 602000 -- (-3590.561) (-3590.258) [-3589.545] (-3590.955) * [-3594.597] (-3601.783) (-3595.339) (-3602.304) -- 0:03:28 602500 -- (-3596.025) [-3591.444] (-3593.567) (-3602.388) * [-3594.966] (-3602.388) (-3595.544) (-3596.620) -- 0:03:28 603000 -- (-3594.168) (-3591.824) (-3609.461) [-3598.579] * (-3601.902) (-3601.018) (-3594.427) [-3588.513] -- 0:03:28 603500 -- (-3596.582) (-3599.026) [-3596.669] (-3596.902) * (-3603.987) (-3595.108) (-3589.674) [-3590.114] -- 0:03:27 604000 -- (-3592.584) [-3591.337] (-3597.808) (-3591.975) * (-3592.767) (-3595.739) (-3595.911) [-3588.420] -- 0:03:27 604500 -- (-3590.192) (-3595.959) (-3605.847) [-3592.130] * (-3596.576) [-3600.371] (-3598.882) (-3591.606) -- 0:03:27 605000 -- (-3606.468) [-3595.410] (-3591.315) (-3593.660) * (-3595.634) (-3603.089) (-3593.765) [-3589.711] -- 0:03:26 Average standard deviation of split frequencies: 0.005679 605500 -- (-3615.592) (-3598.215) [-3597.225] (-3594.984) * (-3595.238) [-3592.980] (-3588.003) (-3603.513) -- 0:03:26 606000 -- (-3598.356) (-3591.231) [-3590.303] (-3601.774) * (-3597.647) (-3602.458) [-3595.831] (-3597.730) -- 0:03:26 606500 -- [-3596.819] (-3590.632) (-3597.764) (-3601.951) * (-3588.059) (-3599.267) (-3588.609) [-3598.244] -- 0:03:26 607000 -- (-3598.498) (-3594.973) [-3590.358] (-3605.075) * (-3588.217) (-3590.688) [-3595.741] (-3602.243) -- 0:03:25 607500 -- (-3601.705) (-3599.751) (-3598.708) [-3586.043] * [-3598.927] (-3597.986) (-3594.689) (-3600.324) -- 0:03:25 608000 -- (-3603.329) [-3586.204] (-3594.124) (-3590.470) * (-3593.808) [-3595.187] (-3587.332) (-3596.794) -- 0:03:25 608500 -- (-3603.844) (-3594.355) (-3600.270) [-3595.244] * [-3607.007] (-3608.884) (-3588.603) (-3604.710) -- 0:03:25 609000 -- [-3590.914] (-3601.466) (-3590.702) (-3599.453) * (-3615.801) (-3596.695) [-3588.723] (-3598.284) -- 0:03:24 609500 -- (-3595.092) (-3596.361) [-3592.826] (-3597.985) * (-3611.082) [-3595.459] (-3600.790) (-3594.083) -- 0:03:24 610000 -- (-3596.113) (-3591.239) [-3601.641] (-3594.251) * (-3602.019) (-3599.139) (-3588.316) [-3591.728] -- 0:03:24 Average standard deviation of split frequencies: 0.005558 610500 -- (-3594.802) [-3597.977] (-3594.326) (-3606.268) * (-3593.952) [-3601.080] (-3589.149) (-3593.452) -- 0:03:24 611000 -- (-3594.416) (-3593.140) (-3605.899) [-3590.979] * (-3588.383) [-3593.503] (-3596.696) (-3592.995) -- 0:03:23 611500 -- [-3594.588] (-3592.503) (-3602.341) (-3602.775) * (-3610.052) [-3594.938] (-3602.601) (-3585.674) -- 0:03:23 612000 -- (-3592.350) (-3601.207) [-3592.551] (-3601.133) * [-3596.871] (-3589.746) (-3595.469) (-3596.560) -- 0:03:23 612500 -- (-3595.107) [-3600.313] (-3605.452) (-3588.968) * (-3594.409) [-3594.889] (-3601.950) (-3599.668) -- 0:03:23 613000 -- (-3603.206) [-3598.385] (-3596.913) (-3599.650) * (-3597.393) [-3588.755] (-3604.944) (-3612.981) -- 0:03:22 613500 -- (-3595.721) (-3593.754) (-3594.725) [-3605.844] * [-3588.419] (-3596.728) (-3589.347) (-3597.587) -- 0:03:22 614000 -- (-3591.196) [-3602.917] (-3600.934) (-3608.971) * (-3591.870) [-3588.651] (-3612.928) (-3604.447) -- 0:03:22 614500 -- (-3595.382) (-3599.196) [-3594.579] (-3603.719) * [-3588.340] (-3596.793) (-3600.840) (-3587.391) -- 0:03:22 615000 -- (-3592.770) [-3588.332] (-3598.441) (-3595.307) * (-3600.863) (-3594.021) (-3598.576) [-3598.910] -- 0:03:21 Average standard deviation of split frequencies: 0.004898 615500 -- [-3593.624] (-3596.143) (-3603.348) (-3598.547) * (-3600.782) (-3589.037) [-3596.052] (-3597.160) -- 0:03:21 616000 -- [-3595.310] (-3598.118) (-3603.666) (-3599.376) * (-3594.284) (-3597.941) (-3590.442) [-3596.346] -- 0:03:21 616500 -- (-3603.932) [-3593.560] (-3596.587) (-3594.345) * (-3596.469) (-3597.772) (-3593.548) [-3598.159] -- 0:03:20 617000 -- (-3596.929) [-3588.392] (-3592.529) (-3595.487) * (-3601.359) (-3591.395) [-3591.474] (-3598.513) -- 0:03:20 617500 -- [-3598.515] (-3594.848) (-3608.284) (-3601.393) * (-3601.239) (-3596.002) (-3595.088) [-3598.736] -- 0:03:20 618000 -- [-3590.554] (-3601.710) (-3597.229) (-3598.044) * (-3598.149) [-3606.279] (-3592.421) (-3600.829) -- 0:03:20 618500 -- (-3600.645) (-3600.767) [-3589.403] (-3596.138) * [-3591.940] (-3600.686) (-3587.587) (-3605.749) -- 0:03:19 619000 -- (-3601.943) [-3592.508] (-3588.710) (-3602.586) * (-3594.431) (-3597.439) [-3587.820] (-3592.570) -- 0:03:20 619500 -- (-3594.428) (-3596.004) [-3595.597] (-3593.907) * (-3588.560) [-3588.970] (-3601.206) (-3596.595) -- 0:03:19 620000 -- (-3591.393) (-3599.102) [-3592.149] (-3588.192) * (-3593.002) (-3597.299) [-3598.678] (-3594.788) -- 0:03:19 Average standard deviation of split frequencies: 0.005317 620500 -- (-3601.974) (-3592.524) (-3593.903) [-3593.363] * (-3593.436) (-3590.385) [-3602.515] (-3588.816) -- 0:03:18 621000 -- (-3605.761) (-3599.103) (-3595.097) [-3599.118] * (-3594.943) [-3593.746] (-3603.620) (-3588.074) -- 0:03:18 621500 -- (-3593.699) [-3595.761] (-3598.382) (-3609.615) * (-3593.033) (-3595.572) [-3589.194] (-3591.574) -- 0:03:18 622000 -- (-3601.659) (-3602.097) [-3597.782] (-3591.994) * (-3607.508) [-3592.760] (-3598.857) (-3592.451) -- 0:03:18 622500 -- [-3595.463] (-3589.916) (-3597.379) (-3598.735) * (-3602.842) [-3592.447] (-3605.666) (-3594.073) -- 0:03:17 623000 -- (-3596.968) (-3593.605) (-3597.065) [-3598.863] * (-3597.967) (-3594.795) (-3604.162) [-3598.864] -- 0:03:17 623500 -- (-3601.491) (-3597.354) (-3596.037) [-3591.017] * (-3605.457) (-3596.990) (-3602.808) [-3592.228] -- 0:03:17 624000 -- (-3601.561) (-3591.000) [-3593.417] (-3592.292) * (-3593.526) (-3595.767) [-3590.571] (-3596.637) -- 0:03:17 624500 -- (-3600.093) [-3600.458] (-3599.841) (-3591.814) * (-3599.406) [-3597.505] (-3595.663) (-3598.374) -- 0:03:16 625000 -- (-3603.900) (-3593.463) [-3591.933] (-3600.314) * [-3592.722] (-3592.714) (-3608.689) (-3594.504) -- 0:03:16 Average standard deviation of split frequencies: 0.004819 625500 -- (-3596.487) (-3593.886) [-3588.848] (-3596.812) * (-3590.853) [-3595.819] (-3596.223) (-3599.556) -- 0:03:16 626000 -- (-3596.436) [-3590.263] (-3597.510) (-3601.025) * [-3591.288] (-3589.429) (-3589.889) (-3611.065) -- 0:03:15 626500 -- (-3600.790) (-3594.588) [-3592.653] (-3602.472) * (-3598.287) (-3591.107) [-3591.331] (-3600.032) -- 0:03:15 627000 -- (-3595.556) (-3595.140) (-3597.924) [-3590.440] * (-3598.722) [-3589.817] (-3596.302) (-3597.548) -- 0:03:15 627500 -- (-3594.458) (-3597.700) (-3592.657) [-3595.965] * (-3593.147) [-3593.634] (-3594.937) (-3590.369) -- 0:03:15 628000 -- (-3596.581) (-3593.857) (-3589.426) [-3595.129] * (-3600.232) (-3591.301) (-3589.707) [-3595.180] -- 0:03:14 628500 -- (-3590.049) (-3594.742) [-3597.741] (-3599.162) * [-3596.616] (-3592.456) (-3593.577) (-3588.111) -- 0:03:14 629000 -- [-3589.260] (-3600.213) (-3597.021) (-3596.898) * (-3599.322) (-3600.532) [-3597.936] (-3602.197) -- 0:03:14 629500 -- [-3593.103] (-3589.566) (-3595.108) (-3588.589) * (-3602.187) [-3591.559] (-3591.311) (-3605.798) -- 0:03:14 630000 -- (-3594.937) (-3604.589) (-3597.965) [-3587.401] * [-3590.305] (-3593.667) (-3591.715) (-3596.664) -- 0:03:13 Average standard deviation of split frequencies: 0.004709 630500 -- (-3599.056) (-3593.016) (-3594.768) [-3600.602] * (-3604.053) (-3599.541) [-3594.807] (-3602.999) -- 0:03:13 631000 -- (-3596.393) (-3612.654) [-3598.486] (-3590.742) * [-3596.096] (-3598.813) (-3593.193) (-3610.754) -- 0:03:13 631500 -- [-3596.748] (-3600.442) (-3606.586) (-3595.294) * (-3597.994) (-3604.512) (-3595.564) [-3598.426] -- 0:03:13 632000 -- (-3591.956) (-3594.048) [-3605.696] (-3600.292) * (-3594.082) [-3590.185] (-3598.189) (-3598.158) -- 0:03:12 632500 -- [-3593.726] (-3593.155) (-3602.402) (-3601.304) * [-3596.398] (-3597.410) (-3604.137) (-3599.866) -- 0:03:12 633000 -- [-3596.245] (-3592.952) (-3598.397) (-3598.359) * [-3590.445] (-3591.045) (-3599.728) (-3591.202) -- 0:03:12 633500 -- [-3593.236] (-3598.906) (-3600.753) (-3608.950) * (-3601.933) (-3596.198) (-3601.909) [-3600.483] -- 0:03:12 634000 -- (-3588.628) (-3606.520) [-3594.055] (-3592.300) * (-3603.613) (-3595.942) [-3599.902] (-3598.284) -- 0:03:11 634500 -- [-3594.796] (-3605.358) (-3598.347) (-3599.634) * (-3594.918) (-3594.431) [-3587.386] (-3596.215) -- 0:03:11 635000 -- (-3598.417) (-3592.920) [-3600.335] (-3599.915) * (-3589.564) (-3603.371) (-3595.305) [-3592.265] -- 0:03:11 Average standard deviation of split frequencies: 0.004595 635500 -- [-3588.992] (-3605.939) (-3593.958) (-3592.494) * [-3593.964] (-3601.754) (-3602.656) (-3596.032) -- 0:03:10 636000 -- (-3594.681) (-3596.651) (-3600.124) [-3588.877] * (-3596.319) [-3593.541] (-3600.987) (-3590.867) -- 0:03:10 636500 -- (-3593.015) (-3591.476) [-3586.333] (-3603.457) * (-3590.206) [-3596.721] (-3606.438) (-3593.319) -- 0:03:10 637000 -- (-3604.716) [-3590.532] (-3595.104) (-3588.434) * (-3599.110) [-3590.999] (-3599.410) (-3585.779) -- 0:03:10 637500 -- (-3594.997) (-3594.725) (-3601.634) [-3590.878] * [-3594.826] (-3591.354) (-3604.075) (-3592.037) -- 0:03:09 638000 -- (-3590.875) (-3600.310) [-3588.911] (-3597.980) * (-3599.020) [-3597.127] (-3597.830) (-3593.603) -- 0:03:09 638500 -- [-3589.935] (-3595.524) (-3589.336) (-3591.793) * (-3594.524) (-3604.278) [-3593.931] (-3591.834) -- 0:03:09 639000 -- (-3589.053) (-3598.580) [-3593.843] (-3599.685) * (-3595.090) [-3598.022] (-3593.775) (-3588.931) -- 0:03:09 639500 -- (-3592.001) (-3597.886) (-3601.069) [-3596.280] * (-3595.106) (-3600.393) [-3592.028] (-3596.103) -- 0:03:08 640000 -- (-3595.854) (-3599.409) (-3596.734) [-3595.058] * [-3598.511] (-3601.391) (-3588.846) (-3588.775) -- 0:03:08 Average standard deviation of split frequencies: 0.004709 640500 -- (-3589.896) (-3591.917) [-3593.323] (-3606.130) * (-3590.854) (-3599.966) [-3598.223] (-3599.127) -- 0:03:08 641000 -- [-3591.675] (-3598.317) (-3597.358) (-3593.966) * [-3593.680] (-3592.800) (-3599.291) (-3606.264) -- 0:03:08 641500 -- (-3596.871) (-3587.700) [-3598.560] (-3599.730) * [-3588.159] (-3597.753) (-3601.129) (-3599.098) -- 0:03:07 642000 -- (-3589.925) [-3597.621] (-3601.697) (-3608.810) * (-3595.781) (-3593.780) (-3595.269) [-3595.209] -- 0:03:07 642500 -- (-3589.201) (-3599.948) (-3591.610) [-3592.955] * [-3587.944] (-3598.214) (-3591.363) (-3599.408) -- 0:03:07 643000 -- (-3597.093) [-3596.640] (-3606.618) (-3593.595) * [-3594.566] (-3600.142) (-3594.557) (-3598.991) -- 0:03:07 643500 -- (-3605.273) [-3591.002] (-3590.803) (-3600.298) * [-3594.301] (-3613.390) (-3592.400) (-3589.231) -- 0:03:06 644000 -- (-3603.498) (-3598.070) [-3594.107] (-3593.087) * (-3599.057) (-3603.838) (-3600.648) [-3590.321] -- 0:03:06 644500 -- [-3591.707] (-3593.289) (-3588.936) (-3599.238) * [-3590.789] (-3595.957) (-3590.807) (-3597.102) -- 0:03:06 645000 -- [-3590.952] (-3598.746) (-3598.442) (-3598.559) * [-3590.720] (-3596.586) (-3596.568) (-3601.511) -- 0:03:06 Average standard deviation of split frequencies: 0.003430 645500 -- (-3597.145) [-3598.289] (-3594.438) (-3606.461) * (-3591.934) (-3600.428) [-3597.148] (-3602.517) -- 0:03:05 646000 -- (-3592.628) [-3596.592] (-3599.266) (-3597.857) * [-3595.154] (-3597.123) (-3599.770) (-3594.498) -- 0:03:05 646500 -- (-3595.411) (-3595.203) (-3586.441) [-3593.031] * (-3605.745) (-3588.093) [-3593.684] (-3594.197) -- 0:03:05 647000 -- (-3594.400) (-3596.306) [-3597.740] (-3599.464) * [-3598.547] (-3593.141) (-3592.258) (-3589.867) -- 0:03:04 647500 -- [-3595.594] (-3602.948) (-3601.629) (-3606.032) * (-3607.634) (-3599.783) [-3591.452] (-3596.773) -- 0:03:04 648000 -- (-3592.142) (-3597.192) (-3593.460) [-3588.625] * (-3593.994) (-3593.428) [-3591.861] (-3591.243) -- 0:03:04 648500 -- [-3596.094] (-3594.381) (-3602.711) (-3593.197) * (-3595.794) [-3593.025] (-3593.552) (-3599.118) -- 0:03:04 649000 -- (-3595.079) (-3592.745) [-3591.234] (-3605.574) * (-3594.908) (-3595.716) (-3590.778) [-3594.098] -- 0:03:03 649500 -- [-3598.657] (-3592.687) (-3589.967) (-3607.012) * (-3593.792) (-3592.792) [-3596.003] (-3598.348) -- 0:03:03 650000 -- (-3597.626) (-3599.628) [-3592.748] (-3596.435) * (-3595.684) (-3599.608) [-3601.722] (-3604.346) -- 0:03:03 Average standard deviation of split frequencies: 0.003550 650500 -- [-3599.244] (-3601.989) (-3593.749) (-3599.449) * [-3593.773] (-3606.230) (-3593.256) (-3597.545) -- 0:03:03 651000 -- (-3595.765) (-3596.418) (-3595.318) [-3596.276] * (-3598.147) (-3600.704) (-3590.703) [-3594.301] -- 0:03:02 651500 -- (-3596.588) [-3596.955] (-3594.002) (-3592.415) * (-3595.776) (-3591.668) (-3600.364) [-3594.520] -- 0:03:02 652000 -- (-3599.628) (-3599.664) (-3598.352) [-3588.635] * (-3605.449) (-3590.405) (-3598.279) [-3595.911] -- 0:03:02 652500 -- [-3594.030] (-3592.348) (-3596.950) (-3603.738) * (-3597.117) [-3590.655] (-3598.893) (-3591.898) -- 0:03:02 653000 -- [-3588.146] (-3590.300) (-3597.242) (-3588.032) * (-3600.496) [-3595.285] (-3594.779) (-3597.114) -- 0:03:01 653500 -- [-3592.065] (-3591.183) (-3593.751) (-3605.921) * (-3602.020) (-3598.454) (-3596.340) [-3597.958] -- 0:03:01 654000 -- (-3591.955) (-3595.056) (-3590.581) [-3594.363] * (-3595.454) [-3599.272] (-3603.090) (-3602.056) -- 0:03:01 654500 -- [-3592.979] (-3598.904) (-3590.809) (-3591.724) * (-3593.102) (-3605.809) [-3597.610] (-3604.708) -- 0:03:01 655000 -- (-3594.883) [-3589.810] (-3595.094) (-3599.331) * (-3592.701) [-3595.921] (-3595.560) (-3597.926) -- 0:03:00 Average standard deviation of split frequencies: 0.002803 655500 -- (-3595.070) (-3594.831) (-3592.083) [-3595.986] * (-3587.839) (-3610.728) (-3608.253) [-3603.994] -- 0:03:00 656000 -- (-3596.276) (-3595.783) [-3594.942] (-3592.411) * (-3595.074) (-3604.981) [-3595.770] (-3595.847) -- 0:03:00 656500 -- (-3597.282) (-3593.477) [-3604.998] (-3596.113) * (-3597.399) [-3591.219] (-3589.533) (-3601.979) -- 0:02:59 657000 -- (-3603.124) (-3604.559) (-3609.988) [-3590.972] * (-3592.995) (-3593.781) [-3594.081] (-3597.307) -- 0:02:59 657500 -- (-3599.609) (-3602.051) (-3614.342) [-3595.304] * (-3597.394) (-3597.910) [-3597.914] (-3598.028) -- 0:02:59 658000 -- [-3592.556] (-3594.351) (-3595.481) (-3595.941) * (-3600.155) [-3595.134] (-3598.261) (-3598.324) -- 0:02:59 658500 -- (-3601.520) (-3603.674) [-3594.096] (-3597.365) * (-3600.957) [-3596.674] (-3593.879) (-3598.959) -- 0:02:58 659000 -- (-3594.541) (-3604.815) (-3603.031) [-3600.410] * (-3593.108) (-3596.838) (-3596.750) [-3596.577] -- 0:02:58 659500 -- (-3593.720) [-3591.706] (-3597.991) (-3599.204) * (-3591.293) [-3594.787] (-3595.604) (-3602.678) -- 0:02:58 660000 -- (-3599.128) (-3589.409) [-3602.376] (-3597.750) * (-3599.363) (-3592.692) (-3599.457) [-3595.753] -- 0:02:58 Average standard deviation of split frequencies: 0.002426 660500 -- [-3594.342] (-3598.635) (-3600.804) (-3597.581) * (-3596.994) (-3594.030) [-3594.611] (-3597.972) -- 0:02:57 661000 -- [-3593.735] (-3598.855) (-3593.690) (-3599.090) * (-3590.283) (-3598.996) [-3587.941] (-3598.572) -- 0:02:57 661500 -- (-3610.426) [-3600.679] (-3598.961) (-3596.257) * (-3586.674) (-3593.522) [-3585.549] (-3598.228) -- 0:02:57 662000 -- (-3594.247) (-3601.896) (-3595.685) [-3591.090] * (-3601.401) [-3595.349] (-3590.472) (-3598.458) -- 0:02:57 662500 -- (-3591.399) [-3597.082] (-3589.591) (-3606.763) * [-3601.735] (-3595.536) (-3593.959) (-3602.851) -- 0:02:56 663000 -- [-3592.248] (-3588.505) (-3602.609) (-3605.735) * [-3601.059] (-3592.454) (-3603.342) (-3594.526) -- 0:02:56 663500 -- [-3595.080] (-3589.772) (-3598.368) (-3591.511) * (-3607.202) (-3594.477) (-3597.172) [-3596.582] -- 0:02:56 664000 -- [-3591.456] (-3593.432) (-3597.523) (-3595.196) * (-3592.470) (-3597.109) [-3592.571] (-3588.989) -- 0:02:56 664500 -- (-3597.060) (-3604.909) [-3595.368] (-3592.703) * (-3595.200) [-3598.879] (-3599.846) (-3591.132) -- 0:02:55 665000 -- (-3597.775) (-3598.629) [-3588.484] (-3594.189) * (-3605.665) (-3594.639) [-3596.526] (-3595.969) -- 0:02:55 Average standard deviation of split frequencies: 0.001840 665500 -- [-3592.273] (-3600.424) (-3601.267) (-3600.341) * [-3589.541] (-3598.391) (-3594.567) (-3597.071) -- 0:02:55 666000 -- [-3590.135] (-3594.104) (-3595.925) (-3592.839) * (-3589.599) (-3597.654) (-3603.918) [-3596.790] -- 0:02:55 666500 -- (-3599.536) (-3592.209) [-3599.128] (-3597.356) * (-3594.727) [-3596.932] (-3600.192) (-3596.221) -- 0:02:54 667000 -- (-3589.856) [-3598.604] (-3595.719) (-3601.690) * (-3600.302) (-3595.504) [-3596.632] (-3590.610) -- 0:02:54 667500 -- (-3596.213) [-3594.536] (-3592.948) (-3592.701) * [-3592.530] (-3591.578) (-3601.233) (-3589.548) -- 0:02:54 668000 -- [-3588.197] (-3594.917) (-3600.438) (-3597.298) * (-3597.724) [-3594.712] (-3604.157) (-3598.957) -- 0:02:53 668500 -- (-3592.174) (-3596.436) (-3597.257) [-3588.624] * (-3599.785) (-3593.698) (-3595.146) [-3591.906] -- 0:02:53 669000 -- (-3592.698) [-3599.038] (-3593.350) (-3603.297) * (-3593.733) (-3592.551) [-3589.878] (-3594.323) -- 0:02:53 669500 -- (-3600.200) (-3590.391) [-3594.990] (-3610.655) * (-3596.508) (-3604.102) [-3590.766] (-3592.571) -- 0:02:53 670000 -- [-3590.006] (-3598.411) (-3598.120) (-3592.422) * (-3594.617) (-3601.911) (-3592.758) [-3596.049] -- 0:02:52 Average standard deviation of split frequencies: 0.001617 670500 -- (-3608.163) (-3599.442) (-3606.030) [-3592.363] * (-3596.039) (-3600.499) (-3598.017) [-3588.852] -- 0:02:52 671000 -- (-3594.771) (-3597.818) (-3604.522) [-3589.043] * (-3600.707) (-3592.372) (-3603.876) [-3594.254] -- 0:02:52 671500 -- [-3591.360] (-3592.594) (-3599.898) (-3596.776) * (-3597.029) [-3589.652] (-3593.321) (-3595.941) -- 0:02:52 672000 -- (-3589.699) (-3593.766) [-3597.974] (-3588.347) * (-3596.107) (-3598.489) [-3595.337] (-3591.001) -- 0:02:51 672500 -- (-3594.628) (-3599.809) (-3602.428) [-3594.779] * [-3588.525] (-3596.239) (-3596.328) (-3593.269) -- 0:02:51 673000 -- (-3593.700) [-3592.300] (-3596.458) (-3604.770) * (-3586.521) (-3598.655) [-3592.315] (-3594.492) -- 0:02:51 673500 -- (-3588.379) [-3601.019] (-3597.133) (-3602.490) * [-3589.186] (-3614.852) (-3604.908) (-3597.450) -- 0:02:51 674000 -- (-3595.728) [-3593.422] (-3596.492) (-3597.870) * (-3594.331) [-3591.847] (-3602.382) (-3598.953) -- 0:02:50 674500 -- [-3593.388] (-3599.917) (-3592.777) (-3594.373) * [-3600.263] (-3601.616) (-3595.015) (-3594.091) -- 0:02:50 675000 -- (-3599.193) (-3598.797) (-3598.162) [-3604.922] * (-3600.383) (-3593.076) (-3596.276) [-3591.030] -- 0:02:50 Average standard deviation of split frequencies: 0.001883 675500 -- (-3596.213) [-3589.351] (-3613.268) (-3608.761) * (-3595.925) (-3592.873) [-3590.174] (-3598.012) -- 0:02:50 676000 -- [-3595.376] (-3592.764) (-3596.646) (-3603.024) * [-3589.002] (-3591.483) (-3592.577) (-3596.580) -- 0:02:49 676500 -- (-3596.245) [-3595.966] (-3591.784) (-3600.288) * (-3592.480) (-3599.326) (-3587.899) [-3595.308] -- 0:02:49 677000 -- [-3590.619] (-3597.824) (-3592.515) (-3594.611) * (-3593.199) [-3589.018] (-3593.164) (-3588.571) -- 0:02:49 677500 -- [-3587.147] (-3597.573) (-3596.619) (-3592.027) * [-3587.844] (-3599.983) (-3590.432) (-3592.866) -- 0:02:48 678000 -- (-3592.351) [-3588.720] (-3603.494) (-3594.826) * (-3607.458) (-3595.822) (-3602.248) [-3597.541] -- 0:02:48 678500 -- [-3594.813] (-3601.582) (-3598.831) (-3601.342) * [-3587.690] (-3591.895) (-3593.666) (-3592.925) -- 0:02:48 679000 -- [-3595.151] (-3608.077) (-3593.526) (-3597.453) * (-3596.253) (-3590.772) [-3595.751] (-3599.554) -- 0:02:48 679500 -- (-3592.047) (-3591.409) [-3605.741] (-3610.117) * [-3593.030] (-3600.778) (-3586.948) (-3592.131) -- 0:02:47 680000 -- (-3596.447) (-3601.088) [-3592.058] (-3600.590) * [-3588.232] (-3601.266) (-3598.489) (-3599.133) -- 0:02:47 Average standard deviation of split frequencies: 0.002008 680500 -- (-3590.821) [-3594.634] (-3600.416) (-3599.621) * [-3593.723] (-3599.361) (-3592.851) (-3590.214) -- 0:02:47 681000 -- (-3595.248) (-3601.860) (-3598.596) [-3597.065] * (-3603.240) [-3596.137] (-3594.867) (-3600.249) -- 0:02:47 681500 -- [-3592.665] (-3594.031) (-3595.741) (-3600.616) * (-3599.051) (-3594.193) [-3600.103] (-3604.634) -- 0:02:46 682000 -- (-3595.735) (-3590.267) [-3597.741] (-3594.916) * (-3596.560) (-3592.445) (-3601.643) [-3598.078] -- 0:02:46 682500 -- (-3598.201) (-3598.834) [-3593.254] (-3598.584) * (-3594.571) (-3593.622) [-3594.803] (-3598.264) -- 0:02:46 683000 -- (-3595.183) [-3592.876] (-3597.723) (-3598.381) * (-3607.660) [-3594.725] (-3602.728) (-3598.521) -- 0:02:46 683500 -- (-3601.862) (-3593.078) [-3596.711] (-3598.704) * [-3596.187] (-3595.804) (-3592.758) (-3598.665) -- 0:02:45 684000 -- (-3595.294) [-3594.264] (-3595.632) (-3597.364) * [-3602.823] (-3587.863) (-3591.789) (-3604.504) -- 0:02:45 684500 -- (-3598.063) (-3598.784) (-3593.301) [-3593.325] * (-3591.756) (-3605.402) [-3595.616] (-3605.118) -- 0:02:45 685000 -- [-3594.398] (-3595.208) (-3599.982) (-3592.918) * [-3596.293] (-3601.343) (-3600.407) (-3595.527) -- 0:02:45 Average standard deviation of split frequencies: 0.001993 685500 -- (-3591.062) (-3602.347) (-3597.099) [-3592.804] * (-3597.162) (-3599.218) (-3599.230) [-3597.829] -- 0:02:44 686000 -- [-3592.860] (-3599.806) (-3594.236) (-3605.970) * (-3591.811) (-3612.780) [-3593.643] (-3591.384) -- 0:02:44 686500 -- (-3594.251) (-3589.957) (-3589.901) [-3596.541] * (-3589.426) [-3603.428] (-3596.187) (-3594.402) -- 0:02:44 687000 -- (-3596.073) (-3595.829) (-3598.177) [-3596.475] * (-3601.085) (-3601.284) (-3593.984) [-3595.802] -- 0:02:44 687500 -- [-3591.718] (-3593.029) (-3604.793) (-3604.366) * (-3593.260) (-3606.623) [-3591.652] (-3589.929) -- 0:02:43 688000 -- [-3590.237] (-3591.795) (-3592.012) (-3606.902) * (-3606.038) [-3593.052] (-3599.344) (-3594.047) -- 0:02:43 688500 -- (-3600.997) (-3601.645) [-3598.502] (-3596.733) * (-3600.291) (-3601.497) (-3593.716) [-3604.049] -- 0:02:43 689000 -- (-3596.184) [-3593.568] (-3596.610) (-3605.850) * (-3590.665) (-3602.270) [-3594.198] (-3604.317) -- 0:02:42 689500 -- (-3601.679) [-3589.802] (-3594.022) (-3598.840) * (-3591.232) (-3597.329) (-3588.156) [-3592.537] -- 0:02:42 690000 -- (-3611.918) [-3595.242] (-3598.982) (-3602.390) * [-3590.988] (-3593.289) (-3593.602) (-3591.196) -- 0:02:42 Average standard deviation of split frequencies: 0.001638 690500 -- (-3601.025) (-3593.192) [-3589.343] (-3590.418) * (-3598.640) (-3600.677) (-3592.975) [-3589.393] -- 0:02:42 691000 -- (-3597.395) (-3595.693) (-3607.344) [-3589.775] * (-3588.801) (-3597.623) (-3598.458) [-3604.328] -- 0:02:41 691500 -- [-3592.952] (-3600.475) (-3592.624) (-3592.052) * (-3597.651) (-3591.939) (-3592.651) [-3586.843] -- 0:02:41 692000 -- [-3587.471] (-3591.535) (-3607.762) (-3593.979) * [-3592.146] (-3594.185) (-3589.835) (-3593.419) -- 0:02:41 692500 -- [-3591.919] (-3599.441) (-3605.823) (-3596.024) * (-3597.315) (-3598.974) (-3592.790) [-3594.994] -- 0:02:41 693000 -- (-3591.474) [-3594.048] (-3594.937) (-3598.999) * (-3608.940) (-3606.095) (-3597.887) [-3589.851] -- 0:02:40 693500 -- (-3591.307) (-3602.325) [-3592.739] (-3587.758) * [-3596.905] (-3598.545) (-3593.711) (-3593.144) -- 0:02:40 694000 -- (-3605.005) (-3595.828) [-3589.020] (-3593.773) * (-3599.227) [-3590.808] (-3601.827) (-3597.471) -- 0:02:40 694500 -- (-3599.686) [-3586.886] (-3600.306) (-3590.051) * (-3603.259) [-3596.032] (-3599.305) (-3602.776) -- 0:02:40 695000 -- (-3588.638) (-3596.002) [-3593.535] (-3593.317) * (-3594.215) [-3593.347] (-3596.877) (-3590.256) -- 0:02:39 Average standard deviation of split frequencies: 0.001829 695500 -- [-3592.111] (-3596.887) (-3591.556) (-3589.333) * (-3596.469) (-3597.973) [-3592.918] (-3598.893) -- 0:02:39 696000 -- [-3602.546] (-3601.513) (-3593.070) (-3596.867) * (-3591.640) [-3591.586] (-3595.621) (-3608.376) -- 0:02:39 696500 -- (-3594.249) [-3594.439] (-3598.828) (-3592.855) * (-3600.447) (-3590.778) [-3594.161] (-3593.619) -- 0:02:39 697000 -- [-3592.497] (-3604.290) (-3599.216) (-3589.076) * (-3591.473) (-3603.113) [-3593.612] (-3597.245) -- 0:02:38 697500 -- (-3595.659) (-3602.309) [-3587.077] (-3594.918) * [-3595.987] (-3598.648) (-3593.559) (-3590.920) -- 0:02:38 698000 -- [-3592.693] (-3596.625) (-3591.191) (-3597.499) * [-3589.270] (-3596.179) (-3601.555) (-3594.512) -- 0:02:38 698500 -- (-3592.363) [-3591.358] (-3596.835) (-3605.885) * [-3599.165] (-3600.880) (-3603.895) (-3592.643) -- 0:02:37 699000 -- (-3589.357) (-3613.914) (-3596.141) [-3596.017] * [-3587.545] (-3597.548) (-3591.899) (-3604.644) -- 0:02:37 699500 -- [-3603.335] (-3602.596) (-3598.847) (-3599.677) * [-3591.795] (-3593.491) (-3600.798) (-3593.454) -- 0:02:37 700000 -- (-3605.432) (-3595.234) [-3592.592] (-3598.832) * [-3592.851] (-3603.868) (-3594.637) (-3594.379) -- 0:02:37 Average standard deviation of split frequencies: 0.002018 700500 -- (-3611.558) (-3592.088) [-3597.139] (-3606.176) * (-3600.022) (-3589.733) [-3594.031] (-3596.696) -- 0:02:36 701000 -- (-3603.624) [-3589.975] (-3593.766) (-3591.947) * (-3598.752) (-3594.098) [-3595.831] (-3594.773) -- 0:02:36 701500 -- (-3594.245) (-3598.070) [-3600.582] (-3598.203) * (-3595.792) (-3608.690) [-3602.875] (-3602.619) -- 0:02:36 702000 -- (-3588.591) (-3595.898) (-3598.695) [-3592.672] * (-3602.043) (-3607.617) (-3593.029) [-3590.843] -- 0:02:36 702500 -- (-3594.080) (-3603.304) (-3590.628) [-3593.408] * [-3591.481] (-3599.189) (-3598.407) (-3594.508) -- 0:02:35 703000 -- (-3594.794) [-3592.030] (-3600.097) (-3595.442) * (-3593.628) (-3606.524) (-3596.791) [-3594.322] -- 0:02:35 703500 -- (-3599.722) (-3598.519) [-3588.852] (-3604.614) * (-3584.754) (-3604.104) [-3590.958] (-3592.419) -- 0:02:35 704000 -- (-3597.366) [-3592.863] (-3591.763) (-3592.989) * (-3594.874) (-3604.160) [-3595.010] (-3600.174) -- 0:02:35 704500 -- (-3592.956) (-3587.801) (-3591.853) [-3596.869] * (-3592.388) [-3598.453] (-3590.325) (-3606.375) -- 0:02:34 705000 -- (-3591.492) (-3592.351) (-3594.116) [-3608.047] * [-3591.675] (-3591.348) (-3600.832) (-3595.881) -- 0:02:34 Average standard deviation of split frequencies: 0.001936 705500 -- [-3592.874] (-3593.338) (-3595.464) (-3600.074) * [-3590.221] (-3594.560) (-3603.055) (-3595.229) -- 0:02:34 706000 -- (-3591.727) (-3606.000) (-3581.664) [-3595.097] * (-3594.774) (-3599.495) [-3591.101] (-3598.708) -- 0:02:34 706500 -- (-3599.513) [-3598.431] (-3592.310) (-3609.574) * (-3618.164) [-3604.821] (-3597.141) (-3597.147) -- 0:02:33 707000 -- (-3592.133) (-3598.199) (-3603.242) [-3591.498] * (-3597.739) (-3602.791) [-3589.964] (-3597.151) -- 0:02:33 707500 -- (-3590.733) (-3602.949) (-3598.195) [-3590.458] * [-3596.213] (-3594.819) (-3598.784) (-3600.053) -- 0:02:33 708000 -- [-3593.761] (-3598.381) (-3605.463) (-3591.776) * (-3590.335) (-3599.387) [-3593.857] (-3605.948) -- 0:02:33 708500 -- (-3596.858) (-3594.935) (-3594.960) [-3594.681] * (-3602.229) (-3603.001) [-3594.839] (-3595.707) -- 0:02:32 709000 -- (-3600.804) (-3593.540) [-3592.100] (-3596.827) * (-3604.893) (-3600.241) (-3592.546) [-3589.407] -- 0:02:32 709500 -- (-3597.139) [-3587.588] (-3596.093) (-3587.956) * [-3600.165] (-3596.275) (-3603.267) (-3593.665) -- 0:02:32 710000 -- (-3597.943) (-3595.906) (-3593.139) [-3593.292] * [-3590.780] (-3599.080) (-3593.272) (-3588.128) -- 0:02:31 Average standard deviation of split frequencies: 0.001924 710500 -- (-3599.425) [-3596.423] (-3591.979) (-3601.889) * (-3597.610) (-3601.659) [-3601.536] (-3592.322) -- 0:02:31 711000 -- (-3601.960) (-3598.181) (-3594.816) [-3595.948] * (-3596.923) (-3597.038) [-3592.867] (-3595.078) -- 0:02:31 711500 -- (-3601.058) [-3592.003] (-3595.577) (-3589.070) * (-3594.050) [-3597.410] (-3602.004) (-3597.482) -- 0:02:31 712000 -- [-3593.953] (-3602.758) (-3613.656) (-3595.449) * (-3601.636) (-3600.911) (-3597.819) [-3593.418] -- 0:02:30 712500 -- (-3601.157) (-3596.849) (-3598.042) [-3589.455] * (-3601.632) (-3601.559) (-3592.641) [-3591.020] -- 0:02:30 713000 -- (-3594.081) (-3596.759) [-3589.119] (-3596.747) * [-3593.677] (-3603.792) (-3592.658) (-3594.403) -- 0:02:30 713500 -- (-3598.673) [-3590.954] (-3592.304) (-3601.627) * [-3597.302] (-3597.021) (-3605.251) (-3610.629) -- 0:02:30 714000 -- (-3592.069) (-3589.290) [-3596.372] (-3595.300) * [-3596.553] (-3609.408) (-3605.341) (-3594.369) -- 0:02:29 714500 -- (-3589.792) [-3595.140] (-3596.800) (-3604.936) * (-3596.964) [-3590.392] (-3601.806) (-3594.543) -- 0:02:29 715000 -- (-3594.481) (-3596.462) (-3592.529) [-3592.357] * (-3589.209) (-3591.674) (-3599.910) [-3590.671] -- 0:02:29 Average standard deviation of split frequencies: 0.002239 715500 -- (-3595.073) [-3602.829] (-3595.670) (-3596.634) * (-3597.714) (-3599.143) [-3599.984] (-3603.887) -- 0:02:29 716000 -- [-3596.495] (-3605.888) (-3593.640) (-3586.460) * (-3590.620) (-3596.545) (-3593.540) [-3597.858] -- 0:02:28 716500 -- (-3599.647) (-3602.799) (-3594.562) [-3595.353] * (-3602.655) [-3587.436] (-3593.165) (-3587.885) -- 0:02:28 717000 -- (-3597.347) (-3602.489) (-3594.348) [-3592.457] * (-3603.260) (-3590.437) [-3587.267] (-3596.306) -- 0:02:28 717500 -- (-3597.839) (-3607.866) (-3602.461) [-3592.337] * (-3595.471) (-3596.887) [-3592.642] (-3603.883) -- 0:02:28 718000 -- [-3597.269] (-3609.118) (-3601.330) (-3593.200) * (-3597.949) [-3590.613] (-3592.887) (-3605.108) -- 0:02:28 718500 -- [-3596.175] (-3597.733) (-3601.407) (-3598.454) * (-3597.415) [-3590.382] (-3592.883) (-3594.944) -- 0:02:27 719000 -- (-3590.559) (-3591.354) (-3599.036) [-3595.388] * (-3590.772) (-3597.836) [-3590.459] (-3597.430) -- 0:02:27 719500 -- (-3588.756) [-3589.210] (-3607.138) (-3603.481) * [-3588.144] (-3593.272) (-3598.676) (-3599.419) -- 0:02:26 720000 -- (-3594.766) [-3586.305] (-3602.114) (-3588.673) * (-3591.527) [-3592.851] (-3594.211) (-3607.069) -- 0:02:27 Average standard deviation of split frequencies: 0.002420 720500 -- (-3595.156) (-3593.745) [-3597.687] (-3602.811) * [-3591.965] (-3594.311) (-3592.805) (-3592.040) -- 0:02:26 721000 -- (-3596.306) (-3592.184) [-3598.264] (-3606.052) * (-3596.643) [-3595.690] (-3602.219) (-3593.534) -- 0:02:26 721500 -- (-3602.649) [-3596.841] (-3606.139) (-3603.246) * (-3605.838) (-3596.267) [-3593.587] (-3594.711) -- 0:02:25 722000 -- (-3595.265) (-3599.620) [-3592.635] (-3605.037) * (-3597.257) (-3589.501) (-3594.581) [-3595.856] -- 0:02:25 722500 -- (-3604.176) [-3594.356] (-3597.238) (-3598.200) * (-3596.886) (-3594.327) [-3592.176] (-3607.478) -- 0:02:25 723000 -- (-3593.102) (-3596.119) [-3597.763] (-3602.178) * (-3597.480) [-3598.974] (-3595.619) (-3619.471) -- 0:02:25 723500 -- (-3595.651) (-3594.936) (-3598.325) [-3601.302] * [-3600.649] (-3591.844) (-3589.881) (-3603.426) -- 0:02:24 724000 -- [-3590.975] (-3595.569) (-3598.569) (-3591.097) * (-3592.750) [-3593.853] (-3597.803) (-3601.093) -- 0:02:24 724500 -- [-3594.702] (-3597.800) (-3593.649) (-3592.064) * (-3593.406) (-3600.448) [-3593.248] (-3605.047) -- 0:02:24 725000 -- (-3604.192) (-3598.513) [-3597.479] (-3595.816) * [-3595.787] (-3591.812) (-3590.985) (-3603.719) -- 0:02:24 Average standard deviation of split frequencies: 0.002792 725500 -- [-3596.541] (-3589.304) (-3595.196) (-3598.155) * (-3602.125) (-3596.371) [-3595.751] (-3604.948) -- 0:02:23 726000 -- (-3598.382) (-3590.335) [-3595.215] (-3598.491) * (-3606.842) [-3586.735] (-3593.320) (-3597.228) -- 0:02:23 726500 -- [-3596.052] (-3596.436) (-3593.446) (-3604.018) * (-3596.393) (-3590.391) [-3595.061] (-3590.636) -- 0:02:23 727000 -- (-3591.093) (-3588.112) [-3590.893] (-3589.867) * [-3591.989] (-3606.475) (-3589.000) (-3603.715) -- 0:02:23 727500 -- (-3600.204) (-3596.575) [-3593.235] (-3594.493) * [-3598.049] (-3597.338) (-3595.930) (-3598.939) -- 0:02:23 728000 -- (-3600.244) (-3594.996) (-3604.047) [-3594.363] * (-3587.781) [-3594.274] (-3596.383) (-3592.433) -- 0:02:22 728500 -- (-3599.418) [-3597.826] (-3591.554) (-3599.239) * [-3590.307] (-3600.338) (-3604.118) (-3592.859) -- 0:02:22 729000 -- [-3593.643] (-3595.781) (-3595.196) (-3594.944) * (-3586.556) [-3596.515] (-3597.268) (-3597.698) -- 0:02:22 729500 -- (-3607.214) [-3592.631] (-3601.931) (-3592.815) * (-3592.372) (-3591.930) (-3595.457) [-3591.034] -- 0:02:22 730000 -- [-3598.315] (-3594.359) (-3595.648) (-3599.714) * (-3591.840) (-3599.830) (-3594.384) [-3591.023] -- 0:02:21 Average standard deviation of split frequencies: 0.002839 730500 -- [-3594.450] (-3592.987) (-3602.663) (-3597.163) * [-3591.629] (-3595.137) (-3592.422) (-3609.287) -- 0:02:21 731000 -- (-3597.159) [-3589.488] (-3594.982) (-3597.078) * (-3601.136) [-3595.279] (-3596.799) (-3593.520) -- 0:02:20 731500 -- (-3598.784) (-3599.339) [-3594.265] (-3588.738) * (-3589.628) [-3590.475] (-3605.042) (-3595.540) -- 0:02:20 732000 -- (-3601.937) (-3598.035) (-3591.880) [-3595.202] * (-3599.192) (-3593.417) [-3598.471] (-3595.251) -- 0:02:20 732500 -- (-3588.392) (-3600.651) [-3593.376] (-3594.822) * (-3588.855) (-3593.104) (-3606.846) [-3594.625] -- 0:02:20 733000 -- (-3595.506) (-3600.614) [-3594.091] (-3591.873) * (-3597.357) (-3596.966) (-3600.193) [-3593.183] -- 0:02:19 733500 -- (-3594.071) (-3596.186) (-3594.253) [-3589.611] * (-3596.666) (-3588.549) (-3600.100) [-3589.964] -- 0:02:19 734000 -- [-3600.162] (-3593.788) (-3595.277) (-3601.638) * (-3592.651) (-3596.800) [-3589.281] (-3605.838) -- 0:02:19 734500 -- (-3612.285) (-3596.070) [-3586.769] (-3595.104) * (-3604.668) (-3594.644) (-3591.534) [-3590.153] -- 0:02:19 735000 -- (-3597.154) (-3587.994) (-3599.890) [-3597.540] * [-3590.954] (-3610.050) (-3597.235) (-3600.760) -- 0:02:18 Average standard deviation of split frequencies: 0.003074 735500 -- (-3600.976) (-3589.646) [-3594.982] (-3601.032) * (-3594.766) (-3594.943) [-3594.287] (-3587.430) -- 0:02:18 736000 -- (-3589.437) (-3593.875) (-3598.602) [-3593.186] * (-3598.766) (-3606.960) [-3591.512] (-3591.268) -- 0:02:18 736500 -- (-3599.880) (-3589.482) (-3598.702) [-3590.317] * [-3591.447] (-3596.626) (-3590.069) (-3596.653) -- 0:02:18 737000 -- (-3602.837) (-3596.026) [-3596.142] (-3590.671) * [-3588.270] (-3593.501) (-3598.296) (-3599.459) -- 0:02:17 737500 -- (-3598.237) [-3591.165] (-3590.339) (-3591.947) * (-3590.423) [-3587.755] (-3602.618) (-3596.990) -- 0:02:17 738000 -- [-3591.947] (-3596.555) (-3596.895) (-3602.628) * [-3589.463] (-3593.173) (-3597.817) (-3599.722) -- 0:02:17 738500 -- (-3594.418) [-3587.848] (-3602.285) (-3597.152) * (-3587.225) (-3604.527) (-3612.529) [-3593.491] -- 0:02:17 739000 -- (-3595.580) (-3605.901) (-3597.774) [-3597.469] * (-3597.850) (-3601.043) [-3603.789] (-3603.597) -- 0:02:17 739500 -- (-3596.593) (-3607.085) [-3592.576] (-3591.551) * (-3598.516) (-3601.078) (-3602.018) [-3592.521] -- 0:02:16 740000 -- (-3591.621) (-3603.157) [-3590.479] (-3596.070) * (-3597.397) (-3609.882) (-3597.918) [-3586.826] -- 0:02:16 Average standard deviation of split frequencies: 0.003055 740500 -- (-3599.967) [-3597.001] (-3592.854) (-3590.531) * (-3612.079) [-3599.689] (-3598.159) (-3589.936) -- 0:02:15 741000 -- [-3591.977] (-3595.067) (-3598.189) (-3593.493) * (-3592.962) [-3595.037] (-3598.725) (-3601.214) -- 0:02:15 741500 -- [-3598.876] (-3593.964) (-3591.407) (-3592.951) * (-3603.535) (-3593.538) [-3590.239] (-3604.431) -- 0:02:15 742000 -- (-3601.006) (-3595.747) (-3601.288) [-3593.120] * (-3597.427) [-3593.938] (-3589.579) (-3595.558) -- 0:02:15 742500 -- (-3600.608) (-3599.566) (-3607.061) [-3594.473] * (-3591.800) (-3595.448) [-3595.397] (-3600.667) -- 0:02:14 743000 -- [-3595.621] (-3603.934) (-3601.645) (-3595.689) * (-3599.069) (-3593.523) (-3587.278) [-3599.183] -- 0:02:14 743500 -- (-3606.432) (-3594.773) (-3600.053) [-3598.592] * [-3590.691] (-3590.974) (-3594.309) (-3606.404) -- 0:02:14 744000 -- (-3598.384) (-3593.471) [-3589.206] (-3604.896) * (-3600.638) (-3595.032) [-3599.299] (-3592.883) -- 0:02:14 744500 -- [-3593.058] (-3596.691) (-3586.451) (-3588.466) * (-3603.872) (-3596.198) (-3598.571) [-3587.195] -- 0:02:13 745000 -- (-3592.742) (-3593.562) (-3600.737) [-3592.204] * [-3592.748] (-3599.914) (-3596.454) (-3600.590) -- 0:02:13 Average standard deviation of split frequencies: 0.003476 745500 -- [-3588.491] (-3599.102) (-3593.203) (-3593.559) * (-3598.523) (-3596.511) (-3595.026) [-3596.268] -- 0:02:13 746000 -- (-3591.413) (-3594.685) [-3586.692] (-3599.144) * [-3587.788] (-3594.866) (-3600.229) (-3591.257) -- 0:02:13 746500 -- (-3595.974) [-3590.596] (-3600.343) (-3595.140) * (-3589.836) [-3589.748] (-3604.348) (-3599.593) -- 0:02:12 747000 -- (-3593.213) (-3594.238) [-3598.833] (-3595.412) * (-3598.607) (-3594.708) (-3594.199) [-3595.287] -- 0:02:12 747500 -- [-3592.635] (-3594.415) (-3593.483) (-3603.051) * (-3601.649) (-3597.898) (-3596.967) [-3593.282] -- 0:02:12 748000 -- (-3592.922) [-3593.509] (-3592.986) (-3607.958) * (-3604.904) (-3590.213) (-3599.495) [-3590.211] -- 0:02:12 748500 -- [-3596.844] (-3604.993) (-3593.001) (-3601.884) * (-3598.011) (-3599.659) (-3615.698) [-3590.472] -- 0:02:11 749000 -- (-3599.863) (-3601.872) [-3587.541] (-3594.183) * (-3602.430) (-3596.776) (-3599.625) [-3595.822] -- 0:02:11 749500 -- (-3595.410) [-3586.390] (-3590.921) (-3597.217) * [-3599.314] (-3594.748) (-3600.992) (-3592.910) -- 0:02:11 750000 -- (-3597.706) (-3594.199) [-3590.364] (-3605.676) * (-3598.535) (-3594.162) (-3605.192) [-3592.235] -- 0:02:11 Average standard deviation of split frequencies: 0.003768 750500 -- (-3592.657) [-3586.208] (-3596.278) (-3607.161) * [-3598.069] (-3584.717) (-3606.774) (-3597.072) -- 0:02:10 751000 -- (-3594.383) (-3601.892) (-3597.157) [-3591.737] * (-3601.786) [-3589.284] (-3602.134) (-3610.390) -- 0:02:10 751500 -- (-3596.590) (-3602.207) [-3595.527] (-3597.242) * (-3597.385) [-3590.934] (-3599.422) (-3601.401) -- 0:02:10 752000 -- [-3589.527] (-3594.667) (-3597.810) (-3604.215) * (-3597.136) (-3592.207) (-3591.617) [-3591.642] -- 0:02:09 752500 -- (-3600.537) (-3608.571) [-3597.415] (-3589.830) * (-3595.332) (-3597.054) (-3598.328) [-3592.121] -- 0:02:09 753000 -- (-3589.803) (-3598.802) [-3593.474] (-3597.417) * [-3593.427] (-3586.291) (-3591.174) (-3594.353) -- 0:02:09 753500 -- (-3594.424) (-3598.039) (-3591.594) [-3597.563] * (-3596.993) [-3590.204] (-3599.385) (-3594.209) -- 0:02:09 754000 -- (-3595.151) [-3592.078] (-3607.271) (-3591.807) * (-3596.691) (-3601.509) [-3597.568] (-3592.551) -- 0:02:08 754500 -- (-3603.615) (-3594.865) [-3595.327] (-3594.509) * (-3603.116) (-3598.031) (-3606.956) [-3599.696] -- 0:02:08 755000 -- (-3591.062) (-3602.712) [-3594.621] (-3602.809) * (-3603.700) [-3587.930] (-3603.209) (-3599.184) -- 0:02:08 Average standard deviation of split frequencies: 0.003242 755500 -- (-3603.911) (-3601.960) (-3597.163) [-3593.077] * [-3597.623] (-3597.318) (-3596.472) (-3592.700) -- 0:02:08 756000 -- (-3593.399) (-3593.458) (-3604.272) [-3592.205] * (-3593.421) [-3594.423] (-3593.855) (-3595.846) -- 0:02:07 756500 -- [-3590.720] (-3592.086) (-3594.269) (-3588.165) * (-3591.187) (-3598.412) [-3597.184] (-3594.273) -- 0:02:07 757000 -- (-3592.664) (-3592.788) [-3590.140] (-3601.812) * (-3600.293) (-3601.614) [-3597.526] (-3592.029) -- 0:02:07 757500 -- [-3595.406] (-3597.076) (-3593.807) (-3594.414) * (-3594.904) [-3597.024] (-3593.430) (-3602.704) -- 0:02:07 758000 -- (-3596.985) [-3588.642] (-3591.137) (-3591.193) * (-3593.549) [-3597.321] (-3600.810) (-3610.237) -- 0:02:06 758500 -- [-3590.825] (-3588.553) (-3591.399) (-3600.931) * (-3594.307) [-3591.805] (-3594.549) (-3594.602) -- 0:02:06 759000 -- (-3606.986) (-3594.381) [-3595.971] (-3604.588) * (-3591.584) [-3599.943] (-3604.735) (-3592.914) -- 0:02:06 759500 -- (-3599.288) [-3595.080] (-3593.349) (-3594.836) * (-3589.577) (-3604.193) [-3596.296] (-3593.710) -- 0:02:06 760000 -- (-3609.108) [-3595.788] (-3587.911) (-3600.341) * (-3602.056) [-3588.632] (-3590.821) (-3589.486) -- 0:02:05 Average standard deviation of split frequencies: 0.003780 760500 -- [-3595.248] (-3592.438) (-3591.902) (-3606.343) * (-3597.726) (-3597.757) [-3588.406] (-3599.198) -- 0:02:05 761000 -- (-3599.188) [-3599.732] (-3588.859) (-3593.014) * (-3597.872) [-3597.520] (-3601.126) (-3594.555) -- 0:02:05 761500 -- (-3606.713) (-3599.697) (-3590.420) [-3594.501] * (-3599.255) (-3601.483) (-3604.194) [-3598.838] -- 0:02:04 762000 -- [-3601.074] (-3605.322) (-3601.938) (-3591.814) * (-3606.187) [-3590.437] (-3602.546) (-3606.798) -- 0:02:04 762500 -- [-3594.095] (-3605.777) (-3599.422) (-3598.671) * (-3592.654) [-3592.067] (-3595.502) (-3612.010) -- 0:02:04 763000 -- (-3591.806) (-3591.850) [-3597.718] (-3593.971) * (-3595.295) (-3595.429) (-3599.251) [-3597.984] -- 0:02:04 763500 -- (-3591.985) (-3592.202) [-3600.307] (-3613.763) * (-3593.772) [-3606.758] (-3602.150) (-3594.831) -- 0:02:03 764000 -- (-3594.536) [-3602.235] (-3591.258) (-3596.042) * [-3589.893] (-3606.067) (-3598.356) (-3603.425) -- 0:02:03 764500 -- (-3598.957) [-3595.814] (-3591.965) (-3591.514) * (-3592.083) [-3591.713] (-3594.670) (-3596.852) -- 0:02:03 765000 -- (-3599.670) (-3595.672) (-3597.777) [-3590.734] * [-3598.788] (-3591.132) (-3605.080) (-3590.895) -- 0:02:03 Average standard deviation of split frequencies: 0.003323 765500 -- (-3598.438) [-3597.305] (-3603.324) (-3599.113) * (-3598.600) (-3594.854) [-3599.609] (-3594.034) -- 0:02:02 766000 -- (-3598.795) [-3593.834] (-3609.311) (-3598.061) * (-3589.805) (-3592.842) [-3591.031] (-3598.330) -- 0:02:02 766500 -- (-3597.147) (-3595.662) (-3596.928) [-3597.372] * [-3599.252] (-3595.185) (-3598.055) (-3605.858) -- 0:02:02 767000 -- (-3591.100) (-3598.142) (-3594.265) [-3594.143] * (-3590.551) (-3595.273) [-3593.924] (-3594.884) -- 0:02:02 767500 -- (-3601.705) (-3605.591) (-3588.392) [-3590.793] * (-3591.996) (-3587.352) [-3596.430] (-3604.212) -- 0:02:01 768000 -- (-3592.032) [-3593.691] (-3602.007) (-3598.328) * [-3595.553] (-3591.922) (-3590.019) (-3604.917) -- 0:02:01 768500 -- (-3604.141) (-3597.222) (-3596.747) [-3596.950] * [-3601.362] (-3595.322) (-3595.992) (-3597.231) -- 0:02:01 769000 -- (-3597.117) [-3586.279] (-3594.011) (-3595.326) * (-3599.796) (-3594.256) [-3597.470] (-3587.428) -- 0:02:01 769500 -- (-3596.855) (-3593.305) [-3585.562] (-3603.286) * (-3604.564) [-3597.755] (-3601.449) (-3594.952) -- 0:02:01 770000 -- (-3594.815) (-3604.782) [-3589.880] (-3604.272) * (-3609.882) [-3597.483] (-3596.216) (-3591.609) -- 0:02:00 Average standard deviation of split frequencies: 0.002997 770500 -- (-3592.998) [-3592.663] (-3595.023) (-3609.552) * (-3594.572) (-3600.135) (-3594.121) [-3593.796] -- 0:02:00 771000 -- (-3602.757) [-3598.598] (-3605.941) (-3603.863) * (-3595.713) (-3597.863) [-3593.421] (-3595.759) -- 0:01:59 771500 -- (-3600.363) (-3598.053) (-3589.305) [-3596.097] * (-3594.857) [-3599.606] (-3589.082) (-3593.215) -- 0:01:59 772000 -- [-3599.320] (-3599.016) (-3600.046) (-3592.899) * (-3592.995) (-3592.020) (-3600.518) [-3592.420] -- 0:01:59 772500 -- (-3587.073) (-3593.446) (-3608.313) [-3598.795] * (-3592.409) [-3594.850] (-3596.024) (-3596.214) -- 0:01:59 773000 -- [-3586.448] (-3592.240) (-3593.276) (-3592.721) * (-3599.269) (-3600.328) (-3593.362) [-3594.431] -- 0:01:58 773500 -- (-3594.021) (-3607.102) (-3588.418) [-3587.812] * (-3604.747) (-3607.221) (-3597.686) [-3593.910] -- 0:01:58 774000 -- [-3597.423] (-3598.109) (-3609.589) (-3592.230) * (-3593.398) (-3608.372) (-3593.936) [-3600.387] -- 0:01:58 774500 -- (-3594.796) (-3595.935) [-3591.162] (-3600.909) * (-3608.730) (-3616.353) (-3598.301) [-3586.776] -- 0:01:58 775000 -- (-3596.425) (-3597.849) (-3599.970) [-3600.483] * (-3592.321) (-3599.880) (-3602.868) [-3592.353] -- 0:01:57 Average standard deviation of split frequencies: 0.003159 775500 -- [-3593.816] (-3596.112) (-3599.915) (-3594.449) * (-3589.313) [-3600.702] (-3606.212) (-3592.003) -- 0:01:57 776000 -- (-3601.053) [-3590.436] (-3597.076) (-3611.632) * [-3603.358] (-3607.441) (-3594.770) (-3594.540) -- 0:01:57 776500 -- (-3596.255) (-3597.025) [-3587.549] (-3599.345) * [-3588.280] (-3593.316) (-3598.697) (-3600.932) -- 0:01:57 777000 -- (-3606.426) (-3603.637) [-3595.400] (-3608.823) * (-3591.111) (-3591.656) (-3590.281) [-3593.747] -- 0:01:56 777500 -- (-3595.403) (-3588.267) [-3591.454] (-3589.946) * [-3592.164] (-3597.701) (-3595.686) (-3594.051) -- 0:01:56 778000 -- (-3595.005) (-3597.456) [-3593.713] (-3599.528) * (-3606.733) (-3605.733) (-3591.626) [-3596.232] -- 0:01:56 778500 -- (-3598.597) (-3592.285) (-3613.323) [-3597.265] * (-3593.839) (-3599.306) (-3597.659) [-3597.365] -- 0:01:56 779000 -- (-3599.513) (-3599.844) [-3601.325] (-3592.027) * (-3603.826) (-3600.467) [-3594.730] (-3593.674) -- 0:01:56 779500 -- [-3587.714] (-3597.990) (-3597.617) (-3593.420) * (-3599.980) [-3599.831] (-3594.019) (-3604.854) -- 0:01:55 780000 -- (-3592.490) (-3596.596) (-3601.555) [-3588.871] * (-3591.704) (-3604.646) [-3586.963] (-3592.106) -- 0:01:55 Average standard deviation of split frequencies: 0.003804 780500 -- (-3593.743) [-3594.867] (-3595.657) (-3598.967) * (-3605.187) [-3601.191] (-3598.501) (-3599.991) -- 0:01:55 781000 -- (-3587.397) (-3588.384) (-3602.908) [-3597.573] * (-3599.177) (-3596.669) [-3596.548] (-3594.642) -- 0:01:54 781500 -- (-3592.676) (-3597.193) (-3600.484) [-3594.534] * (-3593.999) (-3593.952) [-3591.968] (-3593.356) -- 0:01:54 782000 -- (-3588.983) [-3593.461] (-3595.098) (-3595.196) * [-3593.435] (-3598.503) (-3603.681) (-3585.941) -- 0:01:54 782500 -- (-3591.264) (-3609.603) (-3606.498) [-3591.773] * (-3589.671) (-3601.060) [-3589.451] (-3591.055) -- 0:01:53 783000 -- (-3597.401) (-3599.267) [-3596.960] (-3594.436) * (-3600.095) (-3594.031) (-3595.148) [-3595.422] -- 0:01:53 783500 -- (-3598.957) (-3588.563) [-3593.460] (-3589.638) * (-3592.817) (-3594.562) [-3594.883] (-3592.284) -- 0:01:53 784000 -- (-3596.385) (-3590.709) (-3591.767) [-3591.710] * [-3593.949] (-3593.530) (-3591.922) (-3594.774) -- 0:01:53 784500 -- (-3604.513) [-3590.500] (-3605.202) (-3595.914) * [-3597.266] (-3594.469) (-3605.792) (-3598.725) -- 0:01:52 785000 -- (-3598.426) (-3607.707) [-3595.497] (-3594.403) * (-3591.763) (-3600.173) [-3597.084] (-3592.756) -- 0:01:52 Average standard deviation of split frequencies: 0.003539 785500 -- [-3597.343] (-3594.478) (-3605.109) (-3595.197) * (-3596.140) (-3594.719) [-3595.237] (-3597.076) -- 0:01:52 786000 -- (-3590.787) (-3594.946) [-3605.372] (-3598.722) * (-3592.022) [-3595.630] (-3592.598) (-3596.959) -- 0:01:52 786500 -- (-3595.946) [-3602.547] (-3594.101) (-3595.223) * (-3598.546) [-3590.579] (-3592.339) (-3591.345) -- 0:01:51 787000 -- (-3594.867) (-3599.682) (-3593.996) [-3589.694] * (-3597.172) [-3598.015] (-3598.038) (-3593.040) -- 0:01:51 787500 -- (-3598.530) (-3598.773) (-3595.444) [-3591.022] * (-3599.619) (-3600.338) (-3596.784) [-3589.489] -- 0:01:51 788000 -- (-3601.306) (-3600.796) (-3602.904) [-3594.835] * [-3589.790] (-3592.635) (-3601.410) (-3600.128) -- 0:01:51 788500 -- [-3593.941] (-3590.302) (-3599.840) (-3597.071) * (-3599.910) (-3590.938) (-3596.401) [-3594.995] -- 0:01:51 789000 -- (-3607.337) (-3607.286) [-3593.342] (-3594.219) * (-3602.071) [-3589.424] (-3606.128) (-3596.851) -- 0:01:50 789500 -- (-3589.093) (-3594.438) (-3593.193) [-3598.028] * (-3599.785) [-3591.135] (-3595.173) (-3595.616) -- 0:01:50 790000 -- (-3590.488) [-3599.634] (-3592.834) (-3596.316) * [-3600.247] (-3601.845) (-3594.781) (-3599.112) -- 0:01:50 Average standard deviation of split frequencies: 0.004949 790500 -- [-3590.334] (-3595.639) (-3596.103) (-3598.868) * (-3599.339) (-3601.116) [-3596.661] (-3605.015) -- 0:01:49 791000 -- [-3598.956] (-3599.006) (-3589.773) (-3593.279) * (-3593.519) (-3591.869) [-3591.017] (-3601.604) -- 0:01:49 791500 -- (-3596.494) (-3599.206) [-3588.985] (-3605.079) * (-3601.935) [-3588.665] (-3590.540) (-3603.270) -- 0:01:49 792000 -- (-3602.891) (-3599.479) (-3604.574) [-3600.453] * [-3595.622] (-3588.540) (-3602.105) (-3604.964) -- 0:01:48 792500 -- [-3599.805] (-3595.131) (-3600.326) (-3596.252) * [-3592.620] (-3595.577) (-3594.563) (-3600.051) -- 0:01:48 793000 -- (-3595.958) [-3590.271] (-3603.343) (-3600.847) * (-3596.771) (-3598.702) (-3603.942) [-3593.952] -- 0:01:48 793500 -- (-3595.950) (-3594.259) (-3601.010) [-3588.975] * (-3604.572) (-3603.060) [-3590.839] (-3597.103) -- 0:01:48 794000 -- (-3600.423) (-3602.488) (-3600.539) [-3601.204] * (-3594.316) (-3597.146) [-3589.382] (-3595.449) -- 0:01:47 794500 -- [-3593.078] (-3602.455) (-3594.670) (-3593.585) * [-3600.566] (-3599.988) (-3606.280) (-3593.000) -- 0:01:47 795000 -- [-3596.804] (-3603.410) (-3592.065) (-3596.468) * (-3596.398) (-3597.030) [-3596.886] (-3590.884) -- 0:01:47 Average standard deviation of split frequencies: 0.003849 795500 -- [-3592.208] (-3594.663) (-3596.817) (-3596.266) * (-3603.031) (-3592.931) (-3598.938) [-3590.881] -- 0:01:47 796000 -- (-3593.845) (-3591.274) (-3600.286) [-3594.884] * (-3598.437) (-3592.977) (-3599.084) [-3595.737] -- 0:01:46 796500 -- (-3593.442) (-3593.202) (-3595.620) [-3592.636] * (-3592.744) (-3593.436) (-3597.062) [-3594.023] -- 0:01:46 797000 -- [-3593.442] (-3597.138) (-3597.743) (-3595.449) * [-3597.577] (-3590.973) (-3595.736) (-3597.639) -- 0:01:46 797500 -- [-3592.985] (-3596.648) (-3588.693) (-3600.185) * (-3601.378) (-3604.920) [-3592.163] (-3592.658) -- 0:01:46 798000 -- [-3595.344] (-3594.012) (-3599.560) (-3592.030) * [-3593.861] (-3595.328) (-3598.128) (-3598.675) -- 0:01:45 798500 -- [-3599.299] (-3593.370) (-3606.187) (-3589.255) * [-3588.386] (-3592.788) (-3591.684) (-3601.814) -- 0:01:45 799000 -- (-3599.456) (-3603.176) (-3595.953) [-3587.810] * (-3596.213) [-3586.646] (-3595.308) (-3597.200) -- 0:01:45 799500 -- (-3600.165) (-3595.591) [-3597.459] (-3592.210) * (-3590.769) (-3599.665) [-3590.201] (-3596.242) -- 0:01:45 800000 -- (-3598.094) (-3594.476) [-3596.218] (-3597.862) * (-3593.682) [-3595.602] (-3590.613) (-3598.477) -- 0:01:45 Average standard deviation of split frequencies: 0.003945 800500 -- [-3591.353] (-3602.494) (-3595.391) (-3604.104) * (-3595.182) [-3592.865] (-3595.822) (-3597.203) -- 0:01:44 801000 -- [-3596.821] (-3599.271) (-3589.469) (-3606.512) * [-3587.448] (-3601.202) (-3593.121) (-3599.854) -- 0:01:44 801500 -- (-3596.782) (-3602.709) [-3601.310] (-3611.808) * (-3590.750) [-3594.118] (-3599.184) (-3589.616) -- 0:01:44 802000 -- (-3598.659) [-3599.674] (-3602.476) (-3599.600) * [-3597.758] (-3592.968) (-3603.287) (-3593.826) -- 0:01:43 802500 -- [-3592.758] (-3605.372) (-3595.377) (-3596.103) * (-3593.891) (-3595.515) (-3605.382) [-3587.909] -- 0:01:43 803000 -- [-3598.574] (-3601.295) (-3589.705) (-3596.624) * (-3603.140) (-3594.236) [-3591.072] (-3590.350) -- 0:01:43 803500 -- (-3594.070) (-3596.810) [-3597.583] (-3602.740) * (-3592.729) (-3597.852) (-3603.458) [-3592.728] -- 0:01:42 804000 -- [-3589.980] (-3592.966) (-3618.169) (-3590.251) * (-3591.699) (-3603.192) [-3595.938] (-3592.812) -- 0:01:42 804500 -- (-3592.835) [-3596.247] (-3606.382) (-3595.956) * [-3596.421] (-3605.007) (-3596.716) (-3599.718) -- 0:01:42 805000 -- [-3593.973] (-3602.464) (-3591.310) (-3598.437) * (-3605.112) (-3599.459) (-3606.582) [-3597.304] -- 0:01:42 Average standard deviation of split frequencies: 0.004036 805500 -- (-3595.140) (-3611.676) (-3589.204) [-3596.296] * (-3592.531) (-3599.284) [-3601.537] (-3597.518) -- 0:01:41 806000 -- (-3609.597) (-3597.895) [-3591.797] (-3593.809) * (-3600.775) [-3591.007] (-3608.847) (-3611.176) -- 0:01:41 806500 -- (-3595.758) (-3596.733) (-3597.438) [-3590.744] * (-3596.616) (-3594.884) [-3592.480] (-3598.809) -- 0:01:41 807000 -- (-3605.356) [-3593.233] (-3598.592) (-3594.956) * (-3593.076) [-3595.731] (-3597.458) (-3597.219) -- 0:01:41 807500 -- [-3598.193] (-3598.284) (-3604.770) (-3595.730) * (-3592.921) [-3599.887] (-3589.471) (-3598.942) -- 0:01:40 808000 -- (-3589.508) (-3590.013) (-3597.712) [-3599.954] * (-3591.836) [-3599.259] (-3596.801) (-3589.530) -- 0:01:40 808500 -- (-3602.300) [-3593.147] (-3589.104) (-3596.528) * (-3594.327) (-3607.107) [-3594.730] (-3602.804) -- 0:01:40 809000 -- [-3597.576] (-3605.257) (-3587.497) (-3594.227) * (-3594.486) (-3597.906) [-3596.516] (-3591.280) -- 0:01:40 809500 -- [-3592.052] (-3601.297) (-3601.019) (-3593.708) * (-3594.862) (-3610.308) [-3597.846] (-3592.726) -- 0:01:39 810000 -- [-3592.104] (-3589.661) (-3594.655) (-3600.511) * (-3606.409) [-3597.650] (-3595.266) (-3585.054) -- 0:01:39 Average standard deviation of split frequencies: 0.004361 810500 -- [-3596.150] (-3605.143) (-3599.134) (-3599.953) * [-3591.604] (-3599.951) (-3594.064) (-3594.494) -- 0:01:39 811000 -- (-3594.720) [-3590.155] (-3595.042) (-3594.295) * (-3596.155) (-3603.180) (-3596.371) [-3594.191] -- 0:01:39 811500 -- (-3598.608) [-3589.714] (-3597.597) (-3593.502) * (-3593.582) (-3598.660) (-3591.570) [-3594.104] -- 0:01:38 812000 -- (-3597.513) (-3601.482) [-3598.103] (-3595.113) * (-3598.064) (-3606.025) [-3589.909] (-3594.529) -- 0:01:38 812500 -- (-3595.831) (-3602.166) (-3603.018) [-3599.087] * (-3601.950) [-3592.264] (-3605.064) (-3594.842) -- 0:01:38 813000 -- (-3605.717) (-3596.444) [-3592.319] (-3619.170) * [-3594.983] (-3599.341) (-3597.047) (-3589.243) -- 0:01:37 813500 -- [-3603.210] (-3599.185) (-3595.895) (-3596.438) * [-3597.553] (-3593.378) (-3597.602) (-3603.029) -- 0:01:37 814000 -- (-3596.499) (-3609.585) (-3603.665) [-3600.390] * (-3595.612) [-3589.083] (-3597.237) (-3597.678) -- 0:01:37 814500 -- (-3596.648) (-3600.040) (-3599.483) [-3602.726] * (-3599.503) [-3594.181] (-3592.255) (-3603.851) -- 0:01:37 815000 -- (-3596.580) [-3597.358] (-3603.856) (-3606.828) * (-3604.192) (-3592.933) [-3594.709] (-3590.773) -- 0:01:36 Average standard deviation of split frequencies: 0.004275 815500 -- (-3597.175) [-3597.436] (-3593.647) (-3605.878) * (-3595.614) (-3594.862) [-3597.428] (-3599.680) -- 0:01:36 816000 -- (-3590.750) [-3599.739] (-3593.020) (-3595.062) * (-3587.570) (-3595.370) (-3596.480) [-3587.829] -- 0:01:36 816500 -- (-3612.272) (-3591.798) [-3587.874] (-3600.054) * (-3608.128) (-3594.108) (-3597.733) [-3595.427] -- 0:01:36 817000 -- (-3597.898) (-3588.292) (-3593.991) [-3599.490] * [-3591.475] (-3598.665) (-3602.145) (-3601.208) -- 0:01:35 817500 -- (-3598.351) (-3593.751) [-3601.211] (-3600.238) * (-3594.053) (-3601.289) (-3599.487) [-3595.174] -- 0:01:35 818000 -- (-3608.278) (-3608.273) (-3597.695) [-3600.816] * (-3600.174) (-3594.757) (-3594.079) [-3593.518] -- 0:01:35 818500 -- (-3593.648) [-3590.725] (-3587.420) (-3603.385) * (-3602.140) (-3598.925) (-3599.491) [-3588.802] -- 0:01:35 819000 -- (-3592.898) (-3601.894) [-3591.768] (-3601.082) * (-3592.663) (-3590.397) (-3608.230) [-3592.312] -- 0:01:34 819500 -- (-3592.700) (-3594.629) [-3591.833] (-3598.216) * (-3594.212) (-3599.461) [-3589.384] (-3596.134) -- 0:01:34 820000 -- (-3596.612) (-3594.000) [-3595.084] (-3597.100) * (-3594.034) (-3590.624) [-3593.281] (-3594.066) -- 0:01:34 Average standard deviation of split frequencies: 0.004078 820500 -- (-3597.822) (-3599.197) [-3589.614] (-3593.165) * (-3601.857) (-3605.870) [-3597.686] (-3597.035) -- 0:01:34 821000 -- (-3595.769) (-3601.544) [-3584.441] (-3615.271) * (-3607.936) [-3593.715] (-3591.962) (-3593.193) -- 0:01:33 821500 -- [-3591.554] (-3597.676) (-3601.132) (-3596.149) * (-3600.100) [-3594.650] (-3595.925) (-3594.200) -- 0:01:33 822000 -- [-3593.840] (-3593.585) (-3595.567) (-3602.018) * (-3601.270) [-3596.092] (-3595.563) (-3595.556) -- 0:01:33 822500 -- (-3600.946) (-3592.053) (-3599.238) [-3591.028] * (-3598.596) (-3606.943) [-3588.627] (-3593.042) -- 0:01:33 823000 -- (-3600.673) (-3590.445) [-3599.564] (-3605.001) * (-3611.509) (-3594.429) (-3600.178) [-3598.048] -- 0:01:32 823500 -- [-3594.905] (-3604.560) (-3599.497) (-3602.664) * (-3594.040) (-3595.779) [-3587.935] (-3603.661) -- 0:01:32 824000 -- (-3605.694) (-3597.596) (-3595.319) [-3593.854] * [-3590.406] (-3602.123) (-3596.996) (-3608.467) -- 0:01:32 824500 -- (-3607.741) [-3596.834] (-3590.127) (-3598.084) * (-3600.572) (-3599.648) [-3592.026] (-3608.685) -- 0:01:31 825000 -- (-3593.723) (-3600.680) [-3596.656] (-3594.653) * (-3596.261) (-3599.354) [-3592.791] (-3596.180) -- 0:01:31 Average standard deviation of split frequencies: 0.004680 825500 -- (-3589.977) (-3596.224) (-3608.967) [-3591.935] * (-3599.270) (-3590.987) [-3588.473] (-3592.968) -- 0:01:31 826000 -- (-3593.900) (-3596.854) (-3598.359) [-3591.759] * (-3600.817) [-3596.950] (-3597.309) (-3601.569) -- 0:01:31 826500 -- (-3596.798) (-3590.345) [-3599.690] (-3601.750) * (-3591.884) [-3596.381] (-3611.618) (-3612.243) -- 0:01:30 827000 -- (-3594.894) (-3592.322) (-3590.516) [-3600.445] * [-3593.764] (-3589.433) (-3603.497) (-3599.686) -- 0:01:30 827500 -- [-3598.617] (-3596.153) (-3590.919) (-3594.569) * (-3600.805) (-3597.306) [-3598.156] (-3601.528) -- 0:01:30 828000 -- [-3588.679] (-3596.798) (-3591.778) (-3605.540) * (-3600.164) (-3592.186) (-3594.744) [-3591.601] -- 0:01:30 828500 -- [-3592.066] (-3592.118) (-3588.958) (-3597.833) * (-3598.304) (-3597.667) [-3595.695] (-3596.963) -- 0:01:29 829000 -- (-3601.204) (-3602.132) (-3586.856) [-3588.740] * (-3597.621) [-3599.902] (-3589.811) (-3596.500) -- 0:01:29 829500 -- (-3594.548) [-3603.636] (-3608.058) (-3591.128) * (-3602.219) [-3592.013] (-3600.337) (-3605.120) -- 0:01:29 830000 -- (-3598.300) (-3603.289) (-3596.407) [-3593.944] * (-3590.371) [-3603.475] (-3595.062) (-3592.719) -- 0:01:29 Average standard deviation of split frequencies: 0.004994 830500 -- (-3586.553) (-3598.188) (-3599.990) [-3591.141] * [-3588.415] (-3591.777) (-3594.974) (-3592.195) -- 0:01:28 831000 -- (-3592.024) [-3591.561] (-3603.888) (-3596.095) * (-3587.287) (-3605.345) (-3589.575) [-3592.391] -- 0:01:28 831500 -- (-3600.788) (-3595.154) [-3595.941] (-3603.355) * (-3596.954) [-3594.135] (-3610.685) (-3595.898) -- 0:01:28 832000 -- (-3591.271) (-3591.845) (-3592.263) [-3588.752] * (-3602.543) (-3594.429) (-3594.093) [-3595.140] -- 0:01:28 832500 -- (-3593.136) (-3591.527) (-3602.379) [-3590.497] * [-3595.938] (-3602.481) (-3598.305) (-3604.705) -- 0:01:27 833000 -- (-3601.406) [-3599.691] (-3603.452) (-3606.576) * (-3598.198) (-3606.950) [-3593.140] (-3596.482) -- 0:01:27 833500 -- (-3594.611) [-3593.333] (-3596.924) (-3594.399) * (-3595.167) (-3587.073) [-3599.379] (-3598.501) -- 0:01:27 834000 -- [-3596.587] (-3592.126) (-3591.423) (-3595.323) * (-3596.188) (-3598.270) [-3593.490] (-3591.983) -- 0:01:26 834500 -- [-3594.006] (-3591.150) (-3605.988) (-3593.651) * (-3593.098) (-3595.086) (-3590.766) [-3591.247] -- 0:01:26 835000 -- (-3594.658) (-3602.053) [-3599.762] (-3593.271) * (-3602.774) [-3589.733] (-3599.532) (-3598.998) -- 0:01:26 Average standard deviation of split frequencies: 0.004962 835500 -- (-3590.228) (-3590.823) [-3598.521] (-3590.902) * (-3593.952) (-3596.651) [-3593.115] (-3600.762) -- 0:01:26 836000 -- (-3608.456) (-3588.786) (-3598.865) [-3595.175] * (-3589.920) (-3610.088) (-3598.625) [-3595.059] -- 0:01:25 836500 -- (-3593.513) (-3598.786) (-3603.776) [-3586.567] * (-3591.995) (-3592.758) (-3600.348) [-3590.119] -- 0:01:25 837000 -- (-3595.291) [-3587.367] (-3590.972) (-3593.540) * (-3587.303) [-3589.145] (-3598.610) (-3600.523) -- 0:01:25 837500 -- (-3592.497) (-3604.966) [-3594.693] (-3591.371) * (-3590.238) (-3598.459) [-3597.508] (-3593.514) -- 0:01:25 838000 -- (-3600.187) [-3590.229] (-3606.303) (-3599.782) * (-3599.639) (-3590.487) (-3601.367) [-3593.329] -- 0:01:24 838500 -- (-3602.146) (-3595.410) (-3602.606) [-3594.024] * [-3599.615] (-3594.684) (-3601.495) (-3598.372) -- 0:01:24 839000 -- (-3593.093) [-3588.235] (-3605.888) (-3593.008) * (-3598.699) (-3598.881) (-3596.304) [-3599.960] -- 0:01:24 839500 -- [-3589.592] (-3610.124) (-3606.173) (-3597.690) * (-3597.414) (-3591.328) (-3595.044) [-3602.339] -- 0:01:24 840000 -- [-3594.353] (-3595.138) (-3601.201) (-3601.886) * (-3596.929) (-3591.673) [-3604.168] (-3597.513) -- 0:01:23 Average standard deviation of split frequencies: 0.005103 840500 -- (-3595.844) (-3597.392) (-3602.488) [-3598.912] * [-3589.257] (-3597.826) (-3596.830) (-3589.811) -- 0:01:23 841000 -- (-3600.306) [-3594.514] (-3595.896) (-3599.311) * (-3590.582) (-3600.035) (-3600.421) [-3591.288] -- 0:01:23 841500 -- (-3601.320) [-3592.932] (-3594.151) (-3588.857) * [-3602.629] (-3606.656) (-3589.006) (-3597.436) -- 0:01:23 842000 -- [-3594.023] (-3592.814) (-3602.067) (-3592.242) * [-3597.020] (-3597.168) (-3602.356) (-3602.164) -- 0:01:22 842500 -- (-3595.492) (-3596.857) (-3603.110) [-3593.275] * [-3592.961] (-3595.674) (-3595.340) (-3601.911) -- 0:01:22 843000 -- (-3603.327) (-3595.303) (-3604.347) [-3591.012] * (-3593.526) (-3603.852) [-3594.556] (-3596.036) -- 0:01:22 843500 -- (-3594.562) (-3594.895) (-3602.335) [-3589.736] * (-3591.476) (-3587.094) [-3600.240] (-3588.301) -- 0:01:22 844000 -- (-3596.271) [-3598.644] (-3598.912) (-3592.989) * (-3603.045) (-3588.685) [-3600.826] (-3589.760) -- 0:01:21 844500 -- [-3593.645] (-3600.687) (-3599.200) (-3597.611) * (-3598.541) [-3590.212] (-3592.499) (-3599.002) -- 0:01:21 845000 -- (-3594.047) [-3589.359] (-3598.391) (-3595.528) * (-3591.634) (-3594.171) [-3587.497] (-3595.274) -- 0:01:21 Average standard deviation of split frequencies: 0.005572 845500 -- [-3591.600] (-3602.457) (-3600.960) (-3593.083) * [-3597.526] (-3592.274) (-3589.944) (-3600.474) -- 0:01:20 846000 -- (-3595.754) [-3595.351] (-3591.323) (-3593.088) * [-3596.038] (-3596.526) (-3587.152) (-3595.584) -- 0:01:20 846500 -- [-3588.325] (-3591.328) (-3592.471) (-3603.401) * (-3589.476) (-3592.036) (-3604.906) [-3589.807] -- 0:01:20 847000 -- (-3598.966) [-3594.064] (-3591.455) (-3600.087) * (-3593.966) (-3598.468) [-3592.355] (-3595.179) -- 0:01:20 847500 -- [-3594.777] (-3592.797) (-3594.865) (-3599.351) * (-3596.704) [-3598.533] (-3597.090) (-3589.543) -- 0:01:19 848000 -- (-3597.349) (-3595.084) (-3604.024) [-3591.687] * [-3589.679] (-3601.075) (-3593.164) (-3593.818) -- 0:01:19 848500 -- (-3600.761) (-3603.854) (-3600.205) [-3591.438] * (-3599.261) (-3594.956) [-3598.465] (-3599.410) -- 0:01:19 849000 -- [-3593.267] (-3598.099) (-3593.370) (-3598.464) * (-3599.735) [-3589.722] (-3595.522) (-3595.931) -- 0:01:19 849500 -- [-3592.831] (-3597.718) (-3587.707) (-3592.481) * (-3601.787) (-3600.271) [-3590.139] (-3593.063) -- 0:01:18 850000 -- (-3603.561) [-3599.458] (-3593.771) (-3590.129) * (-3598.729) (-3594.031) (-3587.165) [-3595.941] -- 0:01:18 Average standard deviation of split frequencies: 0.003879 850500 -- (-3598.435) (-3595.361) (-3597.637) [-3594.276] * (-3589.683) (-3604.601) [-3592.128] (-3598.719) -- 0:01:18 851000 -- (-3594.928) [-3590.352] (-3607.320) (-3595.812) * [-3592.263] (-3591.118) (-3600.613) (-3605.479) -- 0:01:18 851500 -- [-3590.994] (-3593.215) (-3597.035) (-3608.546) * (-3600.707) (-3597.045) (-3599.872) [-3588.536] -- 0:01:17 852000 -- (-3597.233) (-3603.350) [-3595.549] (-3597.612) * (-3593.141) (-3599.243) (-3594.978) [-3600.382] -- 0:01:17 852500 -- (-3593.973) (-3602.844) (-3601.138) [-3597.434] * (-3595.634) [-3594.853] (-3600.671) (-3598.217) -- 0:01:17 853000 -- [-3590.476] (-3592.854) (-3602.604) (-3597.271) * (-3600.623) [-3593.032] (-3599.748) (-3600.420) -- 0:01:17 853500 -- (-3591.778) (-3596.286) (-3593.388) [-3591.551] * (-3593.000) (-3607.070) [-3595.837] (-3602.506) -- 0:01:16 854000 -- [-3587.559] (-3607.145) (-3594.228) (-3591.242) * (-3591.624) (-3600.168) [-3593.770] (-3599.042) -- 0:01:16 854500 -- [-3589.175] (-3597.329) (-3600.613) (-3600.044) * (-3595.968) (-3596.299) (-3597.325) [-3591.254] -- 0:01:16 855000 -- (-3591.235) (-3605.618) [-3598.237] (-3594.682) * [-3589.518] (-3603.933) (-3601.566) (-3590.700) -- 0:01:15 Average standard deviation of split frequencies: 0.004406 855500 -- [-3596.780] (-3590.861) (-3593.548) (-3601.028) * (-3598.103) (-3614.883) [-3600.496] (-3590.607) -- 0:01:15 856000 -- (-3600.643) (-3596.293) (-3590.280) [-3596.642] * [-3595.215] (-3600.578) (-3591.223) (-3601.217) -- 0:01:15 856500 -- [-3589.873] (-3602.057) (-3591.494) (-3607.363) * (-3595.157) (-3599.871) [-3594.996] (-3596.026) -- 0:01:15 857000 -- (-3596.741) [-3595.446] (-3600.545) (-3603.370) * [-3597.071] (-3595.644) (-3591.318) (-3600.476) -- 0:01:14 857500 -- (-3598.156) [-3594.098] (-3592.291) (-3605.551) * (-3608.462) [-3591.365] (-3593.029) (-3600.966) -- 0:01:14 858000 -- (-3598.798) (-3595.007) [-3591.657] (-3605.369) * (-3602.976) (-3597.188) (-3588.298) [-3588.976] -- 0:01:14 858500 -- (-3601.916) (-3594.252) (-3604.379) [-3607.500] * [-3597.772] (-3601.165) (-3602.718) (-3595.322) -- 0:01:14 859000 -- [-3596.768] (-3591.525) (-3596.385) (-3604.988) * (-3591.293) [-3595.151] (-3589.291) (-3602.285) -- 0:01:13 859500 -- [-3590.840] (-3590.713) (-3591.871) (-3607.336) * (-3595.099) [-3590.201] (-3599.501) (-3605.952) -- 0:01:13 860000 -- (-3595.767) (-3602.401) (-3604.136) [-3605.190] * (-3593.341) (-3595.395) (-3596.834) [-3591.978] -- 0:01:13 Average standard deviation of split frequencies: 0.004437 860500 -- (-3591.085) [-3595.637] (-3594.096) (-3597.974) * (-3600.728) (-3600.313) (-3589.105) [-3603.791] -- 0:01:13 861000 -- (-3600.255) (-3595.460) (-3595.689) [-3593.843] * (-3597.465) (-3597.623) [-3593.549] (-3597.901) -- 0:01:12 861500 -- (-3594.969) [-3592.095] (-3600.630) (-3593.468) * (-3595.340) (-3598.139) (-3600.510) [-3599.668] -- 0:01:12 862000 -- [-3595.022] (-3592.065) (-3603.920) (-3596.948) * [-3596.524] (-3593.213) (-3606.403) (-3591.488) -- 0:01:12 862500 -- [-3592.225] (-3587.732) (-3600.686) (-3602.582) * (-3605.300) (-3597.662) (-3590.260) [-3590.515] -- 0:01:12 863000 -- (-3595.741) [-3596.638] (-3593.915) (-3593.503) * (-3605.406) [-3595.247] (-3594.521) (-3591.656) -- 0:01:11 863500 -- (-3592.999) (-3599.899) [-3597.549] (-3591.080) * (-3603.245) (-3596.244) [-3591.315] (-3609.243) -- 0:01:11 864000 -- [-3599.605] (-3588.104) (-3602.847) (-3600.241) * [-3592.475] (-3597.132) (-3594.882) (-3595.625) -- 0:01:11 864500 -- (-3597.057) (-3604.249) (-3598.332) [-3596.352] * (-3595.821) (-3598.085) [-3601.573] (-3597.331) -- 0:01:11 865000 -- (-3597.238) (-3591.482) (-3597.058) [-3591.337] * (-3587.105) (-3590.366) (-3602.177) [-3590.310] -- 0:01:10 Average standard deviation of split frequencies: 0.004681 865500 -- (-3599.665) (-3595.656) [-3594.687] (-3588.137) * (-3592.051) (-3588.652) (-3599.101) [-3593.028] -- 0:01:10 866000 -- (-3599.249) (-3598.999) [-3594.650] (-3598.672) * (-3596.016) (-3594.017) (-3596.661) [-3600.905] -- 0:01:10 866500 -- (-3600.760) (-3590.956) [-3596.655] (-3595.909) * [-3590.655] (-3592.652) (-3596.410) (-3598.603) -- 0:01:09 867000 -- (-3587.584) [-3586.516] (-3596.592) (-3597.594) * (-3595.879) [-3599.797] (-3607.985) (-3597.450) -- 0:01:09 867500 -- (-3594.526) [-3595.236] (-3596.560) (-3596.081) * (-3603.493) [-3588.938] (-3602.611) (-3595.863) -- 0:01:09 868000 -- (-3592.394) (-3596.921) [-3597.257] (-3595.565) * [-3597.422] (-3591.632) (-3593.945) (-3595.955) -- 0:01:09 868500 -- (-3592.527) (-3591.985) [-3591.928] (-3611.659) * (-3604.037) (-3599.363) (-3594.245) [-3593.958] -- 0:01:08 869000 -- (-3600.493) (-3593.899) (-3598.303) [-3596.279] * (-3592.787) [-3599.640] (-3603.775) (-3595.364) -- 0:01:08 869500 -- (-3590.379) (-3599.058) (-3596.856) [-3597.681] * [-3589.843] (-3598.900) (-3606.258) (-3603.787) -- 0:01:08 870000 -- (-3593.225) [-3592.854] (-3601.953) (-3589.806) * [-3589.979] (-3588.066) (-3593.901) (-3594.962) -- 0:01:08 Average standard deviation of split frequencies: 0.003790 870500 -- [-3586.904] (-3599.306) (-3596.646) (-3595.346) * (-3600.829) (-3591.816) (-3593.205) [-3595.130] -- 0:01:07 871000 -- (-3593.986) (-3600.854) (-3598.039) [-3588.322] * (-3593.122) (-3591.853) [-3587.561] (-3592.724) -- 0:01:07 871500 -- (-3592.112) [-3599.546] (-3623.353) (-3598.126) * [-3596.237] (-3593.475) (-3591.241) (-3605.860) -- 0:01:07 872000 -- [-3593.391] (-3597.400) (-3594.843) (-3604.089) * [-3593.690] (-3588.862) (-3590.183) (-3600.791) -- 0:01:07 872500 -- [-3593.682] (-3594.423) (-3599.591) (-3597.228) * [-3597.786] (-3600.945) (-3591.618) (-3609.257) -- 0:01:06 873000 -- [-3593.481] (-3590.216) (-3600.633) (-3597.686) * (-3595.812) (-3593.516) (-3602.026) [-3598.579] -- 0:01:06 873500 -- (-3604.385) (-3600.302) [-3592.005] (-3596.055) * (-3599.123) (-3598.839) [-3602.826] (-3596.594) -- 0:01:06 874000 -- (-3590.975) (-3590.934) (-3596.994) [-3586.756] * (-3598.680) [-3607.130] (-3599.565) (-3608.976) -- 0:01:06 874500 -- (-3599.251) (-3597.346) (-3596.849) [-3597.986] * (-3598.565) [-3597.091] (-3587.334) (-3593.145) -- 0:01:05 875000 -- (-3600.654) [-3596.297] (-3590.543) (-3591.233) * (-3595.080) (-3599.482) [-3600.047] (-3605.980) -- 0:01:05 Average standard deviation of split frequencies: 0.003767 875500 -- [-3596.901] (-3598.101) (-3602.872) (-3596.096) * [-3591.066] (-3593.010) (-3593.510) (-3612.790) -- 0:01:05 876000 -- (-3600.573) [-3589.580] (-3596.713) (-3604.097) * (-3596.598) (-3600.621) (-3608.290) [-3597.529] -- 0:01:04 876500 -- (-3605.277) [-3596.738] (-3592.796) (-3590.562) * (-3593.165) (-3600.000) [-3589.096] (-3597.807) -- 0:01:04 877000 -- (-3587.968) (-3610.360) (-3593.870) [-3588.203] * (-3599.870) [-3598.743] (-3593.146) (-3597.354) -- 0:01:04 877500 -- [-3589.890] (-3599.022) (-3596.609) (-3598.751) * [-3594.682] (-3598.633) (-3595.535) (-3592.545) -- 0:01:04 878000 -- (-3598.867) (-3587.464) [-3590.817] (-3592.239) * (-3598.648) [-3594.880] (-3606.988) (-3601.542) -- 0:01:03 878500 -- (-3596.997) (-3596.125) [-3595.311] (-3589.574) * (-3597.566) [-3593.260] (-3599.463) (-3602.371) -- 0:01:03 879000 -- (-3599.766) [-3601.248] (-3597.704) (-3590.366) * (-3593.415) [-3596.770] (-3592.550) (-3593.522) -- 0:01:03 879500 -- (-3596.460) (-3599.287) (-3592.399) [-3599.410] * (-3603.128) (-3598.871) [-3594.288] (-3595.738) -- 0:01:03 880000 -- (-3598.737) [-3590.085] (-3590.687) (-3599.739) * (-3602.886) (-3593.198) [-3591.538] (-3597.281) -- 0:01:02 Average standard deviation of split frequencies: 0.003372 880500 -- (-3592.992) [-3593.898] (-3593.974) (-3592.908) * (-3592.338) (-3592.283) (-3597.210) [-3592.968] -- 0:01:02 881000 -- (-3595.784) (-3610.060) [-3598.831] (-3596.048) * (-3611.885) [-3598.368] (-3597.062) (-3597.296) -- 0:01:02 881500 -- (-3600.760) (-3610.441) (-3594.799) [-3593.480] * (-3604.168) (-3599.385) (-3603.126) [-3594.769] -- 0:01:02 882000 -- [-3592.386] (-3586.107) (-3599.203) (-3590.151) * (-3597.489) [-3607.847] (-3594.750) (-3594.617) -- 0:01:01 882500 -- (-3594.658) (-3593.795) [-3596.908] (-3606.987) * (-3604.531) (-3599.010) [-3589.814] (-3589.643) -- 0:01:01 883000 -- (-3589.443) (-3586.087) (-3591.332) [-3595.881] * (-3596.905) [-3591.290] (-3600.599) (-3599.767) -- 0:01:01 883500 -- (-3586.168) [-3590.845] (-3596.750) (-3606.506) * (-3609.809) [-3591.414] (-3608.016) (-3598.317) -- 0:01:01 884000 -- (-3601.889) (-3594.375) [-3596.291] (-3603.283) * (-3606.728) (-3586.697) [-3597.928] (-3606.749) -- 0:01:00 884500 -- [-3592.061] (-3600.845) (-3599.489) (-3592.700) * (-3593.538) (-3598.381) [-3593.144] (-3595.447) -- 0:01:00 885000 -- (-3597.679) (-3593.989) (-3591.404) [-3593.681] * (-3608.515) (-3592.081) (-3599.663) [-3589.500] -- 0:01:00 Average standard deviation of split frequencies: 0.003990 885500 -- (-3600.420) (-3596.754) (-3589.832) [-3589.909] * (-3612.739) [-3606.590] (-3590.641) (-3588.694) -- 0:00:59 886000 -- (-3596.603) (-3594.925) (-3597.521) [-3588.448] * (-3602.894) (-3595.059) (-3599.597) [-3594.205] -- 0:00:59 886500 -- (-3589.674) (-3590.578) [-3598.025] (-3600.873) * [-3594.845] (-3595.803) (-3593.022) (-3597.482) -- 0:00:59 887000 -- [-3594.955] (-3600.105) (-3601.020) (-3594.234) * (-3601.658) (-3595.113) (-3594.489) [-3594.953] -- 0:00:59 887500 -- [-3593.377] (-3595.791) (-3604.829) (-3595.581) * (-3591.001) (-3594.294) [-3597.866] (-3599.342) -- 0:00:58 888000 -- [-3595.751] (-3596.043) (-3599.628) (-3598.690) * [-3595.959] (-3590.221) (-3597.683) (-3601.543) -- 0:00:58 888500 -- [-3597.936] (-3598.248) (-3587.712) (-3602.592) * (-3597.891) [-3592.229] (-3602.950) (-3591.540) -- 0:00:58 889000 -- (-3600.799) (-3599.040) (-3591.484) [-3599.871] * (-3596.512) [-3590.577] (-3595.207) (-3593.300) -- 0:00:58 889500 -- (-3596.246) (-3597.078) [-3593.933] (-3595.846) * (-3592.215) [-3598.557] (-3592.700) (-3597.463) -- 0:00:57 890000 -- [-3592.351] (-3596.478) (-3591.017) (-3598.716) * (-3596.062) (-3598.193) [-3589.295] (-3599.713) -- 0:00:57 Average standard deviation of split frequencies: 0.003493 890500 -- (-3599.547) [-3599.158] (-3598.308) (-3593.000) * [-3593.578] (-3595.738) (-3587.102) (-3587.305) -- 0:00:57 891000 -- (-3597.620) (-3590.724) [-3591.522] (-3598.252) * [-3593.825] (-3597.195) (-3595.991) (-3594.328) -- 0:00:57 891500 -- (-3601.455) (-3600.523) (-3595.715) [-3603.931] * [-3590.999] (-3587.613) (-3598.861) (-3595.656) -- 0:00:56 892000 -- (-3599.953) (-3601.615) (-3592.324) [-3595.433] * (-3593.092) (-3593.541) [-3592.131] (-3593.778) -- 0:00:56 892500 -- (-3596.597) [-3593.766] (-3598.073) (-3603.460) * (-3594.433) [-3595.615] (-3597.915) (-3598.584) -- 0:00:56 893000 -- (-3600.589) (-3595.377) (-3602.114) [-3599.666] * [-3587.657] (-3596.707) (-3600.573) (-3596.572) -- 0:00:56 893500 -- (-3598.648) (-3593.441) [-3592.789] (-3602.033) * [-3601.769] (-3595.118) (-3593.097) (-3602.022) -- 0:00:55 894000 -- [-3590.949] (-3612.976) (-3592.036) (-3601.542) * [-3590.725] (-3592.399) (-3608.439) (-3594.444) -- 0:00:55 894500 -- (-3598.854) (-3598.248) (-3593.439) [-3597.127] * (-3604.918) (-3590.551) (-3602.804) [-3590.254] -- 0:00:55 895000 -- (-3594.693) (-3603.868) (-3598.293) [-3592.550] * (-3604.359) (-3602.628) (-3595.420) [-3595.793] -- 0:00:55 Average standard deviation of split frequencies: 0.003315 895500 -- (-3596.353) (-3597.550) [-3588.795] (-3598.404) * (-3602.786) (-3599.555) (-3601.467) [-3587.379] -- 0:00:54 896000 -- [-3589.907] (-3593.445) (-3594.183) (-3596.791) * (-3601.503) (-3594.433) [-3590.160] (-3596.631) -- 0:00:54 896500 -- (-3595.160) [-3602.753] (-3600.913) (-3589.623) * (-3596.686) (-3598.190) (-3599.637) [-3594.470] -- 0:00:54 897000 -- [-3590.184] (-3597.010) (-3588.722) (-3592.951) * (-3589.836) [-3587.096] (-3591.271) (-3594.096) -- 0:00:53 897500 -- (-3592.325) (-3591.206) [-3585.928] (-3597.386) * (-3594.508) (-3601.658) (-3598.771) [-3588.539] -- 0:00:53 898000 -- [-3595.580] (-3587.908) (-3592.125) (-3594.758) * (-3605.198) (-3596.977) [-3601.796] (-3596.085) -- 0:00:53 898500 -- (-3589.420) (-3596.222) [-3598.828] (-3593.686) * (-3609.044) [-3592.278] (-3599.776) (-3597.117) -- 0:00:53 899000 -- (-3596.469) [-3590.110] (-3604.054) (-3596.067) * (-3592.351) (-3598.701) (-3603.233) [-3593.576] -- 0:00:52 899500 -- (-3596.634) (-3599.789) (-3595.193) [-3593.276] * (-3596.828) (-3604.490) [-3599.281] (-3592.869) -- 0:00:52 900000 -- (-3604.164) (-3595.708) [-3593.635] (-3600.473) * [-3598.809] (-3590.007) (-3598.492) (-3595.365) -- 0:00:52 Average standard deviation of split frequencies: 0.004501 900500 -- (-3597.518) (-3596.937) [-3594.238] (-3610.256) * (-3598.113) [-3591.052] (-3591.000) (-3590.892) -- 0:00:52 901000 -- (-3599.379) [-3596.387] (-3586.255) (-3597.121) * (-3595.153) (-3597.784) (-3601.994) [-3590.234] -- 0:00:51 901500 -- (-3595.612) [-3593.226] (-3590.498) (-3596.953) * (-3600.509) [-3587.910] (-3590.507) (-3595.568) -- 0:00:51 902000 -- [-3601.176] (-3591.404) (-3603.374) (-3597.292) * (-3605.225) (-3595.202) [-3591.261] (-3591.392) -- 0:00:51 902500 -- (-3603.180) [-3607.891] (-3592.556) (-3605.710) * (-3604.201) (-3600.603) (-3596.459) [-3598.514] -- 0:00:51 903000 -- (-3599.063) (-3599.032) [-3595.104] (-3602.273) * (-3607.457) (-3599.596) [-3594.847] (-3590.422) -- 0:00:50 903500 -- (-3590.278) (-3606.335) (-3591.600) [-3601.403] * (-3587.222) (-3593.072) (-3594.286) [-3589.961] -- 0:00:50 904000 -- (-3598.265) [-3595.569] (-3597.631) (-3602.933) * (-3595.786) (-3590.615) [-3598.231] (-3602.683) -- 0:00:50 904500 -- (-3594.266) (-3600.030) (-3607.149) [-3589.452] * (-3609.519) [-3590.046] (-3593.756) (-3595.634) -- 0:00:50 905000 -- (-3590.739) (-3601.400) [-3591.085] (-3591.049) * (-3604.399) (-3591.601) [-3592.935] (-3599.137) -- 0:00:49 Average standard deviation of split frequencies: 0.004475 905500 -- (-3598.411) (-3602.467) [-3594.291] (-3598.537) * (-3597.459) [-3596.938] (-3603.181) (-3603.876) -- 0:00:49 906000 -- [-3594.907] (-3597.482) (-3593.326) (-3606.977) * (-3600.746) [-3599.327] (-3609.491) (-3596.982) -- 0:00:49 906500 -- [-3591.886] (-3600.703) (-3606.292) (-3604.161) * (-3600.216) (-3591.582) [-3590.814] (-3596.465) -- 0:00:48 907000 -- [-3591.621] (-3592.999) (-3603.445) (-3598.930) * (-3595.544) (-3596.087) (-3596.676) [-3597.670] -- 0:00:48 907500 -- (-3597.476) (-3593.901) [-3600.949] (-3602.620) * [-3590.472] (-3604.339) (-3592.238) (-3607.012) -- 0:00:48 908000 -- (-3596.277) (-3589.613) [-3593.077] (-3592.291) * (-3592.669) (-3596.894) (-3593.883) [-3596.485] -- 0:00:48 908500 -- (-3592.866) [-3585.851] (-3600.076) (-3599.429) * (-3591.523) [-3593.868] (-3594.939) (-3598.131) -- 0:00:47 909000 -- [-3586.529] (-3587.609) (-3606.400) (-3601.721) * [-3597.825] (-3605.877) (-3590.371) (-3593.101) -- 0:00:47 909500 -- (-3593.392) (-3602.528) (-3607.466) [-3590.823] * (-3594.075) (-3613.863) [-3596.528] (-3599.124) -- 0:00:47 910000 -- (-3588.961) (-3595.001) [-3589.687] (-3588.180) * [-3592.672] (-3591.614) (-3606.036) (-3598.972) -- 0:00:47 Average standard deviation of split frequencies: 0.004089 910500 -- (-3594.008) (-3606.105) (-3595.554) [-3593.319] * (-3598.939) (-3591.322) [-3589.776] (-3590.527) -- 0:00:46 911000 -- (-3591.718) (-3590.912) [-3587.699] (-3595.705) * (-3589.933) (-3607.713) (-3599.540) [-3599.581] -- 0:00:46 911500 -- (-3589.759) (-3594.869) [-3593.297] (-3597.906) * (-3601.663) (-3597.456) [-3591.217] (-3593.524) -- 0:00:46 912000 -- [-3593.354] (-3599.228) (-3594.012) (-3596.268) * (-3604.237) (-3600.676) [-3597.115] (-3596.542) -- 0:00:46 912500 -- (-3592.466) (-3596.536) (-3596.517) [-3594.835] * (-3595.726) (-3596.152) [-3593.933] (-3599.446) -- 0:00:45 913000 -- (-3590.569) (-3590.960) (-3592.392) [-3590.496] * (-3599.982) (-3599.674) [-3599.029] (-3602.905) -- 0:00:45 913500 -- (-3600.624) [-3589.500] (-3589.865) (-3592.143) * (-3602.218) [-3589.623] (-3590.797) (-3602.609) -- 0:00:45 914000 -- (-3596.643) (-3592.115) (-3603.323) [-3589.956] * (-3598.873) (-3598.642) [-3597.266] (-3596.692) -- 0:00:45 914500 -- (-3602.097) (-3601.069) (-3597.369) [-3599.137] * (-3594.242) (-3605.228) [-3595.686] (-3596.109) -- 0:00:44 915000 -- (-3604.988) [-3587.005] (-3594.787) (-3601.607) * (-3596.701) (-3606.679) [-3594.815] (-3592.373) -- 0:00:44 Average standard deviation of split frequencies: 0.003911 915500 -- (-3603.939) (-3591.454) [-3597.456] (-3594.481) * (-3598.740) [-3599.646] (-3594.519) (-3588.258) -- 0:00:44 916000 -- [-3595.452] (-3599.647) (-3597.185) (-3595.189) * [-3601.953] (-3599.742) (-3597.740) (-3608.691) -- 0:00:44 916500 -- (-3599.044) [-3600.823] (-3592.966) (-3597.999) * (-3597.778) [-3603.625] (-3600.536) (-3606.059) -- 0:00:43 917000 -- (-3598.315) (-3598.827) (-3595.208) [-3600.111] * (-3600.324) (-3601.982) (-3595.928) [-3590.033] -- 0:00:43 917500 -- (-3593.598) (-3592.778) [-3594.033] (-3596.375) * [-3602.698] (-3602.939) (-3591.879) (-3595.716) -- 0:00:43 918000 -- (-3603.679) (-3598.034) (-3598.070) [-3592.983] * (-3602.096) (-3594.590) [-3589.947] (-3596.938) -- 0:00:42 918500 -- (-3593.835) (-3602.317) [-3594.709] (-3587.842) * (-3595.547) [-3590.565] (-3603.233) (-3603.749) -- 0:00:42 919000 -- (-3588.999) (-3605.649) (-3593.864) [-3595.579] * (-3597.896) [-3602.883] (-3596.938) (-3597.108) -- 0:00:42 919500 -- [-3599.081] (-3601.313) (-3592.472) (-3590.569) * (-3598.566) (-3614.508) [-3595.351] (-3603.925) -- 0:00:42 920000 -- [-3602.204] (-3601.449) (-3590.671) (-3591.166) * (-3595.427) (-3599.776) (-3593.454) [-3589.023] -- 0:00:41 Average standard deviation of split frequencies: 0.003328 920500 -- [-3600.582] (-3605.505) (-3602.602) (-3600.947) * [-3597.683] (-3589.183) (-3591.817) (-3592.907) -- 0:00:41 921000 -- (-3594.418) (-3589.535) [-3590.104] (-3599.255) * [-3588.864] (-3595.743) (-3600.559) (-3597.152) -- 0:00:41 921500 -- [-3588.088] (-3593.320) (-3598.540) (-3596.551) * (-3595.366) (-3590.525) [-3589.623] (-3601.847) -- 0:00:41 922000 -- (-3593.453) [-3589.862] (-3594.885) (-3598.583) * (-3597.706) [-3591.141] (-3594.348) (-3596.731) -- 0:00:40 922500 -- (-3601.743) (-3587.726) [-3594.831] (-3597.295) * (-3595.918) (-3594.035) (-3602.434) [-3591.545] -- 0:00:40 923000 -- (-3597.190) (-3595.831) [-3598.319] (-3598.399) * [-3596.841] (-3599.017) (-3600.541) (-3592.804) -- 0:00:40 923500 -- (-3594.406) [-3593.761] (-3595.332) (-3604.517) * (-3601.056) [-3590.075] (-3594.388) (-3596.274) -- 0:00:40 924000 -- [-3592.958] (-3595.237) (-3599.188) (-3605.261) * (-3597.735) (-3593.259) [-3594.327] (-3607.702) -- 0:00:39 924500 -- (-3595.106) (-3594.394) (-3592.276) [-3593.905] * (-3597.302) [-3587.737] (-3590.378) (-3591.906) -- 0:00:39 925000 -- [-3601.088] (-3600.829) (-3597.288) (-3597.854) * [-3589.135] (-3591.297) (-3593.860) (-3596.646) -- 0:00:39 Average standard deviation of split frequencies: 0.003513 925500 -- [-3594.993] (-3592.587) (-3598.122) (-3601.823) * (-3604.509) (-3603.652) (-3600.919) [-3594.804] -- 0:00:39 926000 -- [-3592.618] (-3597.626) (-3598.294) (-3605.644) * (-3593.639) (-3592.451) [-3599.182] (-3594.922) -- 0:00:38 926500 -- [-3591.111] (-3596.069) (-3598.298) (-3597.556) * (-3600.240) [-3591.771] (-3596.929) (-3596.760) -- 0:00:38 927000 -- (-3591.792) (-3595.719) (-3592.575) [-3590.832] * (-3600.054) [-3595.224] (-3599.842) (-3601.071) -- 0:00:38 927500 -- [-3592.506] (-3598.969) (-3600.794) (-3608.047) * (-3598.313) (-3600.402) (-3592.748) [-3594.699] -- 0:00:37 928000 -- (-3591.176) (-3598.181) [-3599.828] (-3590.753) * [-3598.620] (-3591.004) (-3596.016) (-3600.762) -- 0:00:37 928500 -- (-3592.979) (-3594.795) (-3597.369) [-3591.661] * (-3598.018) (-3603.432) [-3598.348] (-3601.978) -- 0:00:37 929000 -- (-3595.712) [-3593.661] (-3602.298) (-3597.974) * (-3596.665) [-3590.296] (-3593.902) (-3591.946) -- 0:00:37 929500 -- [-3595.188] (-3598.855) (-3607.963) (-3606.972) * (-3601.279) [-3596.448] (-3602.615) (-3600.141) -- 0:00:36 930000 -- (-3598.093) (-3596.070) [-3589.393] (-3593.984) * [-3592.401] (-3592.012) (-3594.843) (-3600.514) -- 0:00:36 Average standard deviation of split frequencies: 0.004052 930500 -- (-3593.418) (-3596.098) (-3595.814) [-3593.417] * (-3594.670) (-3597.862) [-3595.056] (-3611.131) -- 0:00:36 931000 -- (-3590.807) (-3596.478) (-3592.835) [-3591.775] * (-3599.878) (-3593.469) [-3589.870] (-3601.986) -- 0:00:36 931500 -- [-3591.753] (-3589.948) (-3593.096) (-3590.304) * [-3592.166] (-3589.605) (-3600.679) (-3597.635) -- 0:00:35 932000 -- (-3598.273) [-3595.684] (-3605.159) (-3589.069) * (-3599.217) [-3592.076] (-3601.374) (-3596.575) -- 0:00:35 932500 -- (-3596.508) (-3605.387) (-3599.712) [-3595.242] * (-3595.809) (-3594.601) (-3595.336) [-3592.250] -- 0:00:35 933000 -- (-3599.517) (-3595.903) [-3589.732] (-3605.299) * (-3616.506) [-3594.640] (-3597.442) (-3589.165) -- 0:00:35 933500 -- [-3592.087] (-3600.388) (-3599.325) (-3589.654) * (-3606.138) (-3590.179) [-3591.446] (-3593.100) -- 0:00:34 934000 -- [-3596.323] (-3604.170) (-3597.870) (-3594.110) * [-3592.550] (-3600.802) (-3593.490) (-3593.798) -- 0:00:34 934500 -- (-3591.183) (-3599.059) [-3598.514] (-3600.242) * [-3593.059] (-3606.819) (-3597.942) (-3601.465) -- 0:00:34 935000 -- [-3595.501] (-3598.061) (-3594.905) (-3599.429) * (-3593.281) (-3597.123) [-3596.489] (-3599.007) -- 0:00:34 Average standard deviation of split frequencies: 0.004382 935500 -- (-3598.647) (-3591.518) [-3594.322] (-3601.039) * [-3592.293] (-3600.505) (-3594.108) (-3592.567) -- 0:00:33 936000 -- (-3594.662) [-3599.443] (-3595.513) (-3593.384) * (-3597.849) [-3594.942] (-3585.144) (-3595.251) -- 0:00:33 936500 -- (-3592.111) (-3598.924) [-3585.749] (-3599.156) * [-3599.135] (-3591.106) (-3591.198) (-3596.787) -- 0:00:33 937000 -- (-3594.244) (-3598.262) (-3600.360) [-3597.342] * (-3601.949) [-3594.640] (-3601.674) (-3594.787) -- 0:00:33 937500 -- (-3594.494) (-3598.846) [-3600.420] (-3594.226) * [-3593.467] (-3597.845) (-3605.454) (-3593.262) -- 0:00:32 938000 -- (-3593.595) [-3597.727] (-3597.824) (-3602.304) * (-3592.446) [-3589.210] (-3590.778) (-3597.249) -- 0:00:32 938500 -- (-3600.524) [-3593.371] (-3601.402) (-3600.006) * (-3598.413) (-3610.465) [-3596.310] (-3593.018) -- 0:00:32 939000 -- (-3595.524) [-3598.014] (-3588.156) (-3599.833) * (-3599.399) [-3598.121] (-3592.863) (-3587.483) -- 0:00:31 939500 -- (-3603.510) (-3598.188) [-3589.207] (-3601.115) * (-3601.950) (-3605.060) [-3595.714] (-3602.756) -- 0:00:31 940000 -- [-3599.755] (-3606.629) (-3596.789) (-3591.917) * (-3599.964) (-3586.228) (-3588.687) [-3591.824] -- 0:00:31 Average standard deviation of split frequencies: 0.004059 940500 -- [-3594.156] (-3593.692) (-3593.791) (-3600.040) * [-3598.969] (-3589.644) (-3596.309) (-3595.398) -- 0:00:31 941000 -- [-3591.782] (-3607.758) (-3593.417) (-3604.555) * (-3592.183) [-3589.115] (-3591.686) (-3595.588) -- 0:00:30 941500 -- (-3602.400) (-3586.608) [-3603.327] (-3598.084) * (-3587.797) (-3594.672) (-3604.389) [-3590.521] -- 0:00:30 942000 -- (-3588.244) (-3597.433) (-3600.200) [-3595.545] * (-3603.639) [-3592.863] (-3594.871) (-3597.715) -- 0:00:30 942500 -- [-3595.590] (-3594.796) (-3602.926) (-3591.695) * (-3592.542) (-3596.128) [-3593.455] (-3594.846) -- 0:00:30 943000 -- [-3596.544] (-3600.291) (-3603.560) (-3595.188) * (-3596.315) (-3603.643) [-3602.510] (-3593.203) -- 0:00:29 943500 -- (-3599.422) (-3598.354) (-3593.422) [-3592.894] * (-3594.098) [-3591.315] (-3598.393) (-3605.702) -- 0:00:29 944000 -- (-3604.031) (-3594.183) (-3597.935) [-3597.861] * (-3590.926) (-3590.904) (-3597.732) [-3587.546] -- 0:00:29 944500 -- (-3603.781) (-3590.687) [-3598.654] (-3590.354) * (-3592.544) (-3603.201) (-3594.127) [-3590.089] -- 0:00:29 945000 -- (-3596.980) [-3595.619] (-3605.310) (-3603.498) * (-3593.649) (-3595.123) [-3589.285] (-3598.115) -- 0:00:28 Average standard deviation of split frequencies: 0.004784 945500 -- (-3613.196) [-3587.639] (-3595.678) (-3600.056) * (-3596.106) (-3591.342) [-3591.938] (-3591.588) -- 0:00:28 946000 -- (-3604.849) (-3600.100) (-3594.433) [-3586.629] * (-3589.364) (-3590.650) (-3598.500) [-3595.897] -- 0:00:28 946500 -- [-3599.273] (-3596.159) (-3593.588) (-3591.215) * [-3589.916] (-3605.592) (-3607.996) (-3592.598) -- 0:00:28 947000 -- (-3597.358) (-3602.984) (-3595.579) [-3587.710] * (-3595.903) (-3593.312) (-3597.730) [-3589.412] -- 0:00:27 947500 -- (-3592.612) (-3604.246) [-3597.469] (-3598.771) * (-3592.744) (-3608.135) [-3594.736] (-3594.589) -- 0:00:27 948000 -- (-3603.440) (-3595.449) (-3598.890) [-3589.693] * (-3594.012) (-3597.275) (-3602.703) [-3593.259] -- 0:00:27 948500 -- (-3596.001) (-3595.889) [-3589.561] (-3597.200) * [-3588.900] (-3590.961) (-3597.498) (-3599.460) -- 0:00:26 949000 -- (-3592.218) [-3595.624] (-3604.990) (-3596.504) * (-3599.757) (-3598.745) (-3611.719) [-3595.124] -- 0:00:26 949500 -- (-3602.192) [-3586.359] (-3593.546) (-3599.898) * (-3613.710) [-3599.706] (-3604.954) (-3593.000) -- 0:00:26 950000 -- (-3600.245) [-3595.512] (-3592.641) (-3597.679) * (-3601.172) (-3593.138) (-3604.502) [-3608.431] -- 0:00:26 Average standard deviation of split frequencies: 0.004264 950500 -- [-3593.199] (-3594.935) (-3594.951) (-3606.159) * (-3594.489) (-3597.270) (-3600.226) [-3588.369] -- 0:00:25 951000 -- [-3599.878] (-3591.055) (-3605.376) (-3600.252) * [-3592.693] (-3597.705) (-3594.791) (-3599.369) -- 0:00:25 951500 -- (-3592.982) [-3600.637] (-3593.409) (-3594.890) * (-3598.490) (-3606.710) (-3596.456) [-3598.385] -- 0:00:25 952000 -- [-3593.788] (-3595.220) (-3594.455) (-3600.997) * (-3594.760) (-3598.407) (-3597.970) [-3591.624] -- 0:00:25 952500 -- (-3597.785) (-3595.081) [-3595.408] (-3605.302) * (-3590.903) (-3595.328) [-3598.789] (-3596.484) -- 0:00:24 953000 -- [-3591.739] (-3596.357) (-3603.297) (-3601.154) * [-3598.759] (-3599.571) (-3597.750) (-3592.500) -- 0:00:24 953500 -- [-3590.086] (-3593.330) (-3592.890) (-3598.588) * (-3602.184) (-3598.227) (-3593.315) [-3593.872] -- 0:00:24 954000 -- [-3595.525] (-3602.783) (-3595.238) (-3599.387) * [-3595.828] (-3599.511) (-3600.502) (-3590.876) -- 0:00:24 954500 -- (-3595.724) (-3596.282) [-3588.833] (-3589.899) * (-3598.190) (-3605.594) [-3598.200] (-3600.153) -- 0:00:23 955000 -- (-3607.329) (-3598.898) [-3600.459] (-3598.009) * (-3591.806) [-3595.567] (-3602.533) (-3600.245) -- 0:00:23 Average standard deviation of split frequencies: 0.003846 955500 -- (-3614.023) (-3597.303) (-3612.644) [-3598.681] * [-3587.094] (-3587.582) (-3612.727) (-3593.969) -- 0:00:23 956000 -- (-3595.826) [-3590.207] (-3595.672) (-3614.964) * [-3590.629] (-3590.438) (-3596.210) (-3600.355) -- 0:00:23 956500 -- (-3590.739) [-3594.293] (-3616.235) (-3604.983) * [-3590.998] (-3596.224) (-3592.333) (-3595.493) -- 0:00:22 957000 -- (-3598.321) [-3598.166] (-3593.952) (-3603.423) * (-3595.541) (-3596.900) [-3593.575] (-3592.839) -- 0:00:22 957500 -- [-3594.059] (-3592.875) (-3595.156) (-3594.339) * (-3605.163) (-3594.846) [-3593.425] (-3597.482) -- 0:00:22 958000 -- [-3593.004] (-3602.309) (-3599.287) (-3589.681) * [-3594.125] (-3590.608) (-3589.453) (-3596.104) -- 0:00:22 958500 -- [-3593.143] (-3587.618) (-3598.544) (-3593.435) * (-3594.694) [-3593.024] (-3597.466) (-3601.391) -- 0:00:21 959000 -- (-3600.774) [-3597.484] (-3596.330) (-3596.380) * (-3596.877) [-3592.709] (-3588.020) (-3592.135) -- 0:00:21 959500 -- (-3597.536) (-3590.588) (-3594.394) [-3592.361] * (-3594.315) (-3590.890) [-3592.075] (-3607.100) -- 0:00:21 960000 -- (-3588.075) (-3600.312) (-3604.649) [-3591.371] * [-3595.091] (-3596.894) (-3598.461) (-3593.583) -- 0:00:20 Average standard deviation of split frequencies: 0.004564 960500 -- (-3591.589) (-3595.197) (-3594.551) [-3601.034] * (-3597.402) [-3589.497] (-3596.796) (-3597.653) -- 0:00:20 961000 -- [-3591.570] (-3594.849) (-3605.149) (-3601.014) * [-3597.143] (-3606.796) (-3604.862) (-3592.830) -- 0:00:20 961500 -- (-3596.824) [-3602.558] (-3602.630) (-3596.374) * (-3597.957) (-3597.740) [-3591.389] (-3589.053) -- 0:00:20 962000 -- (-3604.391) (-3583.772) [-3598.871] (-3600.220) * [-3586.219] (-3596.467) (-3606.315) (-3596.950) -- 0:00:19 962500 -- [-3594.866] (-3600.268) (-3597.850) (-3592.454) * (-3589.314) (-3596.441) (-3594.848) [-3597.087] -- 0:00:19 963000 -- (-3589.573) [-3596.911] (-3605.260) (-3596.501) * (-3596.535) [-3591.010] (-3607.647) (-3590.838) -- 0:00:19 963500 -- [-3596.728] (-3598.254) (-3590.461) (-3591.930) * (-3597.696) [-3595.766] (-3594.624) (-3595.932) -- 0:00:19 964000 -- [-3595.445] (-3595.446) (-3600.900) (-3597.672) * (-3611.043) (-3592.009) [-3602.724] (-3592.550) -- 0:00:18 964500 -- [-3594.378] (-3599.747) (-3600.139) (-3596.076) * (-3597.274) [-3592.994] (-3598.099) (-3600.444) -- 0:00:18 965000 -- (-3592.550) (-3598.509) [-3602.670] (-3602.938) * [-3594.242] (-3591.922) (-3600.250) (-3604.778) -- 0:00:18 Average standard deviation of split frequencies: 0.004050 965500 -- (-3597.441) (-3601.049) [-3587.158] (-3595.583) * [-3591.469] (-3599.348) (-3601.603) (-3604.188) -- 0:00:18 966000 -- (-3598.247) [-3597.223] (-3602.986) (-3592.595) * (-3607.783) (-3601.092) [-3589.660] (-3593.846) -- 0:00:17 966500 -- (-3595.893) [-3589.341] (-3596.390) (-3600.066) * (-3588.641) (-3590.938) (-3599.298) [-3593.003] -- 0:00:17 967000 -- (-3591.627) (-3592.478) [-3594.082] (-3599.277) * [-3594.629] (-3606.391) (-3595.480) (-3599.871) -- 0:00:17 967500 -- (-3609.440) [-3598.769] (-3595.054) (-3604.996) * (-3602.436) (-3590.414) [-3591.347] (-3607.452) -- 0:00:17 968000 -- (-3595.902) (-3594.365) [-3591.085] (-3599.535) * (-3604.012) (-3598.087) (-3594.022) [-3600.652] -- 0:00:16 968500 -- (-3600.131) (-3590.979) (-3590.009) [-3597.935] * (-3595.901) (-3609.874) [-3597.072] (-3595.153) -- 0:00:16 969000 -- (-3600.122) (-3594.919) [-3592.761] (-3591.077) * (-3598.918) (-3593.562) (-3596.112) [-3599.919] -- 0:00:16 969500 -- (-3595.735) (-3591.859) [-3590.666] (-3595.764) * (-3599.625) (-3588.982) (-3601.700) [-3589.386] -- 0:00:15 970000 -- [-3601.264] (-3595.852) (-3589.788) (-3594.518) * (-3607.052) [-3584.059] (-3594.682) (-3591.099) -- 0:00:15 Average standard deviation of split frequencies: 0.004079 970500 -- [-3591.220] (-3591.067) (-3590.519) (-3595.049) * (-3592.740) [-3593.613] (-3601.099) (-3594.493) -- 0:00:15 971000 -- (-3590.530) (-3600.878) (-3588.506) [-3592.567] * (-3591.895) (-3597.816) (-3596.269) [-3594.668] -- 0:00:15 971500 -- (-3600.954) (-3596.167) [-3590.954] (-3595.062) * (-3589.123) [-3599.433] (-3595.522) (-3594.627) -- 0:00:14 972000 -- (-3606.916) (-3595.897) (-3592.755) [-3597.081] * (-3593.169) (-3612.972) (-3596.074) [-3591.022] -- 0:00:14 972500 -- (-3602.107) (-3591.053) (-3607.388) [-3585.021] * (-3605.810) (-3590.714) [-3590.905] (-3587.621) -- 0:00:14 973000 -- (-3599.100) (-3597.198) (-3603.717) [-3596.182] * [-3595.614] (-3592.882) (-3593.921) (-3595.384) -- 0:00:14 973500 -- (-3596.283) (-3594.196) [-3592.806] (-3590.408) * (-3594.874) [-3590.183] (-3601.803) (-3594.875) -- 0:00:13 974000 -- [-3601.550] (-3594.823) (-3598.308) (-3588.384) * (-3597.023) (-3598.750) [-3593.316] (-3597.883) -- 0:00:13 974500 -- (-3604.463) (-3594.500) [-3593.917] (-3590.694) * (-3599.302) [-3593.388] (-3603.833) (-3607.424) -- 0:00:13 975000 -- (-3608.001) [-3590.121] (-3598.558) (-3592.050) * [-3590.663] (-3600.054) (-3595.405) (-3597.543) -- 0:00:13 Average standard deviation of split frequencies: 0.004057 975500 -- (-3599.543) (-3598.093) (-3598.755) [-3592.678] * (-3594.958) (-3597.987) (-3595.857) [-3597.061] -- 0:00:12 976000 -- (-3600.009) (-3592.155) [-3599.771] (-3597.179) * (-3595.454) (-3600.665) [-3591.064] (-3596.483) -- 0:00:12 976500 -- (-3603.443) [-3597.107] (-3592.325) (-3599.436) * (-3594.192) (-3591.201) (-3591.810) [-3589.028] -- 0:00:12 977000 -- (-3614.882) [-3593.763] (-3596.444) (-3595.218) * (-3596.028) (-3598.863) [-3593.772] (-3596.680) -- 0:00:12 977500 -- [-3599.533] (-3593.461) (-3593.923) (-3588.538) * (-3600.231) (-3595.124) (-3601.626) [-3591.922] -- 0:00:11 978000 -- (-3594.756) (-3603.512) [-3597.470] (-3597.893) * (-3599.945) (-3599.222) (-3603.532) [-3589.679] -- 0:00:11 978500 -- (-3597.060) (-3600.886) [-3595.065] (-3593.810) * [-3591.594] (-3594.636) (-3601.269) (-3590.308) -- 0:00:11 979000 -- (-3605.642) [-3594.113] (-3598.425) (-3603.546) * (-3590.623) (-3613.995) (-3602.098) [-3593.469] -- 0:00:11 979500 -- (-3611.045) (-3591.676) (-3592.374) [-3595.793] * (-3589.646) (-3598.756) (-3598.793) [-3606.326] -- 0:00:10 980000 -- (-3593.876) [-3597.441] (-3597.875) (-3596.679) * [-3590.851] (-3594.838) (-3600.449) (-3602.015) -- 0:00:10 Average standard deviation of split frequencies: 0.004422 980500 -- (-3600.526) [-3592.447] (-3594.659) (-3596.100) * (-3591.468) (-3599.254) [-3593.896] (-3603.574) -- 0:00:10 981000 -- [-3605.090] (-3604.210) (-3597.158) (-3585.661) * [-3596.438] (-3596.272) (-3591.927) (-3595.143) -- 0:00:09 981500 -- [-3594.548] (-3598.765) (-3600.993) (-3594.126) * [-3594.557] (-3603.791) (-3594.590) (-3597.164) -- 0:00:09 982000 -- (-3607.064) (-3606.508) (-3600.353) [-3602.103] * [-3597.386] (-3591.185) (-3598.247) (-3602.527) -- 0:00:09 982500 -- (-3597.673) (-3605.168) [-3595.157] (-3596.319) * (-3594.504) (-3592.119) [-3596.737] (-3597.959) -- 0:00:09 983000 -- (-3602.453) (-3595.120) [-3594.858] (-3586.164) * (-3587.170) (-3593.974) (-3594.879) [-3595.414] -- 0:00:08 983500 -- [-3594.979] (-3591.989) (-3595.062) (-3599.426) * (-3595.891) (-3593.906) [-3594.736] (-3594.902) -- 0:00:08 984000 -- (-3605.506) (-3593.744) [-3594.067] (-3605.107) * [-3588.731] (-3592.449) (-3590.194) (-3603.443) -- 0:00:08 984500 -- (-3600.486) [-3590.307] (-3591.303) (-3594.326) * [-3590.459] (-3596.653) (-3604.063) (-3590.075) -- 0:00:08 985000 -- [-3593.153] (-3595.881) (-3602.855) (-3601.191) * (-3600.385) (-3611.654) [-3594.312] (-3600.768) -- 0:00:07 Average standard deviation of split frequencies: 0.004207 985500 -- (-3594.598) (-3609.280) [-3603.374] (-3594.947) * (-3602.684) (-3603.813) [-3593.497] (-3598.405) -- 0:00:07 986000 -- (-3597.508) (-3599.545) (-3596.566) [-3594.094] * [-3591.849] (-3607.014) (-3598.610) (-3599.528) -- 0:00:07 986500 -- (-3594.608) (-3592.347) [-3594.524] (-3598.527) * (-3603.172) (-3605.584) (-3587.789) [-3594.616] -- 0:00:07 987000 -- [-3590.736] (-3590.175) (-3593.827) (-3595.249) * (-3598.528) [-3597.194] (-3598.836) (-3598.170) -- 0:00:06 987500 -- (-3597.764) [-3586.527] (-3602.262) (-3596.481) * (-3595.869) [-3588.892] (-3603.603) (-3589.583) -- 0:00:06 988000 -- (-3594.084) (-3592.722) [-3600.041] (-3601.319) * [-3596.097] (-3593.338) (-3600.767) (-3601.890) -- 0:00:06 988500 -- [-3596.827] (-3598.984) (-3591.702) (-3600.740) * (-3589.450) (-3597.285) (-3596.493) [-3589.914] -- 0:00:06 989000 -- (-3611.726) (-3607.143) (-3604.440) [-3595.212] * (-3595.528) (-3593.523) (-3596.077) [-3594.916] -- 0:00:05 989500 -- (-3604.995) (-3598.344) (-3601.943) [-3589.705] * [-3596.324] (-3590.182) (-3606.986) (-3596.124) -- 0:00:05 990000 -- (-3594.160) (-3595.591) (-3604.135) [-3597.164] * (-3596.270) [-3596.470] (-3601.634) (-3594.831) -- 0:00:05 Average standard deviation of split frequencies: 0.004616 990500 -- (-3596.704) [-3600.162] (-3602.259) (-3603.947) * [-3608.936] (-3597.286) (-3596.326) (-3598.422) -- 0:00:04 991000 -- (-3608.145) (-3595.097) [-3595.225] (-3592.728) * (-3601.422) (-3606.601) [-3601.796] (-3598.763) -- 0:00:04 991500 -- (-3594.518) [-3590.139] (-3598.332) (-3590.136) * [-3593.626] (-3598.069) (-3595.177) (-3593.683) -- 0:00:04 992000 -- (-3592.384) (-3599.076) (-3606.574) [-3590.618] * (-3609.064) (-3590.527) [-3599.294] (-3590.216) -- 0:00:04 992500 -- (-3592.065) (-3601.317) (-3598.074) [-3598.697] * (-3595.422) [-3595.052] (-3597.684) (-3602.913) -- 0:00:03 993000 -- (-3597.726) [-3591.824] (-3596.908) (-3593.862) * [-3599.471] (-3607.924) (-3595.358) (-3593.270) -- 0:00:03 993500 -- [-3595.520] (-3595.394) (-3593.950) (-3591.988) * (-3606.875) (-3590.439) [-3592.193] (-3598.932) -- 0:00:03 994000 -- [-3589.523] (-3595.951) (-3591.931) (-3595.632) * [-3596.635] (-3602.357) (-3594.333) (-3590.763) -- 0:00:03 994500 -- (-3602.217) [-3594.057] (-3595.030) (-3592.577) * [-3595.322] (-3597.625) (-3594.573) (-3593.728) -- 0:00:02 995000 -- [-3599.453] (-3595.773) (-3598.232) (-3605.373) * (-3610.383) (-3596.302) (-3594.766) [-3593.145] -- 0:00:02 Average standard deviation of split frequencies: 0.004733 995500 -- (-3596.062) (-3599.863) [-3603.785] (-3597.802) * (-3601.262) (-3597.149) (-3597.362) [-3591.402] -- 0:00:02 996000 -- (-3602.690) (-3599.139) (-3592.504) [-3596.407] * (-3595.150) (-3598.290) (-3596.004) [-3592.980] -- 0:00:02 996500 -- (-3601.839) (-3597.871) [-3593.677] (-3605.608) * [-3594.816] (-3598.385) (-3606.427) (-3596.905) -- 0:00:01 997000 -- (-3597.569) (-3603.901) (-3594.274) [-3599.267] * [-3591.879] (-3594.340) (-3595.251) (-3590.796) -- 0:00:01 997500 -- (-3595.001) [-3610.370] (-3599.209) (-3593.014) * (-3595.327) (-3599.558) (-3592.356) [-3590.758] -- 0:00:01 998000 -- (-3604.220) [-3596.720] (-3600.429) (-3591.263) * [-3595.155] (-3595.372) (-3602.338) (-3601.703) -- 0:00:01 998500 -- (-3603.430) [-3598.946] (-3593.560) (-3603.459) * (-3596.395) [-3591.064] (-3604.278) (-3601.184) -- 0:00:00 999000 -- (-3606.402) (-3594.792) [-3595.688] (-3599.642) * (-3589.378) (-3591.955) (-3594.015) [-3598.952] -- 0:00:00 999500 -- (-3591.177) [-3596.364] (-3592.883) (-3598.784) * [-3593.982] (-3610.332) (-3597.674) (-3601.329) -- 0:00:00 1000000 -- (-3595.353) [-3593.397] (-3598.889) (-3596.154) * (-3606.803) [-3603.639] (-3590.808) (-3598.640) -- 0:00:00 Average standard deviation of split frequencies: 0.004711 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -3595.352812 -- 19.643623 Chain 1 -- -3595.352793 -- 19.643623 Chain 2 -- -3593.397429 -- 21.542295 Chain 2 -- -3593.397432 -- 21.542295 Chain 3 -- -3598.888811 -- 19.659235 Chain 3 -- -3598.888811 -- 19.659235 Chain 4 -- -3596.153728 -- 18.189042 Chain 4 -- -3596.153727 -- 18.189042 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -3606.802734 -- 21.668687 Chain 1 -- -3606.802734 -- 21.668687 Chain 2 -- -3603.638785 -- 23.059696 Chain 2 -- -3603.638785 -- 23.059696 Chain 3 -- -3590.807666 -- 19.982036 Chain 3 -- -3590.807660 -- 19.982036 Chain 4 -- -3598.639525 -- 23.233778 Chain 4 -- -3598.639518 -- 23.233778 Analysis completed in 8 mins 44 seconds Analysis used 524.80 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -3582.18 Likelihood of best state for "cold" chain of run 2 was -3581.36 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 37.9 % ( 28 %) Dirichlet(Revmat{all}) 55.8 % ( 39 %) Slider(Revmat{all}) 23.7 % ( 28 %) Dirichlet(Pi{all}) 25.9 % ( 24 %) Slider(Pi{all}) 29.1 % ( 29 %) Multiplier(Alpha{1,2}) 41.6 % ( 26 %) Multiplier(Alpha{3}) 41.0 % ( 32 %) Slider(Pinvar{all}) 6.9 % ( 11 %) ExtSPR(Tau{all},V{all}) 2.2 % ( 2 %) ExtTBR(Tau{all},V{all}) 7.2 % ( 5 %) NNI(Tau{all},V{all}) 6.8 % ( 7 %) ParsSPR(Tau{all},V{all}) 26.1 % ( 24 %) Multiplier(V{all}) 32.1 % ( 36 %) Nodeslider(V{all}) 25.1 % ( 22 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 37.9 % ( 25 %) Dirichlet(Revmat{all}) 54.5 % ( 35 %) Slider(Revmat{all}) 23.4 % ( 22 %) Dirichlet(Pi{all}) 25.9 % ( 22 %) Slider(Pi{all}) 28.8 % ( 27 %) Multiplier(Alpha{1,2}) 41.3 % ( 27 %) Multiplier(Alpha{3}) 41.0 % ( 22 %) Slider(Pinvar{all}) 6.8 % ( 3 %) ExtSPR(Tau{all},V{all}) 2.2 % ( 2 %) ExtTBR(Tau{all},V{all}) 7.1 % ( 2 %) NNI(Tau{all},V{all}) 6.6 % ( 6 %) ParsSPR(Tau{all},V{all}) 26.0 % ( 26 %) Multiplier(V{all}) 32.4 % ( 35 %) Nodeslider(V{all}) 25.4 % ( 28 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.44 2 | 166295 0.80 0.62 3 | 166100 166382 0.81 4 | 166585 167080 167558 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.78 0.59 0.43 2 | 166277 0.80 0.62 3 | 166574 166624 0.81 4 | 167042 166741 166742 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -3592.36 | 1 1 | | 2 2 1 21 2 1 | | 1 1 2 | |1 2 1 2 2 | | 2111 2 12 2 2 2 | | 2 1 2 21 * 21 1 1 1 | | 1 1 2* 2 11 1 1 222 | | 11 1 2 1 * 2 2 1 1 21 1 2 2 | | 2 1 1 1 | | *1 1 2 1 1 1 1 * 2 112 * 1 * | | 2 2 2 22 2 1 | | 2 2 2 2 | |2 2 1 1 2 1 2 2 1 2| | 1 2 2 2 1 | | 2 1| +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -3595.97 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3589.00 -3604.33 2 -3589.37 -3603.03 -------------------------------------- TOTAL -3589.17 -3603.88 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.675052 0.004334 0.552135 0.802740 0.671698 1354.52 1359.99 1.000 r(A<->C){all} 0.112940 0.000464 0.072316 0.154826 0.111657 995.06 1073.48 1.001 r(A<->G){all} 0.179747 0.000717 0.129183 0.233310 0.178346 971.34 1078.29 1.001 r(A<->T){all} 0.097148 0.000641 0.050112 0.146419 0.095696 983.42 1041.88 1.000 r(C<->G){all} 0.070068 0.000180 0.046538 0.099339 0.069039 1060.33 1061.85 1.000 r(C<->T){all} 0.464476 0.001644 0.381273 0.539274 0.463907 835.55 984.52 1.000 r(G<->T){all} 0.075621 0.000287 0.041718 0.107464 0.074870 1165.38 1265.16 1.000 pi(A){all} 0.191600 0.000118 0.171233 0.213889 0.191556 923.43 1082.53 1.001 pi(C){all} 0.289599 0.000148 0.266747 0.313910 0.289428 1302.74 1344.46 1.001 pi(G){all} 0.315142 0.000161 0.290962 0.341013 0.314891 1227.06 1230.30 1.000 pi(T){all} 0.203659 0.000112 0.182682 0.223672 0.203115 1140.31 1226.56 1.003 alpha{1,2} 0.157315 0.000527 0.116654 0.206415 0.154884 1423.01 1462.00 1.000 alpha{3} 2.649032 0.652979 1.338836 4.389093 2.553274 1371.29 1394.43 1.000 pinvar{all} 0.505950 0.001624 0.424004 0.580642 0.507757 1314.06 1394.14 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 Key to taxon bipartitions (saved to file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ---------------- 1 -- .********* 2 -- .*........ 3 -- ..*....... 4 -- ...*...... 5 -- ....*..... 6 -- .....*.... 7 -- ......*... 8 -- .......*.. 9 -- ........*. 10 -- .........* 11 -- .**....... 12 -- ....****** 13 -- ...******* 14 -- ....**.*** 15 -- ........** 16 -- ....*..*** 17 -- ....*..*.. 18 -- .....*.*** 19 -- .....*.*.. 20 -- .......*** ---------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 11 3002 1.000000 0.000000 1.000000 1.000000 2 12 3002 1.000000 0.000000 1.000000 1.000000 2 13 3001 0.999667 0.000471 0.999334 1.000000 2 14 2999 0.999001 0.001413 0.998001 1.000000 2 15 2922 0.973351 0.001884 0.972019 0.974684 2 16 1581 0.526649 0.002355 0.524983 0.528314 2 17 1267 0.422052 0.015546 0.411059 0.433045 2 18 1247 0.415390 0.008009 0.409727 0.421053 2 19 967 0.322119 0.005182 0.318454 0.325783 2 20 516 0.171885 0.012248 0.163225 0.180546 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.022463 0.000039 0.011184 0.034698 0.021815 1.000 2 length{all}[2] 0.010295 0.000015 0.003731 0.018453 0.009758 1.000 2 length{all}[3] 0.002991 0.000005 0.000009 0.007026 0.002492 1.000 2 length{all}[4] 0.022482 0.000050 0.009196 0.035634 0.021792 1.000 2 length{all}[5] 0.062502 0.000186 0.036872 0.087917 0.061445 1.000 2 length{all}[6] 0.059031 0.000173 0.034985 0.085632 0.058077 1.000 2 length{all}[7] 0.070985 0.000230 0.043391 0.101600 0.069711 1.001 2 length{all}[8] 0.109737 0.000407 0.069687 0.148623 0.107976 1.001 2 length{all}[9] 0.075532 0.000246 0.047452 0.107545 0.074109 1.000 2 length{all}[10] 0.061653 0.000191 0.035642 0.088382 0.060307 1.000 2 length{all}[11] 0.012975 0.000022 0.004870 0.022645 0.012515 1.000 2 length{all}[12] 0.076901 0.000267 0.046795 0.108577 0.075545 1.000 2 length{all}[13] 0.016768 0.000042 0.005309 0.029954 0.016042 1.000 2 length{all}[14] 0.029318 0.000119 0.010519 0.052037 0.028205 1.000 2 length{all}[15] 0.020461 0.000073 0.005601 0.037557 0.019424 1.001 2 length{all}[16] 0.011014 0.000039 0.001314 0.023998 0.010158 1.003 2 length{all}[17] 0.010547 0.000041 0.000071 0.022488 0.009500 0.999 2 length{all}[18] 0.012281 0.000047 0.000011 0.024728 0.011303 1.001 2 length{all}[19] 0.011689 0.000053 0.000144 0.025173 0.010809 0.999 2 length{all}[20] 0.007859 0.000034 0.000015 0.018904 0.006485 1.000 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.004711 Maximum standard deviation of split frequencies = 0.015546 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.003 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | | /------------ C2 (2) |---------------------------100---------------------------+ | \------------ C3 (3) | + /---------------------------------------------------------- C4 (4) | | | | /----------------------- C5 (5) | | | | | |----------------------- C8 (8) \----100----+ /-----53----+ | | | /------------ C9 (9) | | \----97----+ | /----100----+ \------------ C10 (10) | | | \----100---+ \----------------------------------- C6 (6) | \----------------------------------------------- C7 (7) Phylogram (based on average branch lengths): /------- C1 (1) | | /--- C2 (2) |---+ | \- C3 (3) | + /------ C4 (4) | | | | /------------------- C5 (5) | | | | | |--------------------------------- C8 (8) \----+ /--+ | | | /----------------------- C9 (9) | | \-----+ | /-------+ \------------------ C10 (10) | | | \----------------------+ \------------------ C6 (6) | \--------------------- C7 (7) |--------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (36 trees sampled): 50 % credible set contains 2 trees 90 % credible set contains 6 trees 95 % credible set contains 9 trees 99 % credible set contains 19 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 10 ls = 1275 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Sites with gaps or missing data are removed. 78 ambiguity characters in seq. 1 81 ambiguity characters in seq. 2 81 ambiguity characters in seq. 3 75 ambiguity characters in seq. 4 63 ambiguity characters in seq. 5 75 ambiguity characters in seq. 6 75 ambiguity characters in seq. 7 51 ambiguity characters in seq. 8 96 ambiguity characters in seq. 9 84 ambiguity characters in seq. 10 35 sites are removed. 7 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 64 106 107 108 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 Sequences read.. Counting site patterns.. 0:00 213 patterns at 390 / 390 sites (100.0%), 0:00 Counting codons.. 360 bytes for distance 207888 bytes for conP 28968 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 727608 bytes for conP, adjusted 0.040939 0.017480 0.013070 0.005100 0.027626 0.033706 0.092413 0.025167 0.009632 0.085251 0.123579 0.023865 0.108417 0.091438 0.064390 0.108639 0.300000 1.300000 ntime & nrate & np: 16 2 18 Bounds (np=18): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 18 lnL0 = -3767.479944 Iterating by ming2 Initial: fx= 3767.479944 x= 0.04094 0.01748 0.01307 0.00510 0.02763 0.03371 0.09241 0.02517 0.00963 0.08525 0.12358 0.02387 0.10842 0.09144 0.06439 0.10864 0.30000 1.30000 1 h-m-p 0.0000 0.0000 700.6510 +CYCYCYC 3753.833653 6 0.0000 33 | 0/18 2 h-m-p 0.0000 0.0001 8957.6220 YCYCCC 3726.996950 5 0.0000 62 | 0/18 3 h-m-p 0.0000 0.0002 778.3385 +YCYYYYYC 3687.039221 7 0.0002 92 | 0/18 4 h-m-p 0.0000 0.0000 6275.0914 +YYCYCCCC 3659.210871 7 0.0000 125 | 0/18 5 h-m-p 0.0000 0.0000 9156.9593 +CYCCC 3612.935696 4 0.0000 154 | 0/18 6 h-m-p 0.0000 0.0000 6607.1009 +YYYCCC 3565.547648 5 0.0000 183 | 0/18 7 h-m-p 0.0000 0.0000 2632.5612 +YYYCCC 3555.974738 5 0.0000 212 | 0/18 8 h-m-p 0.0000 0.0001 694.8823 YCYCCC 3550.843690 5 0.0000 241 | 0/18 9 h-m-p 0.0001 0.0006 586.6208 ++ 3508.306134 m 0.0006 262 | 0/18 10 h-m-p 0.0000 0.0000 23946.4913 +YYYYY 3502.735692 4 0.0000 288 | 0/18 11 h-m-p 0.0000 0.0000 11907.3035 ++ 3482.660883 m 0.0000 309 | 0/18 12 h-m-p -0.0000 -0.0000 11295.8754 h-m-p: -3.80339472e-23 -1.90169736e-22 1.12958754e+04 3482.660883 .. | 0/18 13 h-m-p 0.0000 0.0000 42324.7509 YYCYCCCC 3438.312283 7 0.0000 359 | 0/18 14 h-m-p 0.0000 0.0000 1306.5586 +YCYYC 3416.862332 4 0.0000 387 | 0/18 15 h-m-p 0.0000 0.0000 4037.2792 YYCCC 3408.889835 4 0.0000 414 | 0/18 16 h-m-p 0.0001 0.0003 618.3823 +YYCCCCC 3358.045775 6 0.0002 446 | 0/18 17 h-m-p 0.0000 0.0000 5608.0275 YCYCCC 3349.769534 5 0.0000 475 | 0/18 18 h-m-p 0.0000 0.0001 4100.5729 +YCYCCC 3289.569275 5 0.0001 506 | 0/18 19 h-m-p 0.0000 0.0000 49428.2578 YCYCCC 3272.250793 5 0.0000 535 | 0/18 20 h-m-p 0.0000 0.0001 1147.1074 CYCCCC 3267.329096 5 0.0000 565 | 0/18 21 h-m-p 0.0002 0.0030 120.3715 +CCCC 3262.157758 3 0.0008 593 | 0/18 22 h-m-p 0.0001 0.0005 181.0962 CYCCC 3260.691963 4 0.0002 621 | 0/18 23 h-m-p 0.0001 0.0007 279.6884 CCCC 3258.600783 3 0.0002 648 | 0/18 24 h-m-p 0.0002 0.0015 260.4984 YCCC 3255.129427 3 0.0004 674 | 0/18 25 h-m-p 0.0001 0.0007 490.3556 CCCCC 3252.062728 4 0.0002 703 | 0/18 26 h-m-p 0.0003 0.0026 350.2362 YC 3245.702052 1 0.0007 725 | 0/18 27 h-m-p 0.0002 0.0013 1280.9106 YCCC 3232.025822 3 0.0004 751 | 0/18 28 h-m-p 0.0001 0.0006 994.3185 CCC 3229.074809 2 0.0001 776 | 0/18 29 h-m-p 0.0003 0.0015 85.1127 YCC 3228.844858 2 0.0001 800 | 0/18 30 h-m-p 0.0008 0.0064 15.1950 CC 3228.812518 1 0.0003 823 | 0/18 31 h-m-p 0.0252 1.6136 0.1524 ++CYCCCC 3201.459198 5 0.7836 856 | 0/18 32 h-m-p 0.3490 1.7452 0.2024 CYCCC 3191.531176 4 0.4463 902 | 0/18 33 h-m-p 0.5892 4.0579 0.1533 YCCC 3186.768205 3 1.3831 946 | 0/18 34 h-m-p 0.5409 2.7044 0.0776 YCCC 3183.758757 3 1.2188 990 | 0/18 35 h-m-p 0.9249 4.6247 0.0224 CCCCC 3182.240083 4 1.1065 1037 | 0/18 36 h-m-p 1.1114 8.0000 0.0223 +YC 3180.254759 1 3.6018 1078 | 0/18 37 h-m-p 1.5820 8.0000 0.0508 CCC 3179.031579 2 1.4707 1121 | 0/18 38 h-m-p 1.6000 8.0000 0.0059 YCCC 3178.128218 3 2.9764 1165 | 0/18 39 h-m-p 1.0973 8.0000 0.0161 YC 3177.084041 1 2.6473 1205 | 0/18 40 h-m-p 1.6000 8.0000 0.0127 CCC 3176.544696 2 1.9453 1248 | 0/18 41 h-m-p 1.6000 8.0000 0.0057 CCC 3176.210715 2 2.2067 1291 | 0/18 42 h-m-p 1.6000 8.0000 0.0056 CC 3176.131930 1 1.5710 1332 | 0/18 43 h-m-p 0.8275 8.0000 0.0106 +YC 3176.047678 1 2.0701 1373 | 0/18 44 h-m-p 1.6000 8.0000 0.0051 YC 3175.932352 1 3.4828 1413 | 0/18 45 h-m-p 1.6000 8.0000 0.0063 +YC 3175.792810 1 5.1609 1454 | 0/18 46 h-m-p 1.6000 8.0000 0.0030 +CCC 3175.408468 2 5.7647 1498 | 0/18 47 h-m-p 0.6536 8.0000 0.0265 +YCC 3175.157895 2 2.0617 1541 | 0/18 48 h-m-p 1.6000 8.0000 0.0081 CCC 3175.096065 2 1.6838 1584 | 0/18 49 h-m-p 1.6000 8.0000 0.0030 CC 3175.070705 1 1.4891 1625 | 0/18 50 h-m-p 1.6000 8.0000 0.0015 C 3175.064843 0 1.4776 1664 | 0/18 51 h-m-p 0.7407 8.0000 0.0029 +YC 3175.060418 1 2.4474 1705 | 0/18 52 h-m-p 1.6000 8.0000 0.0011 CC 3175.059534 1 1.3351 1746 | 0/18 53 h-m-p 1.6000 8.0000 0.0008 C 3175.059425 0 1.8623 1785 | 0/18 54 h-m-p 1.6000 8.0000 0.0008 C 3175.059387 0 1.6234 1824 | 0/18 55 h-m-p 1.6000 8.0000 0.0001 Y 3175.059384 0 1.1299 1863 | 0/18 56 h-m-p 1.6000 8.0000 0.0000 C 3175.059384 0 2.1301 1902 | 0/18 57 h-m-p 1.6000 8.0000 0.0000 C 3175.059384 0 1.6000 1941 | 0/18 58 h-m-p 1.6000 8.0000 0.0000 Y 3175.059384 0 1.6000 1980 | 0/18 59 h-m-p 1.6000 8.0000 0.0000 ---Y 3175.059384 0 0.0063 2022 Out.. lnL = -3175.059384 2023 lfun, 2023 eigenQcodon, 32368 P(t) Time used: 0:14 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 0.040939 0.017480 0.013070 0.005100 0.027626 0.033706 0.092413 0.025167 0.009632 0.085251 0.123579 0.023865 0.108417 0.091438 0.064390 0.108639 2.641280 0.816750 0.136540 ntime & nrate & np: 16 2 19 Bounds (np=19): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 8.375585 np = 19 lnL0 = -3254.466447 Iterating by ming2 Initial: fx= 3254.466447 x= 0.04094 0.01748 0.01307 0.00510 0.02763 0.03371 0.09241 0.02517 0.00963 0.08525 0.12358 0.02387 0.10842 0.09144 0.06439 0.10864 2.64128 0.81675 0.13654 1 h-m-p 0.0000 0.0001 778.0665 ++ 3211.806889 m 0.0001 24 | 0/19 2 h-m-p 0.0000 0.0000 58197.7475 +YYYYCCCC 3176.198201 7 0.0000 57 | 0/19 3 h-m-p 0.0000 0.0001 424.3186 YCYCCC 3174.028272 5 0.0000 87 | 0/19 4 h-m-p 0.0000 0.0003 316.8447 +YCYCCC 3168.124851 5 0.0002 118 | 0/19 5 h-m-p 0.0001 0.0007 121.1310 CCC 3167.489356 2 0.0001 144 | 0/19 6 h-m-p 0.0003 0.0032 43.2995 CCC 3167.213036 2 0.0003 170 | 0/19 7 h-m-p 0.0007 0.0034 19.4171 CCC 3167.172796 2 0.0002 196 | 0/19 8 h-m-p 0.0007 0.0132 7.2293 YC 3167.161663 1 0.0003 219 | 0/19 9 h-m-p 0.0004 0.0213 5.7599 CC 3167.143752 1 0.0007 243 | 0/19 10 h-m-p 0.0006 0.0472 6.2136 ++YCC 3166.848434 2 0.0065 270 | 0/19 11 h-m-p 0.0005 0.0079 87.9149 +YYCC 3165.893002 3 0.0014 297 | 0/19 12 h-m-p 0.0003 0.0030 422.4203 YC 3163.882918 1 0.0006 320 | 0/19 13 h-m-p 0.0003 0.0013 907.7321 +YCYCCC 3158.426691 5 0.0007 351 | 0/19 14 h-m-p 0.0002 0.0011 391.3902 CCCC 3157.743284 3 0.0002 379 | 0/19 15 h-m-p 0.0013 0.0071 67.1259 CC 3157.573776 1 0.0003 403 | 0/19 16 h-m-p 0.0032 0.0162 6.7002 CC 3157.543359 1 0.0008 427 | 0/19 17 h-m-p 0.0007 0.0664 7.0300 ++CCCC 3157.038641 3 0.0130 457 | 0/19 18 h-m-p 0.0004 0.0045 217.8537 +YYYC 3154.981569 3 0.0016 483 | 0/19 19 h-m-p 0.0002 0.0012 373.3848 CCCC 3154.166332 3 0.0004 511 | 0/19 20 h-m-p 0.0119 0.0596 4.1463 -CC 3154.153696 1 0.0010 536 | 0/19 21 h-m-p 0.0015 0.7613 4.2591 +++CCCCC 3151.255563 4 0.1565 569 | 0/19 22 h-m-p 1.6000 8.0000 0.1312 YCCC 3150.850221 3 0.7586 596 | 0/19 23 h-m-p 1.6000 8.0000 0.0331 CCC 3150.735460 2 1.4021 641 | 0/19 24 h-m-p 1.6000 8.0000 0.0034 CC 3150.651108 1 1.6145 684 | 0/19 25 h-m-p 0.1839 8.0000 0.0303 +CC 3150.601379 1 0.9311 728 | 0/19 26 h-m-p 1.6000 8.0000 0.0111 YC 3150.588258 1 1.0068 770 | 0/19 27 h-m-p 1.6000 8.0000 0.0010 YC 3150.585560 1 0.9842 812 | 0/19 28 h-m-p 0.6927 8.0000 0.0014 C 3150.585348 0 0.8830 853 | 0/19 29 h-m-p 1.6000 8.0000 0.0007 Y 3150.585331 0 0.7523 894 | 0/19 30 h-m-p 1.6000 8.0000 0.0001 Y 3150.585329 0 0.7900 935 | 0/19 31 h-m-p 0.5775 8.0000 0.0001 C 3150.585329 0 0.8843 976 | 0/19 32 h-m-p 1.6000 8.0000 0.0000 Y 3150.585329 0 0.7223 1017 | 0/19 33 h-m-p 1.6000 8.0000 0.0000 C 3150.585329 0 1.6000 1058 | 0/19 34 h-m-p 1.6000 8.0000 0.0000 -Y 3150.585329 0 0.1000 1100 | 0/19 35 h-m-p 0.0169 8.0000 0.0000 -------------.. | 0/19 36 h-m-p 0.0148 7.3977 0.0030 ------------- | 0/19 37 h-m-p 0.0148 7.3977 0.0030 ------------- Out.. lnL = -3150.585329 1257 lfun, 3771 eigenQcodon, 40224 P(t) Time used: 0:30 Model 2: PositiveSelection TREE # 1 (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 initial w for M2:NSpselection reset. 0.040939 0.017480 0.013070 0.005100 0.027626 0.033706 0.092413 0.025167 0.009632 0.085251 0.123579 0.023865 0.108417 0.091438 0.064390 0.108639 2.641618 1.098208 0.580294 0.458835 2.948231 ntime & nrate & np: 16 3 21 Bounds (np=21): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 3.655404 np = 21 lnL0 = -3465.371510 Iterating by ming2 Initial: fx= 3465.371510 x= 0.04094 0.01748 0.01307 0.00510 0.02763 0.03371 0.09241 0.02517 0.00963 0.08525 0.12358 0.02387 0.10842 0.09144 0.06439 0.10864 2.64162 1.09821 0.58029 0.45883 2.94823 1 h-m-p 0.0000 0.0002 644.1079 ++YCCCC 3450.995231 4 0.0001 56 | 0/21 2 h-m-p 0.0002 0.0010 441.2008 ++ 3422.211465 m 0.0010 101 | 0/21 3 h-m-p 0.0000 0.0000 10542.8870 ++ 3336.322566 m 0.0000 146 | 1/21 4 h-m-p 0.0000 0.0002 2303.2475 +YCCCC 3327.647133 4 0.0001 199 | 1/21 5 h-m-p 0.0001 0.0007 299.1545 ++ 3299.267928 m 0.0007 243 | 1/21 6 h-m-p 0.0002 0.0009 217.3523 +YYYCCC 3284.117187 5 0.0006 295 | 1/21 7 h-m-p 0.0003 0.0015 347.3937 +YCYCCC 3263.579553 5 0.0009 348 | 1/21 8 h-m-p 0.0001 0.0006 1858.2248 YCCCCC 3231.265143 5 0.0003 401 | 1/21 9 h-m-p 0.0001 0.0004 636.6009 +YYCYCCC 3219.168663 6 0.0003 455 | 1/21 10 h-m-p 0.0002 0.0009 265.2222 YCCCC 3215.561374 4 0.0003 506 | 0/21 11 h-m-p 0.0001 0.0003 728.9252 YYCCC 3214.135104 4 0.0000 556 | 0/21 12 h-m-p 0.0002 0.0032 70.1838 +CCCC 3212.390234 3 0.0009 608 | 0/21 13 h-m-p 0.0003 0.0044 202.7807 +YYCC 3207.285736 3 0.0012 658 | 0/21 14 h-m-p 0.0005 0.0023 314.4664 YC 3199.309214 1 0.0012 704 | 0/21 15 h-m-p 0.0001 0.0006 930.6514 CCCC 3196.262665 3 0.0002 755 | 0/21 16 h-m-p 0.0003 0.0017 112.0621 CCCC 3195.388276 3 0.0004 806 | 0/21 17 h-m-p 0.0007 0.0083 60.1769 CCC 3194.614481 2 0.0008 855 | 0/21 18 h-m-p 0.0013 0.0168 38.3782 +YYYC 3192.107301 3 0.0050 904 | 0/21 19 h-m-p 0.0008 0.0089 225.5523 +CYC 3183.168965 2 0.0033 953 | 0/21 20 h-m-p 0.0038 0.0189 32.6369 YYC 3182.332578 2 0.0029 1000 | 0/21 21 h-m-p 0.0011 0.0701 86.6113 ++CYCCC 3165.514541 4 0.0236 1054 | 0/21 22 h-m-p 0.0023 0.0116 28.7262 CCC 3165.350390 2 0.0009 1103 | 0/21 23 h-m-p 0.0391 1.7340 0.6471 ++YCYCCC 3158.665040 5 1.1107 1158 | 0/21 24 h-m-p 0.0400 0.2002 1.8135 +YYCCC 3156.672620 4 0.1380 1210 | 0/21 25 h-m-p 0.2546 2.9822 0.9832 YCCC 3153.266178 3 0.5917 1260 | 0/21 26 h-m-p 0.9229 4.7638 0.6303 CCC 3150.574578 2 1.3855 1309 | 0/21 27 h-m-p 0.3539 1.7694 1.0571 CCCCC 3149.713461 4 0.4348 1362 | 0/21 28 h-m-p 0.6016 3.0079 0.5525 CCCC 3148.919563 3 0.7861 1413 | 0/21 29 h-m-p 1.6000 8.0000 0.2704 YC 3148.761864 1 1.0021 1459 | 0/21 30 h-m-p 0.9372 8.0000 0.2892 CCC 3148.653445 2 1.2880 1508 | 0/21 31 h-m-p 1.6000 8.0000 0.2206 CCC 3148.589881 2 1.4452 1557 | 0/21 32 h-m-p 1.6000 8.0000 0.1438 YC 3148.564435 1 1.0088 1603 | 0/21 33 h-m-p 1.6000 8.0000 0.0306 YC 3148.556825 1 0.9377 1649 | 0/21 34 h-m-p 1.1612 8.0000 0.0247 YC 3148.549888 1 2.1265 1695 | 0/21 35 h-m-p 0.7665 8.0000 0.0686 +YC 3148.537586 1 2.3501 1742 | 0/21 36 h-m-p 1.1072 8.0000 0.1457 +CY 3148.494204 1 4.2862 1790 | 0/21 37 h-m-p 1.6000 8.0000 0.2866 YCCC 3148.406831 3 2.7984 1840 | 0/21 38 h-m-p 1.6000 8.0000 0.2699 YC 3148.360585 1 1.0525 1886 | 0/21 39 h-m-p 1.6000 8.0000 0.0463 YC 3148.346868 1 1.2048 1932 | 0/21 40 h-m-p 0.8985 8.0000 0.0621 YC 3148.342323 1 1.7772 1978 | 0/21 41 h-m-p 1.6000 8.0000 0.0174 YC 3148.337027 1 3.2834 2024 | 0/21 42 h-m-p 1.3043 8.0000 0.0437 +YC 3148.324874 1 3.7571 2071 | 0/21 43 h-m-p 1.6000 8.0000 0.0762 YC 3148.321227 1 1.0192 2117 | 0/21 44 h-m-p 1.6000 8.0000 0.0054 YC 3148.321024 1 0.8799 2163 | 0/21 45 h-m-p 1.6000 8.0000 0.0021 Y 3148.321013 0 0.7028 2208 | 0/21 46 h-m-p 1.6000 8.0000 0.0008 Y 3148.321012 0 1.1744 2253 | 0/21 47 h-m-p 1.6000 8.0000 0.0002 Y 3148.321012 0 0.9692 2298 | 0/21 48 h-m-p 1.6000 8.0000 0.0000 Y 3148.321012 0 1.1531 2343 | 0/21 49 h-m-p 1.6000 8.0000 0.0000 Y 3148.321012 0 1.2550 2388 | 0/21 50 h-m-p 1.6000 8.0000 0.0000 ------------C 3148.321012 0 0.0000 2445 Out.. lnL = -3148.321012 2446 lfun, 9784 eigenQcodon, 117408 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3174.025112 S = -3087.674489 -79.124769 Calculating f(w|X), posterior probabilities of site classes. did 10 / 213 patterns 1:17 did 20 / 213 patterns 1:17 did 30 / 213 patterns 1:17 did 40 / 213 patterns 1:17 did 50 / 213 patterns 1:17 did 60 / 213 patterns 1:17 did 70 / 213 patterns 1:17 did 80 / 213 patterns 1:17 did 90 / 213 patterns 1:17 did 100 / 213 patterns 1:18 did 110 / 213 patterns 1:18 did 120 / 213 patterns 1:18 did 130 / 213 patterns 1:18 did 140 / 213 patterns 1:18 did 150 / 213 patterns 1:18 did 160 / 213 patterns 1:18 did 170 / 213 patterns 1:18 did 180 / 213 patterns 1:18 did 190 / 213 patterns 1:18 did 200 / 213 patterns 1:18 did 210 / 213 patterns 1:18 did 213 / 213 patterns 1:18 Time used: 1:18 Model 3: discrete TREE # 1 (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 0.040939 0.017480 0.013070 0.005100 0.027626 0.033706 0.092413 0.025167 0.009632 0.085251 0.123579 0.023865 0.108417 0.091438 0.064390 0.108639 2.674316 0.923969 0.634343 0.020406 0.051067 0.071333 ntime & nrate & np: 16 4 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 14.609171 np = 22 lnL0 = -3176.203839 Iterating by ming2 Initial: fx= 3176.203839 x= 0.04094 0.01748 0.01307 0.00510 0.02763 0.03371 0.09241 0.02517 0.00963 0.08525 0.12358 0.02387 0.10842 0.09144 0.06439 0.10864 2.67432 0.92397 0.63434 0.02041 0.05107 0.07133 1 h-m-p 0.0000 0.0001 445.2327 +CYYCC 3171.461419 4 0.0000 56 | 0/22 2 h-m-p 0.0000 0.0000 1351.2485 +CCCC 3169.436188 3 0.0000 110 | 0/22 3 h-m-p 0.0000 0.0000 322.0109 ++ 3168.496053 m 0.0000 157 | 1/22 4 h-m-p 0.0000 0.0003 1594.5094 +CYCCC 3165.492914 4 0.0000 212 | 1/22 5 h-m-p 0.0002 0.0008 149.7944 ++ 3158.232128 m 0.0008 258 | 2/22 6 h-m-p 0.0003 0.0015 242.4614 YCCC 3157.275947 3 0.0002 309 | 2/22 7 h-m-p 0.0005 0.0023 60.2280 YCC 3157.110832 2 0.0002 357 | 2/22 8 h-m-p 0.0002 0.0044 48.3629 CYC 3156.994390 2 0.0003 405 | 2/22 9 h-m-p 0.0005 0.0039 23.5387 YC 3156.953094 1 0.0002 451 | 2/22 10 h-m-p 0.0004 0.0239 15.4344 YC 3156.907173 1 0.0007 497 | 2/22 11 h-m-p 0.0005 0.0168 21.9653 CC 3156.847751 1 0.0007 544 | 2/22 12 h-m-p 0.0002 0.0096 79.3892 +CC 3156.494578 1 0.0012 592 | 2/22 13 h-m-p 0.0004 0.0024 237.8584 CCCC 3155.830934 3 0.0007 643 | 2/22 14 h-m-p 0.0002 0.0010 572.7102 YYCC 3155.450440 3 0.0002 692 | 2/22 15 h-m-p 0.0011 0.0079 90.9116 CC 3155.327496 1 0.0004 739 | 2/22 16 h-m-p 0.0010 0.0049 17.1190 YC 3155.320031 1 0.0001 785 | 1/22 17 h-m-p 0.0001 0.0565 29.2683 CC 3155.303484 1 0.0000 832 | 1/22 18 h-m-p 0.0004 0.0666 3.0006 CC 3155.300452 1 0.0006 880 | 1/22 19 h-m-p 0.0009 0.4666 3.4456 ++YC 3155.171553 1 0.0258 929 | 1/22 20 h-m-p 0.0005 0.0151 168.5323 +YCCCC 3154.029509 4 0.0042 983 | 1/22 21 h-m-p 0.0027 0.0135 95.1619 YC 3153.966203 1 0.0005 1030 | 0/22 22 h-m-p 0.0002 0.0063 209.8364 CYC 3153.823789 2 0.0001 1079 | 0/22 23 h-m-p 0.0067 2.0151 1.8863 ++YCCC 3153.200219 3 0.2515 1133 | 0/22 24 h-m-p 0.1254 0.6270 1.3328 +YYCCC 3151.695111 4 0.4204 1187 | 0/22 25 h-m-p 0.2095 1.0473 0.5047 YYC 3151.344506 2 0.1700 1236 | 0/22 26 h-m-p 0.6950 6.8437 0.1234 CC 3151.072764 1 0.9390 1285 | 0/22 27 h-m-p 0.4596 8.0000 0.2522 +CCC 3150.884020 2 1.5653 1337 | 0/22 28 h-m-p 1.6000 8.0000 0.0526 YCCC 3150.680655 3 2.7490 1389 | 0/22 29 h-m-p 1.6000 8.0000 0.0799 YCCC 3150.457717 3 2.7121 1441 | 0/22 30 h-m-p 0.8006 4.0028 0.0977 +YCCC 3150.292509 3 2.1483 1494 | 0/22 31 h-m-p 0.1563 0.7816 0.3523 ++ 3150.061498 m 0.7816 1541 | 1/22 32 h-m-p 0.3647 3.0614 0.7548 -------------C 3150.061498 0 0.0000 1601 | 1/22 33 h-m-p 0.0073 3.6466 1.8548 ++CC 3149.996981 1 0.1616 1651 | 1/22 34 h-m-p 1.0043 8.0000 0.2985 YC 3149.922447 1 0.5303 1698 | 1/22 35 h-m-p 0.3781 7.2001 0.4186 CCC 3149.847473 2 0.4932 1748 | 1/22 36 h-m-p 1.6000 8.0000 0.0195 YC 3149.827027 1 3.1655 1795 | 1/22 37 h-m-p 1.6000 8.0000 0.0348 +CC 3149.758136 1 5.9782 1844 | 1/22 38 h-m-p 1.6000 8.0000 0.0665 CC 3149.736164 1 1.4074 1892 | 1/22 39 h-m-p 1.6000 8.0000 0.0287 CC 3149.728064 1 1.8390 1940 | 1/22 40 h-m-p 0.7722 8.0000 0.0684 CC 3149.724002 1 1.0711 1988 | 1/22 41 h-m-p 1.6000 8.0000 0.0195 C 3149.723694 0 0.5789 2034 | 1/22 42 h-m-p 1.6000 8.0000 0.0015 ---------Y 3149.723694 0 0.0000 2089 | 1/22 43 h-m-p 0.0002 0.1080 11.8716 ++YC 3149.718627 1 0.0025 2138 | 1/22 44 h-m-p 1.6000 8.0000 0.0073 ++ 3149.638582 m 8.0000 2184 | 1/22 45 h-m-p 0.0553 8.0000 1.0614 ++CCCCC 3148.617840 4 1.1833 2240 | 1/22 46 h-m-p 1.6000 8.0000 0.7430 YCCC 3148.040543 3 1.0689 2291 | 1/22 47 h-m-p 1.1580 8.0000 0.6858 YCCC 3147.304936 3 0.6313 2342 | 0/22 48 h-m-p 0.0002 0.0048 2725.7190 YCCC 3147.212339 3 0.0001 2393 | 0/22 49 h-m-p 0.2732 1.7054 0.9391 +YYCC 3146.670511 3 0.9447 2445 | 0/22 50 h-m-p 1.6000 8.0000 0.2388 YCCC 3146.432302 3 2.4060 2497 | 0/22 51 h-m-p 1.6000 8.0000 0.0779 CCC 3146.383133 2 1.3447 2548 | 0/22 52 h-m-p 0.9708 8.0000 0.1079 +YC 3146.352065 1 2.6387 2597 | 0/22 53 h-m-p 0.3003 1.5014 0.0890 ++ 3146.286949 m 1.5014 2644 | 1/22 54 h-m-p 0.2476 2.5225 0.5396 CC 3146.280483 1 0.0524 2693 | 1/22 55 h-m-p 0.3563 8.0000 0.0793 +CCC 3146.190353 2 1.7137 2744 | 1/22 56 h-m-p 1.4429 8.0000 0.0942 CC 3146.151897 1 1.6101 2792 | 1/22 57 h-m-p 1.6000 8.0000 0.0234 YC 3146.150691 1 0.9840 2839 | 1/22 58 h-m-p 1.6000 8.0000 0.0066 -----C 3146.150691 0 0.0004 2890 | 1/22 59 h-m-p 0.0160 8.0000 0.0002 +++++ 3146.150671 m 8.0000 2939 | 1/22 60 h-m-p 0.4298 8.0000 0.0044 +YC 3146.150423 1 3.2516 2987 | 1/22 61 h-m-p 1.6000 8.0000 0.0005 ++ 3146.147737 m 8.0000 3033 | 1/22 62 h-m-p 0.0282 8.0000 0.1490 +++YCC 3145.991842 2 1.3871 3085 | 1/22 63 h-m-p 1.2434 8.0000 0.1662 ++ 3145.566040 m 8.0000 3131 | 1/22 64 h-m-p 1.6000 8.0000 0.4225 CCC 3145.494044 2 1.3528 3181 | 1/22 65 h-m-p 1.6000 8.0000 0.2813 YC 3145.483705 1 1.0246 3228 | 1/22 66 h-m-p 1.6000 8.0000 0.0572 YC 3145.482840 1 1.2701 3275 | 1/22 67 h-m-p 1.6000 8.0000 0.0058 Y 3145.482798 0 1.0696 3321 | 1/22 68 h-m-p 1.6000 8.0000 0.0013 Y 3145.482796 0 1.1471 3367 | 1/22 69 h-m-p 1.6000 8.0000 0.0000 Y 3145.482796 0 1.1640 3413 | 1/22 70 h-m-p 1.6000 8.0000 0.0000 Y 3145.482796 0 0.4000 3459 | 1/22 71 h-m-p 0.6860 8.0000 0.0000 Y 3145.482796 0 0.6860 3505 | 1/22 72 h-m-p 0.5100 8.0000 0.0000 ---------------Y 3145.482796 0 0.0000 3566 Out.. lnL = -3145.482796 3567 lfun, 14268 eigenQcodon, 171216 P(t) Time used: 2:27 Model 7: beta TREE # 1 (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 0.040939 0.017480 0.013070 0.005100 0.027626 0.033706 0.092413 0.025167 0.009632 0.085251 0.123579 0.023865 0.108417 0.091438 0.064390 0.108639 2.652737 1.091300 1.180709 ntime & nrate & np: 16 1 19 Bounds (np=19): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 6.356859 np = 19 lnL0 = -3342.216612 Iterating by ming2 Initial: fx= 3342.216612 x= 0.04094 0.01748 0.01307 0.00510 0.02763 0.03371 0.09241 0.02517 0.00963 0.08525 0.12358 0.02387 0.10842 0.09144 0.06439 0.10864 2.65274 1.09130 1.18071 1 h-m-p 0.0000 0.0001 500.6453 +CYCCC 3336.574043 4 0.0001 52 | 0/19 2 h-m-p 0.0000 0.0061 646.8784 CCYC 3335.831365 3 0.0000 98 | 0/19 3 h-m-p 0.0000 0.0006 203.6444 +YCYCCC 3329.744418 5 0.0004 148 | 0/19 4 h-m-p 0.0000 0.0001 981.1647 +YCCCC 3325.743560 4 0.0001 197 | 0/19 5 h-m-p 0.0001 0.0009 674.5833 +YCCYCCC 3278.926613 6 0.0008 250 | 0/19 6 h-m-p 0.0000 0.0000 27832.8396 ++ 3265.676618 m 0.0000 291 | 0/19 7 h-m-p 0.0000 0.0000 15381.7722 h-m-p: 1.21525155e-21 6.07625774e-21 1.53817722e+04 3265.676618 .. | 0/19 8 h-m-p 0.0000 0.0001 1563.4298 +CCCCC 3240.315511 4 0.0000 379 | 0/19 9 h-m-p 0.0001 0.0005 363.2310 +YCCC 3232.585743 3 0.0003 426 | 0/19 10 h-m-p 0.0001 0.0007 618.9385 +YCYCCC 3198.051781 5 0.0004 476 | 0/19 11 h-m-p 0.0000 0.0002 951.6881 +YCYCCC 3179.238134 5 0.0001 526 | 0/19 12 h-m-p 0.0001 0.0003 486.5628 CYCCCC 3175.540406 5 0.0001 576 | 0/19 13 h-m-p 0.0006 0.0031 41.9262 CCC 3175.378188 2 0.0002 621 | 0/19 14 h-m-p 0.0004 0.0079 19.7402 CC 3175.290657 1 0.0005 664 | 0/19 15 h-m-p 0.0002 0.0105 52.3567 +YCC 3175.031066 2 0.0006 709 | 0/19 16 h-m-p 0.0002 0.0022 165.7803 +YCCCCC 3173.709355 5 0.0009 760 | 0/19 17 h-m-p 0.0001 0.0050 1423.3010 +YCCCC 3165.085030 4 0.0008 809 | 0/19 18 h-m-p 0.0003 0.0017 366.0594 YCC 3164.383081 2 0.0002 853 | 0/19 19 h-m-p 0.0002 0.0011 114.9991 YCC 3164.268133 2 0.0001 897 | 0/19 20 h-m-p 0.0005 0.0050 33.4071 YC 3164.229891 1 0.0002 939 | 0/19 21 h-m-p 0.0007 0.0127 8.9319 YC 3164.216385 1 0.0004 981 | 0/19 22 h-m-p 0.0014 0.1840 2.2458 +CCC 3164.149481 2 0.0049 1027 | 0/19 23 h-m-p 0.0004 0.0182 25.2819 +YCCC 3163.383757 3 0.0039 1074 | 0/19 24 h-m-p 0.0003 0.0017 364.8410 +YYCCCC 3159.729164 5 0.0011 1124 | 0/19 25 h-m-p 0.0001 0.0006 286.4983 YCCCC 3159.192635 4 0.0002 1172 | 0/19 26 h-m-p 0.0011 0.0054 20.2280 CY 3159.158643 1 0.0003 1215 | 0/19 27 h-m-p 0.0018 0.0818 2.9448 ++CYCCC 3158.681997 4 0.0413 1265 | 0/19 28 h-m-p 0.1132 1.6560 1.0732 +YYYC 3155.866780 3 0.4388 1310 | 0/19 29 h-m-p 0.9344 4.6720 0.2589 CC 3155.316364 1 1.1380 1353 | 0/19 30 h-m-p 0.4995 3.4631 0.5899 CYCCC 3154.795642 4 0.8414 1401 | 0/19 31 h-m-p 1.1430 5.7152 0.3981 YCYYCCC 3153.012593 6 3.1397 1452 | 0/19 32 h-m-p 0.2429 1.2143 0.8459 YYYYC 3152.777256 4 0.2431 1497 | 0/19 33 h-m-p 0.7405 5.8315 0.2777 YCCC 3152.314846 3 0.5439 1543 | 0/19 34 h-m-p 0.8178 4.4464 0.1847 YCC 3152.236064 2 0.5643 1587 | 0/19 35 h-m-p 1.6000 8.0000 0.0113 YC 3152.201477 1 0.8831 1629 | 0/19 36 h-m-p 1.0070 8.0000 0.0100 CC 3152.191761 1 0.9504 1672 | 0/19 37 h-m-p 1.6000 8.0000 0.0038 YC 3152.189554 1 1.1196 1714 | 0/19 38 h-m-p 1.2626 8.0000 0.0034 C 3152.189251 0 1.1526 1755 | 0/19 39 h-m-p 1.6000 8.0000 0.0009 C 3152.189219 0 1.4217 1796 | 0/19 40 h-m-p 1.6000 8.0000 0.0001 C 3152.189208 0 1.3838 1837 | 0/19 41 h-m-p 0.5199 8.0000 0.0003 Y 3152.189208 0 0.9032 1878 | 0/19 42 h-m-p 1.6000 8.0000 0.0000 Y 3152.189208 0 1.0743 1919 | 0/19 43 h-m-p 1.6000 8.0000 0.0000 C 3152.189208 0 0.5260 1960 | 0/19 44 h-m-p 1.0816 8.0000 0.0000 C 3152.189208 0 0.2704 2001 | 0/19 45 h-m-p 0.4135 8.0000 0.0000 ----------Y 3152.189208 0 0.0000 2052 Out.. lnL = -3152.189208 2053 lfun, 22583 eigenQcodon, 328480 P(t) Time used: 4:41 Model 8: beta&w>1 TREE # 1 (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 initial w for M8:NSbetaw>1 reset. 0.040939 0.017480 0.013070 0.005100 0.027626 0.033706 0.092413 0.025167 0.009632 0.085251 0.123579 0.023865 0.108417 0.091438 0.064390 0.108639 2.629720 0.900000 0.318342 1.765725 2.851152 ntime & nrate & np: 16 2 21 Bounds (np=21): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.930902 np = 21 lnL0 = -3258.333752 Iterating by ming2 Initial: fx= 3258.333752 x= 0.04094 0.01748 0.01307 0.00510 0.02763 0.03371 0.09241 0.02517 0.00963 0.08525 0.12358 0.02387 0.10842 0.09144 0.06439 0.10864 2.62972 0.90000 0.31834 1.76572 2.85115 1 h-m-p 0.0000 0.0001 1072.9232 ++ 3195.325586 m 0.0001 47 | 0/21 2 h-m-p 0.0000 0.0002 738.6884 CYCCC 3194.436907 4 0.0000 99 | 0/21 3 h-m-p 0.0000 0.0001 312.1779 +CYCCC 3191.696601 4 0.0000 152 | 0/21 4 h-m-p 0.0000 0.0001 1063.5522 +YCYYCCC 3180.805123 6 0.0001 208 | 0/21 5 h-m-p 0.0000 0.0002 903.0056 YCYCCC 3170.883232 5 0.0001 261 | 0/21 6 h-m-p 0.0000 0.0002 600.7805 CYCCC 3167.057520 4 0.0001 313 | 0/21 7 h-m-p 0.0002 0.0010 90.8980 YC 3166.647491 1 0.0001 359 | 0/21 8 h-m-p 0.0003 0.0059 33.7377 CCC 3166.387014 2 0.0005 408 | 0/21 9 h-m-p 0.0007 0.0035 22.5549 CCC 3166.328967 2 0.0003 457 | 0/21 10 h-m-p 0.0003 0.0095 18.1424 +CCCC 3166.072869 3 0.0019 509 | 0/21 11 h-m-p 0.0003 0.0140 100.7321 +YCCC 3163.831225 3 0.0032 560 | 0/21 12 h-m-p 0.0004 0.0020 814.4243 CCCC 3159.979215 3 0.0007 611 | 0/21 13 h-m-p 0.0004 0.0019 913.7872 CCCCC 3156.573984 4 0.0005 664 | 0/21 14 h-m-p 0.0006 0.0032 181.0741 YCCC 3156.046636 3 0.0004 714 | 0/21 15 h-m-p 0.0028 0.0141 19.0230 CCC 3155.976997 2 0.0006 763 | 0/21 16 h-m-p 0.0014 0.0432 8.1998 +YCC 3155.743543 2 0.0044 812 | 0/21 17 h-m-p 0.0004 0.0094 81.2975 ++YCYCCC 3152.285815 5 0.0054 867 | 0/21 18 h-m-p 0.0003 0.0017 250.7517 CC 3151.724644 1 0.0003 914 | 0/21 19 h-m-p 0.0029 0.0144 7.5798 YC 3151.711800 1 0.0004 960 | 0/21 20 h-m-p 0.0033 1.6341 2.0035 +++CCC 3150.383903 2 0.2140 1012 | 0/21 21 h-m-p 0.0006 0.0035 685.0412 CCCC 3148.656067 3 0.0008 1063 | 0/21 22 h-m-p 0.1079 0.5442 5.0603 CCC 3147.213260 2 0.1267 1112 | 0/21 23 h-m-p 0.5777 4.4807 1.1099 CYCC 3146.354966 3 0.7407 1162 | 0/21 24 h-m-p 1.5444 8.0000 0.5323 CC 3145.948222 1 1.5569 1209 | 0/21 25 h-m-p 1.6000 8.0000 0.4318 YC 3145.805076 1 1.1294 1255 | 0/21 26 h-m-p 1.6000 8.0000 0.2746 YCC 3145.753557 2 1.0649 1303 | 0/21 27 h-m-p 1.3174 8.0000 0.2220 CC 3145.710417 1 1.8189 1350 | 0/21 28 h-m-p 1.6000 8.0000 0.1680 YC 3145.638816 1 3.7564 1396 | 0/21 29 h-m-p 1.6000 8.0000 0.2356 YYYYC 3145.576504 4 1.6023 1445 | 0/21 30 h-m-p 0.8838 8.0000 0.4272 CCC 3145.545208 2 1.1080 1494 | 0/21 31 h-m-p 1.6000 8.0000 0.0331 YC 3145.543069 1 0.7941 1540 | 0/21 32 h-m-p 1.6000 8.0000 0.0082 YC 3145.542942 1 0.8450 1586 | 0/21 33 h-m-p 1.6000 8.0000 0.0025 Y 3145.542934 0 1.1901 1631 | 0/21 34 h-m-p 1.6000 8.0000 0.0004 +Y 3145.542923 0 4.4687 1677 | 0/21 35 h-m-p 0.4903 8.0000 0.0036 +Y 3145.542891 0 3.8830 1723 | 0/21 36 h-m-p 1.6000 8.0000 0.0013 Y 3145.542888 0 0.9535 1768 | 0/21 37 h-m-p 1.6000 8.0000 0.0005 Y 3145.542888 0 0.8481 1813 | 0/21 38 h-m-p 1.6000 8.0000 0.0000 Y 3145.542888 0 0.8865 1858 | 0/21 39 h-m-p 1.6000 8.0000 0.0000 C 3145.542888 0 0.4000 1903 | 0/21 40 h-m-p 0.1721 8.0000 0.0000 ---------------.. | 0/21 41 h-m-p 0.0160 8.0000 0.0011 ------------- Out.. lnL = -3145.542888 2018 lfun, 24216 eigenQcodon, 355168 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -3185.995516 S = -3088.635396 -90.079749 Calculating f(w|X), posterior probabilities of site classes. did 10 / 213 patterns 7:04 did 20 / 213 patterns 7:05 did 30 / 213 patterns 7:05 did 40 / 213 patterns 7:05 did 50 / 213 patterns 7:05 did 60 / 213 patterns 7:05 did 70 / 213 patterns 7:05 did 80 / 213 patterns 7:06 did 90 / 213 patterns 7:06 did 100 / 213 patterns 7:06 did 110 / 213 patterns 7:06 did 120 / 213 patterns 7:06 did 130 / 213 patterns 7:07 did 140 / 213 patterns 7:07 did 150 / 213 patterns 7:07 did 160 / 213 patterns 7:07 did 170 / 213 patterns 7:07 did 180 / 213 patterns 7:07 did 190 / 213 patterns 7:08 did 200 / 213 patterns 7:08 did 210 / 213 patterns 7:08 did 213 / 213 patterns 7:08 Time used: 7:08 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=10, Len=425 D_melanogaster_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- D_sechellia_bves-PC MPSTAG-SAAGVWMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- D_simulans_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- D_yakuba_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAGAP---- D_takahashii_bves-PC MPSTAGSSAAGVGMGALINSAGSSASSVMGIGLGGAAAAAGASGGS---- D_suzukii_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAPGAPG------- D_eugracilis_bves-PC MPSTAG-SAAGVGMGALINNAGSSASSVMGIGLGRAAATGAGAGAP---- D_ficusphila_bves-PC MPSTAG-SAAGVGMGALINSAGSSASGAMGIGLGGAAAAGAAGAAAGPGA D_rhopaloa_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAVS----------- D_elegans_bves-PC MPSTTG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAAG---------- ****:* ***** ******.******..****:* **.. D_melanogaster_bves-PC -GSSGSGADASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI D_sechellia_bves-PC -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI D_simulans_bves-PC -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI D_yakuba_bves-PC -GSSGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI D_takahashii_bves-PC -PGSGGGDASAAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI D_suzukii_bves-PC -SASGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI D_eugracilis_bves-PC -GAASAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI D_ficusphila_bves-PC GAAVSGGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI D_rhopaloa_bves-PC ----GSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI D_elegans_bves-PC -TGAGAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI ..* ::*. *****************:.***************** D_melanogaster_bves-PC EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM D_sechellia_bves-PC EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM D_simulans_bves-PC EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM D_yakuba_bves-PC EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM D_takahashii_bves-PC EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM D_suzukii_bves-PC EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM D_eugracilis_bves-PC EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM D_ficusphila_bves-PC EQCLGWQQPHPLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM D_rhopaloa_bves-PC EQCFGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRATLLIGCLMMGM D_elegans_bves-PC EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM **.:* ** **********************:***** ********** D_melanogaster_bves-PC HGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF D_sechellia_bves-PC HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF D_simulans_bves-PC HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF D_yakuba_bves-PC HGYLVARAPDVMLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF D_takahashii_bves-PC HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF D_suzukii_bves-PC HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF D_eugracilis_bves-PC HGYLVACAPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF D_ficusphila_bves-PC HGYLVACTPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF D_rhopaloa_bves-PC HGYLVACTPDLVLWSSMGLFVNFVYLVVVLCRLRPVIFEQEIEAVYLALF D_elegans_bves-PC HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF ****** : *::***.*******:************ ************* D_melanogaster_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_sechellia_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_simulans_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_yakuba_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_takahashii_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_suzukii_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_eugracilis_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_ficusphila_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_rhopaloa_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV D_elegans_bves-PC QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV ************************************************** D_melanogaster_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_sechellia_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_simulans_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_yakuba_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_takahashii_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_suzukii_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_eugracilis_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_ficusphila_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_rhopaloa_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL D_elegans_bves-PC SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL ************************************************** D_melanogaster_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_sechellia_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_simulans_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_yakuba_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_takahashii_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_suzukii_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_eugracilis_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_ficusphila_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_rhopaloa_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED D_elegans_bves-PC KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED ************************************************** D_melanogaster_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_sechellia_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_simulans_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_yakuba_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_takahashii_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_suzukii_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_eugracilis_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_ficusphila_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_rhopaloa_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR D_elegans_bves-PC AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR ************************************************** D_melanogaster_bves-PC IDETDHETAVooooooooo------ D_sechellia_bves-PC IDETDHETAVoooooooooo----- D_simulans_bves-PC IDETDHETAVoooooooooo----- D_yakuba_bves-PC IDETDHETAVoooooooo------- D_takahashii_bves-PC IDETDHETAVoooo----------- D_suzukii_bves-PC IDETDHETAVoooooooo------- D_eugracilis_bves-PC IDETDHETAVoooooooo------- D_ficusphila_bves-PC IDETDHETAV--------------- D_rhopaloa_bves-PC IDETDHETAVooooooooooooooo D_elegans_bves-PC IDETDHETAVooooooooooo---- **********
>D_melanogaster_bves-PC ATGCCCAGCACGGCGGGC---AGTGCAGCTGGCGTTGGTATGGGCGCCCT GATCAACAGTGCCGGCAGCAGCGCCAGTAGTGTCATGGGCATTGGCATGG GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ ---GGCAGTTCGGGATCTGGAGCAGATGCCTCCGCCGCCGGCACTTTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGTGGAACGATCACCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGATTGGTCCATC GAACAGTGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCACACGGTCCCTACGGCG CCCTGTGGATGCGTGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCTTTGCACCGGACGTCATCCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTATGCCGGCTGA GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTCTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCAGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAATTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTGGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTAAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGAGATCCGAATTCTTGGCGCCTTGGAAGG ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- ------------------------- >D_sechellia_bves-PC ATGCCCAGCACGGCGGGC---AGTGCAGCTGGCGTTTGGATGGGCGCCCT GATCAACAGTGCCGGCAGCAGCGCCAGTAGCGTCATGGGCATCGGCATGG GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ ---GGCAGCTCGGGATCTGGAGCAGAGGCCTCCGCTGGC---ACTTTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACCATGCCCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGAGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCCCACGGTCCCTACGGTG CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCTTTGCAAAGGACGTCATCCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACACGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTGGGCCGGGATGTGGTCAAGAAGCTAATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGGGATCCGAATTCTTGGCGCCTTGGAAGG ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- ------------------------- >D_simulans_bves-PC ATGCCCAGCACGGCGGGC---AGTGCGGCGGGCGTTGGGATGGGCGCCCT GATCAACAGTGCCGGCAGCAGCGCCAGTAGCGTCATGGGCATCGGCATGG GCAGAGCAGCTGCTACG------GGAGCAGGAGCACCA------------ ---GGCAGTTCGGGATCTGGAGCAGAGGCCTCCGCCGGC---ACTTTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACCATGCCCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGAGCCTCGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTAGCCTTTTTGGCTCCCCACGGTCCCTACGGCG CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCTTTGCAAAGGACGTCATCCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA GGCCTGTGCGATTCGAGCAGGAAATCGAAGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAACTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTGGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGGGATCCGAATTCTTGGCGCCTTGGAAGG ATCGATGAAACGGATCACGAAACGGCCGTT-------------------- ------------------------- >D_yakuba_bves-PC ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCCCT GATCAACAGCGCCGGCAGCAGCGCCAGTAGTGTCATGGGCATCGGCATGG GCAGAGCAGCGGCTACGGGGGCAGGAGCAGGAGCACCG------------ ---GGTAGTTCGGGATCTGGAGCAGAGGCATCTGCCGGC---ACACTAAT CGCGCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGAACGATCACCT GGGACAACAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTTGGG---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTAGCCTTTTTGGCTCCACACGGTCCCTACGGAT CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CATGGCTACTTGGTGGCCCGTGCACCGGACGTCATGCTGTGGTCGGGCAT GGGACTTTTTGTCAACTTCATCTATCTCGTCGTGGTGCTGTGCCGGCTGA GGCCTGTGAGATTCGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAGTACCAGGAGGTCTACGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGCGGCAAATTGGTGGTG TCGCAGCATCAGCGCGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGCGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AGTCGATAGCCAGCAATGGCTTCCTGCCCTCTGGTGGATATGCTGAGGAT GCGGAGGACAAGCCCATGCTGATACTCAAGAAGAGTGTGGATGTGGGACA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCTAGGATAT CGAAGTATTACGATTGCGCTGGGGATCCGAACTCTTGGCGCCTTGGGAGG ATCGATGAAACGGATCATGAAACGGCCGTT-------------------- ------------------------- >D_takahashii_bves-PC ATGCCCAGCACGGCGGGCAGTAGTGCAGCGGGCGTTGGGATGGGCGCTCT GATCAATAGTGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATTGGCCTGG GCGGAGCAGCTGCAGCAGCGGGAGCATCAGGAGGATCA------------ ---CCTGGATCTGGAGGAGGAGATGCCTCCGCTGCTGGC---ACCCTAAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGCACGATCACCT GGGACAACAACGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGTTGGCAGCAGCCGCATCACCTCTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCTTGGCCCCGCACGGCCCCTACGGAT CCCTCTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTGGCCTGTACACCGGATGTTGTCCTCTGGTCGGGCAT GGGACTCTTCGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGCCGACTGA GACCCGTGAGATTCGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTC CAGCCGCTGCACGTGACTCGCCATCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGCGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTGGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAATCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTTTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCATCGGGAGGATATGCGGAGGAT GCGGAGGATAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTGCAGGCCCTGCCCAGGATAT CGAAGTATTATGACTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGGAGG ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- ------------------------- >D_suzukii_bves-PC ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCTCT GATCAATAGTGCCGGCAGCAGCGCCAGCAGCGTCATGGGCATCGGTCTGG GCGGAGCAGCTGCACCAGGAGCTCCTGGC--------------------- ---TCCGCCTCCGGATCTGGGGCAGAGGCCTCCGCTGGC---ACTTTGAT AGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGTACGATCACCT GGGACAACAACGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGATGGCAGCAGCCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCCCCCCACGGCCCCTACGGCT CGCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTGGCCTGCACGCCGGACGTGGTCCTATGGTCCGGCAT GGGACTGTTTGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGCCGCCTGA GACCCGTGAGATTCGAGCAGGAAATCGAGGCGGTTTACCTGGCACTTTTC CAGCCCCTGCACGTGACTCGCCATCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TTACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTAGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCCTCGGGTGGCTATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTAAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTATTATGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGA ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- ------------------------- >D_eugracilis_bves-PC ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGAGCTCT AATCAATAATGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATCGGCCTGG GAAGAGCAGCTGCCACGGGAGCAGGAGCTGGGGCACCA------------ ---GGGGCAGCTAGTGCTGGAGCAGAGGCTTCTGCTGGC---ACTCTAAT TGCCCAGAGCACGGCAGGAACGAGCGCGGCCAGCAGCGGTACGATCACCT GGGACAATAATGGAACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGA---------CCACATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCTTTTTTGGCCCCCCATGGTCCCTACGGAG CCCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTAATGATGGGCATG CACGGCTATCTGGTGGCCTGTGCACCGGATGTGGTCTTGTGGTCCGGCAT GGGACTCTTCGTCAACTTCATCTATCTCGTCGTGGTGCTATGCCGGCTGA GGCCCGTCAGATTCGAGCAGGAAATCGAGGCGGTGTATCTGGCACTTTTC CAGCCGCTGCACGTGACTCGCCACCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGTGCATTGAAGTACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGTTGAGTGGCAAGTTGGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TCATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCACCGCGACAAGCTC AAACTGTCAATTATGGCCGAGCCTTTCTTGCAGACCGTCTTCGATCACAT TCTCGGTCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCTTCGGGAGGATATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGACGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTATTACGACTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGG ATCGACGAGACGGACCACGAAACGGCCGTT-------------------- ------------------------- >D_ficusphila_bves-PC ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGAATGGGCGCTCT AATCAATAGTGCCGGCAGCAGTGCCAGTGGTGCCATGGGCATCGGCCTGG GTGGAGCAGCGGCGGCCGGAGCAGCAGGAGCAGCAGCTGGACCAGGTGCT GGAGCGGCTGTCTCCGGTGGAGCAGAGGCCTCCGCCGGT---ACCTTGAT CGCCCAGAGCACGGCGGGAACGAGCGCCGCCAGCAGCGGTACGATCACCT GGGACAACAACGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGTTGGCAGCAGCCGCATCCGCTCTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCGCCCCACGGTCCGTACGGAT CGCTCTGGATGCGGGCCATGCTGCTCATCGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTGGCCTGCACACCGGACGTGGTCCTCTGGTCCGGAAT GGGACTGTTCGTCAACTTCATCTATCTCGTCGTGGTGCTCTGCCGGCTGA GACCCGTGCGATTCGAGCAGGAAATCGAGGCGGTTTACCTGGCACTTTTC CAGCCGCTGCACGTGACGCGCCATCAGTTCAAAAAGGTGCTCAACTGCAT GAAGGTGATACGCGCCCTGAAATACCAGGAAGTCTATGCCCAGGAGAAGG TCACCAAGGTGGACAGCCTCTCGTTGGTGCTGAGTGGCAAATTGGTGGTG TCGCAGCATCAGCGAGCGCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAATGGTTTGGCGTCTCGACCGACGACTACTTTCAGGTCTCCA TTATGGCCATGGAGGAGTCGCGAGTGCTGATCTGGCATCGCGACAAGCTC AAATTGTCAATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTCCTGCCATCGGGAGGATATGCTGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGAAGG ATCGACGAAACGGACCACGAAACGGCGGTT-------------------- ------------------------- >D_rhopaloa_bves-PC ATGCCCAGCACGGCGGGC---AGTGCAGCGGGCGTTGGGATGGGCGCTCT GATCAACAGTGCCGGTAGTAGTGCCAGTAGTGTCATGGGCATCGGACTAG GCGGAGCAGCTGTATCT--------------------------------- ------------GGATCTGGAGCAGAGGCCTCCGCCGGC---ACCTTGAT TGCCCAGAGCACGGCGGGTACGAGTGCCGCCAGCAGCGGTACGATCACCT GGGACAACAATGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCTTCGGATGGCAGCAGCCGCATCACCTGTACTTTCAGCTCGG CTGGGCCTTCCTCTTCCTGGCCTTCCTGGCCCCCCACGGTCCCTACGGAT CGCTGTGGATGCGGGCCACGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTATCTGGTCGCCTGCACCCCGGACTTAGTTTTGTGGTCGAGCAT GGGCCTGTTCGTCAACTTTGTCTATCTCGTCGTGGTGCTGTGCCGGCTGA GACCCGTGATATTTGAGCAGGAAATCGAGGCGGTGTACCTGGCACTTTTT CAGCCGCTGCACGTGACTCGTCATCAGTTCAAGAAGGTGCTCAACTGCAT GAAGGTGATACGCGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAATTGGTGGTG TCCCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA CTCGCCGGAGTGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TTATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAACTGTCTATTATGGCCGAGCCCTTCTTGCAAACCGTCTTCGATCACAT TCTCGGCCGAGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGTAATGGCTTTTTGCCCTCGGGAGGATATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTGAAGAAGAGTGTGGATGTGGGTCA CGGACTGACGGCCTTGATCAACCGGCAGTTACAGGCCCTGCCCAGGATAT CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGGAGG ATCGATGAGACGGACCATGAAACGGCCGTT-------------------- ------------------------- >D_elegans_bves-PC ATGCCAAGCACGACGGGC---AGTGCAGCAGGCGTTGGAATGGGAGCTTT GATCAATAGTGCCGGCAGTAGCGCCAGCAGTGTCATGGGCATTGGACTGG GCGGAGCAGCCGCAGCAGGA------------------------------ ---ACTGGAGCTGGAGCTGGAGCAGAGGCCTCAGCCGGC---ACCTTAAT CGCACAGAGCACGGCGGGAACAAGCGCCGCCAGCAGCGGTACCATCACTT GGGACAACAATGGCACCCTGCGATCGATCAATCCCGGCGACTGGTCCATC GAACAGTGCCTCGGTTGGCAGCAGCCGCATCACCTGTACTTTCAGCTCGG CTGGGCCTTTCTCTTCCTGGCCTTCCTGGCGCCCCATGGTCCCTACGGAT CGCTGTGGATGCGGGCCATGCTGCTCATTGGCTGCCTGATGATGGGCATG CACGGCTACCTGGTCGCCTGCACGCCGGATGTGGTCCTATGGTCGGGCAT GGGCCTCTTTGTCAACTTCGTCTATCTCGTCGTGGTGCTGTGTCGGCTGA GACCCGTGAGATTTGAGCAAGAAATCGAGGCGGTGTACCTGGCACTTTTT CAGCCGCTGCACGTGACTCGCCACCAGTTCAAAAAGGTGCTCAACTGCAT GAAGGTGATACGTGCCCTGAAATACCAGGAGGTCTATGCCCAGGAGAAGG TCACCAAGGTCGACAGCCTGTCGCTGGTGCTGAGTGGCAAACTGGTGGTG TCGCAGCATCAGCGAGCCCTGCACATTGTGTTTCCCCATCAGTTCCTAGA TTCGCCCGAGTGGTTTGGCGTCTCGACCGATGACTACTTTCAGGTCTCCA TTATGGCCATGGAGGAGTCGCGGGTGCTGATCTGGCATCGCGACAAGCTC AAGCTGTCTATTATGGCCGAGCCCTTCTTGCAGACCGTCTTCGATCACAT TCTCGGCCGGGATGTGGTCAAGAAGCTGATGCAGGTCACCCAGGTGAGCG AATCGATAGCCAGCAATGGCTTTCTGCCATCGGGAGGATATGCGGAGGAT GCGGAGGACAAGCCCATGTTGATACTCAAGAAGAGTGTGGATGTGGGCCA CGGACTGACGGCCCTGATCAACCGGCAGCTACAGGCCCTGCCCAGGATAT CGAAGTACTACGATTGCGCTGGGGATCCTAACTCTTGGCGCCTTGGACGG ATCGATGAAACGGACCATGAAACGGCCGTT-------------------- -------------------------
>D_melanogaster_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGADASAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_sechellia_bves-PC MPSTAG-SAAGVWMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_simulans_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAAT--GAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTMPWDNNGTLRSINPGDWSI EQSLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVAFAKDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_yakuba_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGMGRAAATGAGAGAP---- -GSSGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVARAPDVMLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_takahashii_bves-PC MPSTAGSSAAGVGMGALINSAGSSASSVMGIGLGGAAAAAGASGGS---- -PGSGGGDASAAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_suzukii_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAPGAPG------- -SASGSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_eugracilis_bves-PC MPSTAG-SAAGVGMGALINNAGSSASSVMGIGLGRAAATGAGAGAP---- -GAASAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLG---PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGM HGYLVACAPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_ficusphila_bves-PC MPSTAG-SAAGVGMGALINSAGSSASGAMGIGLGGAAAAGAAGAAAGPGA GAAVSGGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHPLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_rhopaloa_bves-PC MPSTAG-SAAGVGMGALINSAGSSASSVMGIGLGGAAVS----------- ----GSGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCFGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRATLLIGCLMMGM HGYLVACTPDLVLWSSMGLFVNFVYLVVVLCRLRPVIFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV >D_elegans_bves-PC MPSTTG-SAAGVGMGALINSAGSSASSVMGIGLGGAAAAG---------- -TGAGAGAEASAG-TLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSI EQCLGWQQPHHLYFQLGWAFLFLAFLAPHGPYGSLWMRAMLLIGCLMMGM HGYLVACTPDVVLWSGMGLFVNFVYLVVVLCRLRPVRFEQEIEAVYLALF QPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVV SQHQRALHIVFPHQFLDSPEWFGVSTDDYFQVSIMAMEESRVLIWHRDKL KLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGFLPSGGYAED AEDKPMLILKKSVDVGHGLTALINRQLQALPRISKYYDCAGDPNSWRLGR IDETDHETAV
#NEXUS [ID: 3345153777] begin taxa; dimensions ntax=10; taxlabels D_melanogaster_bves-PC D_sechellia_bves-PC D_simulans_bves-PC D_yakuba_bves-PC D_takahashii_bves-PC D_suzukii_bves-PC D_eugracilis_bves-PC D_ficusphila_bves-PC D_rhopaloa_bves-PC D_elegans_bves-PC ; end; begin trees; translate 1 D_melanogaster_bves-PC, 2 D_sechellia_bves-PC, 3 D_simulans_bves-PC, 4 D_yakuba_bves-PC, 5 D_takahashii_bves-PC, 6 D_suzukii_bves-PC, 7 D_eugracilis_bves-PC, 8 D_ficusphila_bves-PC, 9 D_rhopaloa_bves-PC, 10 D_elegans_bves-PC ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.0218153,(2:0.009758378,3:0.002491815)1.000:0.01251461,(4:0.02179215,(((5:0.06144464,8:0.1079759,(9:0.07410894,10:0.06030667)0.973:0.01942387)0.527:0.01015839,6:0.05807658)0.999:0.02820541,7:0.06971089)1.000:0.07554529)1.000:0.01604218); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.0218153,(2:0.009758378,3:0.002491815):0.01251461,(4:0.02179215,(((5:0.06144464,8:0.1079759,(9:0.07410894,10:0.06030667):0.01942387):0.01015839,6:0.05807658):0.02820541,7:0.06971089):0.07554529):0.01604218); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -3589.00 -3604.33 2 -3589.37 -3603.03 -------------------------------------- TOTAL -3589.17 -3603.88 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/28/bves-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.675052 0.004334 0.552135 0.802740 0.671698 1354.52 1359.99 1.000 r(A<->C){all} 0.112940 0.000464 0.072316 0.154826 0.111657 995.06 1073.48 1.001 r(A<->G){all} 0.179747 0.000717 0.129183 0.233310 0.178346 971.34 1078.29 1.001 r(A<->T){all} 0.097148 0.000641 0.050112 0.146419 0.095696 983.42 1041.88 1.000 r(C<->G){all} 0.070068 0.000180 0.046538 0.099339 0.069039 1060.33 1061.85 1.000 r(C<->T){all} 0.464476 0.001644 0.381273 0.539274 0.463907 835.55 984.52 1.000 r(G<->T){all} 0.075621 0.000287 0.041718 0.107464 0.074870 1165.38 1265.16 1.000 pi(A){all} 0.191600 0.000118 0.171233 0.213889 0.191556 923.43 1082.53 1.001 pi(C){all} 0.289599 0.000148 0.266747 0.313910 0.289428 1302.74 1344.46 1.001 pi(G){all} 0.315142 0.000161 0.290962 0.341013 0.314891 1227.06 1230.30 1.000 pi(T){all} 0.203659 0.000112 0.182682 0.223672 0.203115 1140.31 1226.56 1.003 alpha{1,2} 0.157315 0.000527 0.116654 0.206415 0.154884 1423.01 1462.00 1.000 alpha{3} 2.649032 0.652979 1.338836 4.389093 2.553274 1371.29 1394.43 1.000 pinvar{all} 0.505950 0.001624 0.424004 0.580642 0.507757 1314.06 1394.14 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/28/bves-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 10 ls = 390 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 8 8 8 6 4 5 | Ser TCT 3 3 3 4 1 2 | Tyr TAT 3 3 3 3 6 6 | Cys TGT 0 0 0 0 1 0 TTC 9 9 9 10 12 11 | TCC 3 3 3 3 4 4 | TAC 8 8 8 8 5 5 | TGC 5 4 4 5 5 6 Leu TTA 1 1 1 0 0 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 4 4 4 4 3 | TCG 9 9 9 9 10 10 | TAG 0 0 0 0 0 0 | Trp TGG 8 9 8 8 8 8 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 3 3 3 4 2 2 | Pro CCT 2 2 2 2 1 1 | His CAT 5 5 5 6 6 6 | Arg CGT 2 1 1 2 0 1 CTC 7 8 8 8 13 8 | CCC 7 9 9 7 8 11 | CAC 8 8 8 7 7 7 | CGC 4 5 5 5 4 4 CTA 5 4 3 4 2 4 | CCA 3 1 1 2 1 2 | Gln CAA 0 0 0 0 0 0 | CGA 2 2 2 1 3 2 CTG 23 24 25 24 24 27 | CCG 3 3 3 4 5 2 | CAG 17 17 17 17 17 17 | CGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 4 4 4 5 4 | Thr ACT 1 1 1 0 1 2 | Asn AAT 4 4 4 3 3 3 | Ser AGT 6 4 4 4 6 4 ATC 12 12 12 12 10 10 | ACC 6 6 6 6 7 6 | AAC 5 5 5 6 6 6 | AGC 10 13 13 12 10 12 ATA 4 4 4 4 4 5 | ACA 0 1 0 1 1 0 | Lys AAA 2 2 2 2 3 3 | Arg AGA 1 1 1 2 2 3 Met ATG 16 17 17 17 15 15 | ACG 9 7 8 9 7 8 | AAG 13 14 14 13 12 12 | AGG 3 3 3 3 2 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 4 4 | Ala GCT 6 7 5 4 5 4 | Asp GAT 11 9 9 9 10 8 | Gly GGT 3 3 2 2 1 3 GTC 13 12 12 12 12 12 | GCC 23 21 22 19 20 20 | GAC 7 8 8 8 8 9 | GGC 18 18 19 18 22 21 GTA 0 0 0 0 0 0 | GCA 5 5 4 6 5 5 | Glu GAA 6 6 6 5 6 5 | GGA 11 10 10 10 10 8 GTG 16 17 17 17 17 17 | GCG 4 4 6 7 6 6 | GAG 9 10 10 11 9 11 | GGG 1 2 3 4 3 3 -------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------ Phe TTT 5 4 8 9 | Ser TCT 2 1 4 2 | Tyr TAT 6 4 4 3 | Cys TGT 1 0 0 1 TTC 11 12 9 7 | TCC 3 5 4 2 | TAC 5 7 7 8 | TGC 5 6 6 5 Leu TTA 0 0 2 1 | TCA 1 1 0 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0 TTG 7 6 7 3 | TCG 9 10 10 11 | TAG 0 0 0 0 | Trp TGG 8 8 8 8 ------------------------------------------------------------------------------------------------------ Leu CTT 2 2 2 2 | Pro CCT 3 1 1 1 | His CAT 4 5 6 6 | Arg CGT 1 0 1 1 CTC 10 14 7 10 | CCC 8 8 10 9 | CAC 9 7 7 7 | CGC 3 4 3 3 CTA 6 3 2 3 | CCA 1 1 0 2 | Gln CAA 0 0 1 1 | CGA 2 4 3 2 CTG 20 20 25 26 | CCG 3 6 4 3 | CAG 17 17 16 16 | CGG 5 4 4 6 ------------------------------------------------------------------------------------------------------ Ile ATT 5 4 6 6 | Thr ACT 2 0 1 2 | Asn AAT 6 3 3 4 | Ser AGT 6 6 10 6 ATC 11 12 9 9 | ACC 6 7 8 7 | AAC 4 6 6 5 | AGC 10 9 7 10 ATA 4 4 5 4 | ACA 0 1 0 1 | Lys AAA 1 4 3 3 | Arg AGA 2 1 1 2 Met ATG 15 15 14 15 | ACG 8 8 8 7 | AAG 14 11 12 12 | AGG 3 2 2 1 ------------------------------------------------------------------------------------------------------ Val GTT 2 3 3 2 | Ala GCT 7 3 3 3 | Asp GAT 6 6 8 10 | Gly GGT 3 7 5 3 GTC 13 10 13 14 | GCC 18 20 21 20 | GAC 11 11 9 7 | GGC 16 17 17 19 GTA 0 0 1 0 | GCA 7 4 4 8 | Glu GAA 5 7 4 5 | GGA 12 11 9 12 GTG 17 18 16 17 | GCG 6 10 6 5 | GAG 11 9 12 11 | GGG 2 1 3 1 ------------------------------------------------------------------------------------------------------ Codon position x base (3x4) table for each sequence. #1: D_melanogaster_bves-PC position 1: T:0.16154 C:0.24359 A:0.24872 G:0.34615 position 2: T:0.33077 C:0.21795 A:0.25128 G:0.20000 position 3: T:0.16410 C:0.37179 A:0.10513 G:0.35897 Average T:0.21880 C:0.27778 A:0.20171 G:0.30171 #2: D_sechellia_bves-PC position 1: T:0.15897 C:0.24615 A:0.25128 G:0.34359 position 2: T:0.33077 C:0.21282 A:0.25385 G:0.20256 position 3: T:0.15128 C:0.38205 A:0.09744 G:0.36923 Average T:0.21368 C:0.28034 A:0.20085 G:0.30513 #3: D_simulans_bves-PC position 1: T:0.15641 C:0.24615 A:0.25128 G:0.34615 position 2: T:0.33077 C:0.21282 A:0.25385 G:0.20256 position 3: T:0.14359 C:0.38718 A:0.08974 G:0.37949 Average T:0.21026 C:0.28205 A:0.19829 G:0.30940 #4: D_yakuba_bves-PC position 1: T:0.15641 C:0.24872 A:0.25128 G:0.34359 position 2: T:0.32821 C:0.21538 A:0.25128 G:0.20513 position 3: T:0.14103 C:0.37436 A:0.09744 G:0.38718 Average T:0.20855 C:0.27949 A:0.20000 G:0.31197 #5: D_takahashii_bves-PC position 1: T:0.15641 C:0.24872 A:0.24103 G:0.35385 position 2: T:0.32821 C:0.21282 A:0.25128 G:0.20769 position 3: T:0.14359 C:0.39231 A:0.09744 G:0.36667 Average T:0.20940 C:0.28462 A:0.19658 G:0.30940 #6: D_suzukii_bves-PC position 1: T:0.15897 C:0.25128 A:0.24103 G:0.34872 position 2: T:0.32821 C:0.21538 A:0.25128 G:0.20513 position 3: T:0.14103 C:0.38974 A:0.10000 G:0.36923 Average T:0.20940 C:0.28547 A:0.19744 G:0.30769 #7: D_eugracilis_bves-PC position 1: T:0.16154 C:0.24103 A:0.24872 G:0.34872 position 2: T:0.32821 C:0.21538 A:0.25385 G:0.20256 position 3: T:0.15641 C:0.36667 A:0.10513 G:0.37179 Average T:0.21538 C:0.27436 A:0.20256 G:0.30769 #8: D_ficusphila_bves-PC position 1: T:0.16410 C:0.24615 A:0.23846 G:0.35128 position 2: T:0.32564 C:0.22051 A:0.24872 G:0.20513 position 3: T:0.12564 C:0.39744 A:0.10513 G:0.37179 Average T:0.20513 C:0.28803 A:0.19744 G:0.30940 #9: D_rhopaloa_bves-PC position 1: T:0.17692 C:0.23590 A:0.24359 G:0.34359 position 2: T:0.33077 C:0.21538 A:0.25128 G:0.20256 position 3: T:0.16667 C:0.36667 A:0.08974 G:0.37692 Average T:0.22479 C:0.27265 A:0.19487 G:0.30769 #10: D_elegans_bves-PC position 1: T:0.15641 C:0.25128 A:0.24103 G:0.35128 position 2: T:0.32821 C:0.21538 A:0.25128 G:0.20513 position 3: T:0.15641 C:0.36410 A:0.11538 G:0.36410 Average T:0.21368 C:0.27692 A:0.20256 G:0.30684 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 65 | Ser S TCT 25 | Tyr Y TAT 41 | Cys C TGT 3 TTC 99 | TCC 34 | TAC 69 | TGC 51 Leu L TTA 7 | TCA 9 | *** * TAA 0 | *** * TGA 0 TTG 47 | TCG 96 | TAG 0 | Trp W TGG 81 ------------------------------------------------------------------------------ Leu L CTT 25 | Pro P CCT 16 | His H CAT 54 | Arg R CGT 10 CTC 93 | CCC 86 | CAC 75 | CGC 40 CTA 36 | CCA 14 | Gln Q CAA 2 | CGA 23 CTG 238 | CCG 36 | CAG 168 | CGG 43 ------------------------------------------------------------------------------ Ile I ATT 47 | Thr T ACT 11 | Asn N AAT 37 | Ser S AGT 56 ATC 109 | ACC 65 | AAC 54 | AGC 106 ATA 42 | ACA 5 | Lys K AAA 25 | Arg R AGA 16 Met M ATG 156 | ACG 79 | AAG 127 | AGG 23 ------------------------------------------------------------------------------ Val V GTT 26 | Ala A GCT 47 | Asp D GAT 86 | Gly G GGT 32 GTC 123 | GCC 204 | GAC 86 | GGC 185 GTA 1 | GCA 53 | Glu E GAA 55 | GGA 103 GTG 169 | GCG 60 | GAG 103 | GGG 23 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.16077 C:0.24590 A:0.24564 G:0.34769 position 2: T:0.32897 C:0.21538 A:0.25179 G:0.20385 position 3: T:0.14897 C:0.37923 A:0.10026 G:0.37154 Average T:0.21291 C:0.28017 A:0.19923 G:0.30769 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_bves-PC D_sechellia_bves-PC 0.1426 (0.0097 0.0678) D_simulans_bves-PC 0.1284 (0.0080 0.0620) 0.0529 (0.0011 0.0214) D_yakuba_bves-PC 0.0583 (0.0068 0.1170) 0.1221 (0.0114 0.0932) 0.1261 (0.0102 0.0813) D_takahashii_bves-PC 0.0523 (0.0178 0.3398) 0.0788 (0.0241 0.3063) 0.0752 (0.0230 0.3057) 0.0622 (0.0166 0.2669) D_suzukii_bves-PC 0.0382 (0.0114 0.2989) 0.0606 (0.0160 0.2646) 0.0574 (0.0149 0.2592) 0.0304 (0.0086 0.2812) 0.0498 (0.0091 0.1833) D_eugracilis_bves-PC 0.0284 (0.0097 0.3413) 0.0468 (0.0143 0.3050) 0.0431 (0.0131 0.3045) 0.0313 (0.0091 0.2909) 0.0744 (0.0166 0.2234) 0.0386 (0.0097 0.2513) D_ficusphila_bves-PC 0.0523 (0.0189 0.3617) 0.0669 (0.0236 0.3521) 0.0669 (0.0224 0.3349) 0.0468 (0.0160 0.3424) 0.0535 (0.0132 0.2459) 0.0443 (0.0109 0.2452) 0.0442 (0.0143 0.3233) D_rhopaloa_bves-PC 0.0505 (0.0201 0.3979) 0.0678 (0.0247 0.3647) 0.0668 (0.0236 0.3527) 0.0495 (0.0166 0.3355) 0.0720 (0.0178 0.2468) 0.0341 (0.0080 0.2342) 0.0495 (0.0166 0.3353) 0.0728 (0.0201 0.2762) D_elegans_bves-PC 0.0372 (0.0137 0.3688) 0.0536 (0.0184 0.3424) 0.0511 (0.0172 0.3363) 0.0311 (0.0109 0.3494) 0.0323 (0.0080 0.2475) 0.0133 (0.0034 0.2564) 0.0296 (0.0097 0.3274) 0.0336 (0.0097 0.2893) 0.0431 (0.0103 0.2386) Model 0: one-ratio TREE # 1: (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 lnL(ntime: 16 np: 18): -3175.059384 +0.000000 11..1 11..12 12..2 12..3 11..13 13..4 13..14 14..15 15..16 16..5 16..8 16..17 17..9 17..10 15..6 14..7 0.040089 0.022718 0.015365 0.003505 0.029241 0.034084 0.102218 0.043276 0.022108 0.093475 0.149520 0.031089 0.117504 0.086215 0.067911 0.105728 2.641280 0.040812 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.96404 (1: 0.040089, (2: 0.015365, 3: 0.003505): 0.022718, (4: 0.034084, (((5: 0.093475, 8: 0.149520, (9: 0.117504, 10: 0.086215): 0.031089): 0.022108, 6: 0.067911): 0.043276, 7: 0.105728): 0.102218): 0.029241); (D_melanogaster_bves-PC: 0.040089, (D_sechellia_bves-PC: 0.015365, D_simulans_bves-PC: 0.003505): 0.022718, (D_yakuba_bves-PC: 0.034084, (((D_takahashii_bves-PC: 0.093475, D_ficusphila_bves-PC: 0.149520, (D_rhopaloa_bves-PC: 0.117504, D_elegans_bves-PC: 0.086215): 0.031089): 0.022108, D_suzukii_bves-PC: 0.067911): 0.043276, D_eugracilis_bves-PC: 0.105728): 0.102218): 0.029241); Detailed output identifying parameters kappa (ts/tv) = 2.64128 omega (dN/dS) = 0.04081 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.040 903.5 266.5 0.0408 0.0021 0.0515 1.9 13.7 11..12 0.023 903.5 266.5 0.0408 0.0012 0.0292 1.1 7.8 12..2 0.015 903.5 266.5 0.0408 0.0008 0.0198 0.7 5.3 12..3 0.004 903.5 266.5 0.0408 0.0002 0.0045 0.2 1.2 11..13 0.029 903.5 266.5 0.0408 0.0015 0.0376 1.4 10.0 13..4 0.034 903.5 266.5 0.0408 0.0018 0.0438 1.6 11.7 13..14 0.102 903.5 266.5 0.0408 0.0054 0.1314 4.8 35.0 14..15 0.043 903.5 266.5 0.0408 0.0023 0.0556 2.1 14.8 15..16 0.022 903.5 266.5 0.0408 0.0012 0.0284 1.0 7.6 16..5 0.093 903.5 266.5 0.0408 0.0049 0.1202 4.4 32.0 16..8 0.150 903.5 266.5 0.0408 0.0078 0.1922 7.1 51.2 16..17 0.031 903.5 266.5 0.0408 0.0016 0.0400 1.5 10.7 17..9 0.118 903.5 266.5 0.0408 0.0062 0.1510 5.6 40.3 17..10 0.086 903.5 266.5 0.0408 0.0045 0.1108 4.1 29.5 15..6 0.068 903.5 266.5 0.0408 0.0036 0.0873 3.2 23.3 14..7 0.106 903.5 266.5 0.0408 0.0055 0.1359 5.0 36.2 tree length for dN: 0.0506 tree length for dS: 1.2392 Time used: 0:14 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 check convergence.. lnL(ntime: 16 np: 19): -3150.585329 +0.000000 11..1 11..12 12..2 12..3 11..13 13..4 13..14 14..15 15..16 16..5 16..8 16..17 17..9 17..10 15..6 14..7 0.040878 0.023051 0.015533 0.003552 0.030157 0.034405 0.105948 0.041778 0.022717 0.096923 0.153693 0.032026 0.120888 0.088674 0.070151 0.110173 2.641618 0.964898 0.018141 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.99055 (1: 0.040878, (2: 0.015533, 3: 0.003552): 0.023051, (4: 0.034405, (((5: 0.096923, 8: 0.153693, (9: 0.120888, 10: 0.088674): 0.032026): 0.022717, 6: 0.070151): 0.041778, 7: 0.110173): 0.105948): 0.030157); (D_melanogaster_bves-PC: 0.040878, (D_sechellia_bves-PC: 0.015533, D_simulans_bves-PC: 0.003552): 0.023051, (D_yakuba_bves-PC: 0.034405, (((D_takahashii_bves-PC: 0.096923, D_ficusphila_bves-PC: 0.153693, (D_rhopaloa_bves-PC: 0.120888, D_elegans_bves-PC: 0.088674): 0.032026): 0.022717, D_suzukii_bves-PC: 0.070151): 0.041778, D_eugracilis_bves-PC: 0.110173): 0.105948): 0.030157); Detailed output identifying parameters kappa (ts/tv) = 2.64162 dN/dS (w) for site classes (K=2) p: 0.96490 0.03510 w: 0.01814 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.041 903.5 266.5 0.0526 0.0027 0.0508 2.4 13.5 11..12 0.023 903.5 266.5 0.0526 0.0015 0.0286 1.4 7.6 12..2 0.016 903.5 266.5 0.0526 0.0010 0.0193 0.9 5.1 12..3 0.004 903.5 266.5 0.0526 0.0002 0.0044 0.2 1.2 11..13 0.030 903.5 266.5 0.0526 0.0020 0.0374 1.8 10.0 13..4 0.034 903.5 266.5 0.0526 0.0022 0.0427 2.0 11.4 13..14 0.106 903.5 266.5 0.0526 0.0069 0.1316 6.3 35.1 14..15 0.042 903.5 266.5 0.0526 0.0027 0.0519 2.5 13.8 15..16 0.023 903.5 266.5 0.0526 0.0015 0.0282 1.3 7.5 16..5 0.097 903.5 266.5 0.0526 0.0063 0.1204 5.7 32.1 16..8 0.154 903.5 266.5 0.0526 0.0100 0.1909 9.1 50.9 16..17 0.032 903.5 266.5 0.0526 0.0021 0.0398 1.9 10.6 17..9 0.121 903.5 266.5 0.0526 0.0079 0.1501 7.1 40.0 17..10 0.089 903.5 266.5 0.0526 0.0058 0.1101 5.2 29.3 15..6 0.070 903.5 266.5 0.0526 0.0046 0.0871 4.1 23.2 14..7 0.110 903.5 266.5 0.0526 0.0072 0.1368 6.5 36.5 Time used: 0:30 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 lnL(ntime: 16 np: 21): -3148.321012 +0.000000 11..1 11..12 12..2 12..3 11..13 13..4 13..14 14..15 15..16 16..5 16..8 16..17 17..9 17..10 15..6 14..7 0.042453 0.023929 0.016143 0.003688 0.031276 0.035764 0.109398 0.043975 0.023125 0.102836 0.161634 0.033246 0.124606 0.093294 0.072241 0.114610 2.674316 0.968180 0.027534 0.019675 6.274252 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.03222 (1: 0.042453, (2: 0.016143, 3: 0.003688): 0.023929, (4: 0.035764, (((5: 0.102836, 8: 0.161634, (9: 0.124606, 10: 0.093294): 0.033246): 0.023125, 6: 0.072241): 0.043975, 7: 0.114610): 0.109398): 0.031276); (D_melanogaster_bves-PC: 0.042453, (D_sechellia_bves-PC: 0.016143, D_simulans_bves-PC: 0.003688): 0.023929, (D_yakuba_bves-PC: 0.035764, (((D_takahashii_bves-PC: 0.102836, D_ficusphila_bves-PC: 0.161634, (D_rhopaloa_bves-PC: 0.124606, D_elegans_bves-PC: 0.093294): 0.033246): 0.023125, D_suzukii_bves-PC: 0.072241): 0.043975, D_eugracilis_bves-PC: 0.114610): 0.109398): 0.031276); Detailed output identifying parameters kappa (ts/tv) = 2.67432 dN/dS (w) for site classes (K=3) p: 0.96818 0.02753 0.00429 w: 0.01967 1.00000 6.27425 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.042 903.2 266.8 0.0735 0.0037 0.0497 3.3 13.3 11..12 0.024 903.2 266.8 0.0735 0.0021 0.0280 1.9 7.5 12..2 0.016 903.2 266.8 0.0735 0.0014 0.0189 1.3 5.0 12..3 0.004 903.2 266.8 0.0735 0.0003 0.0043 0.3 1.2 11..13 0.031 903.2 266.8 0.0735 0.0027 0.0366 2.4 9.8 13..4 0.036 903.2 266.8 0.0735 0.0031 0.0419 2.8 11.2 13..14 0.109 903.2 266.8 0.0735 0.0094 0.1281 8.5 34.2 14..15 0.044 903.2 266.8 0.0735 0.0038 0.0515 3.4 13.7 15..16 0.023 903.2 266.8 0.0735 0.0020 0.0271 1.8 7.2 16..5 0.103 903.2 266.8 0.0735 0.0088 0.1204 8.0 32.1 16..8 0.162 903.2 266.8 0.0735 0.0139 0.1892 12.6 50.5 16..17 0.033 903.2 266.8 0.0735 0.0029 0.0389 2.6 10.4 17..9 0.125 903.2 266.8 0.0735 0.0107 0.1459 9.7 38.9 17..10 0.093 903.2 266.8 0.0735 0.0080 0.1092 7.2 29.1 15..6 0.072 903.2 266.8 0.0735 0.0062 0.0846 5.6 22.6 14..7 0.115 903.2 266.8 0.0735 0.0099 0.1342 8.9 35.8 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 39 G 0.667 4.520 40 S 0.954* 6.030 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 39 G 0.890 4.896 +- 2.693 40 S 0.970* 5.255 +- 2.565 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.102 0.114 0.132 0.137 0.131 0.116 0.096 0.075 0.056 0.040 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 1:18 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 lnL(ntime: 16 np: 22): -3145.482796 +0.000000 11..1 11..12 12..2 12..3 11..13 13..4 13..14 14..15 15..16 16..5 16..8 16..17 17..9 17..10 15..6 14..7 0.042470 0.023959 0.016201 0.003695 0.031143 0.035947 0.109044 0.045409 0.023093 0.102328 0.162467 0.033201 0.124782 0.093219 0.071923 0.113369 2.652737 0.833984 0.160474 0.000001 0.224625 5.524937 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.03225 (1: 0.042470, (2: 0.016201, 3: 0.003695): 0.023959, (4: 0.035947, (((5: 0.102328, 8: 0.162467, (9: 0.124782, 10: 0.093219): 0.033201): 0.023093, 6: 0.071923): 0.045409, 7: 0.113369): 0.109044): 0.031143); (D_melanogaster_bves-PC: 0.042470, (D_sechellia_bves-PC: 0.016201, D_simulans_bves-PC: 0.003695): 0.023959, (D_yakuba_bves-PC: 0.035947, (((D_takahashii_bves-PC: 0.102328, D_ficusphila_bves-PC: 0.162467, (D_rhopaloa_bves-PC: 0.124782, D_elegans_bves-PC: 0.093219): 0.033201): 0.023093, D_suzukii_bves-PC: 0.071923): 0.045409, D_eugracilis_bves-PC: 0.113369): 0.109044): 0.031143); Detailed output identifying parameters kappa (ts/tv) = 2.65274 dN/dS (w) for site classes (K=3) p: 0.83398 0.16047 0.00554 w: 0.00000 0.22462 5.52494 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.042 903.4 266.6 0.0667 0.0034 0.0507 3.1 13.5 11..12 0.024 903.4 266.6 0.0667 0.0019 0.0286 1.7 7.6 12..2 0.016 903.4 266.6 0.0667 0.0013 0.0193 1.2 5.2 12..3 0.004 903.4 266.6 0.0667 0.0003 0.0044 0.3 1.2 11..13 0.031 903.4 266.6 0.0667 0.0025 0.0372 2.2 9.9 13..4 0.036 903.4 266.6 0.0667 0.0029 0.0429 2.6 11.4 13..14 0.109 903.4 266.6 0.0667 0.0087 0.1301 7.8 34.7 14..15 0.045 903.4 266.6 0.0667 0.0036 0.0542 3.3 14.4 15..16 0.023 903.4 266.6 0.0667 0.0018 0.0276 1.7 7.3 16..5 0.102 903.4 266.6 0.0667 0.0081 0.1221 7.4 32.6 16..8 0.162 903.4 266.6 0.0667 0.0129 0.1939 11.7 51.7 16..17 0.033 903.4 266.6 0.0667 0.0026 0.0396 2.4 10.6 17..9 0.125 903.4 266.6 0.0667 0.0099 0.1489 9.0 39.7 17..10 0.093 903.4 266.6 0.0667 0.0074 0.1112 6.7 29.7 15..6 0.072 903.4 266.6 0.0667 0.0057 0.0858 5.2 22.9 14..7 0.113 903.4 266.6 0.0667 0.0090 0.1353 8.1 36.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 39 G 0.963* 5.329 40 S 1.000** 5.523 Time used: 2:27 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 lnL(ntime: 16 np: 19): -3152.189208 +0.000000 11..1 11..12 12..2 12..3 11..13 13..4 13..14 14..15 15..16 16..5 16..8 16..17 17..9 17..10 15..6 14..7 0.040846 0.023015 0.015548 0.003552 0.030065 0.034425 0.105056 0.042851 0.022670 0.096266 0.153551 0.031978 0.120479 0.088367 0.069590 0.108997 2.629720 0.051845 0.868401 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.98726 (1: 0.040846, (2: 0.015548, 3: 0.003552): 0.023015, (4: 0.034425, (((5: 0.096266, 8: 0.153551, (9: 0.120479, 10: 0.088367): 0.031978): 0.022670, 6: 0.069590): 0.042851, 7: 0.108997): 0.105056): 0.030065); (D_melanogaster_bves-PC: 0.040846, (D_sechellia_bves-PC: 0.015548, D_simulans_bves-PC: 0.003552): 0.023015, (D_yakuba_bves-PC: 0.034425, (((D_takahashii_bves-PC: 0.096266, D_ficusphila_bves-PC: 0.153551, (D_rhopaloa_bves-PC: 0.120479, D_elegans_bves-PC: 0.088367): 0.031978): 0.022670, D_suzukii_bves-PC: 0.069590): 0.042851, D_eugracilis_bves-PC: 0.108997): 0.105056): 0.030065); Detailed output identifying parameters kappa (ts/tv) = 2.62972 Parameters in M7 (beta): p = 0.05185 q = 0.86840 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.00031 0.00490 0.05442 0.43930 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.041 903.6 266.4 0.0499 0.0026 0.0511 2.3 13.6 11..12 0.023 903.6 266.4 0.0499 0.0014 0.0288 1.3 7.7 12..2 0.016 903.6 266.4 0.0499 0.0010 0.0195 0.9 5.2 12..3 0.004 903.6 266.4 0.0499 0.0002 0.0044 0.2 1.2 11..13 0.030 903.6 266.4 0.0499 0.0019 0.0376 1.7 10.0 13..4 0.034 903.6 266.4 0.0499 0.0022 0.0431 1.9 11.5 13..14 0.105 903.6 266.4 0.0499 0.0066 0.1315 5.9 35.0 14..15 0.043 903.6 266.4 0.0499 0.0027 0.0536 2.4 14.3 15..16 0.023 903.6 266.4 0.0499 0.0014 0.0284 1.3 7.6 16..5 0.096 903.6 266.4 0.0499 0.0060 0.1205 5.4 32.1 16..8 0.154 903.6 266.4 0.0499 0.0096 0.1922 8.7 51.2 16..17 0.032 903.6 266.4 0.0499 0.0020 0.0400 1.8 10.7 17..9 0.120 903.6 266.4 0.0499 0.0075 0.1508 6.8 40.2 17..10 0.088 903.6 266.4 0.0499 0.0055 0.1106 5.0 29.5 15..6 0.070 903.6 266.4 0.0499 0.0043 0.0871 3.9 23.2 14..7 0.109 903.6 266.4 0.0499 0.0068 0.1365 6.2 36.4 Time used: 4:41 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), (4, (((5, 8, (9, 10)), 6), 7))); MP score: 311 check convergence.. lnL(ntime: 16 np: 21): -3145.542888 +0.000000 11..1 11..12 12..2 12..3 11..13 13..4 13..14 14..15 15..16 16..5 16..8 16..17 17..9 17..10 15..6 14..7 0.042505 0.023984 0.016212 0.003698 0.031182 0.035965 0.109111 0.045381 0.023098 0.102453 0.162502 0.033212 0.124790 0.093274 0.071965 0.113497 2.654722 0.994592 0.078107 1.731286 5.650324 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.03283 (1: 0.042505, (2: 0.016212, 3: 0.003698): 0.023984, (4: 0.035965, (((5: 0.102453, 8: 0.162502, (9: 0.124790, 10: 0.093274): 0.033212): 0.023098, 6: 0.071965): 0.045381, 7: 0.113497): 0.109111): 0.031182); (D_melanogaster_bves-PC: 0.042505, (D_sechellia_bves-PC: 0.016212, D_simulans_bves-PC: 0.003698): 0.023984, (D_yakuba_bves-PC: 0.035965, (((D_takahashii_bves-PC: 0.102453, D_ficusphila_bves-PC: 0.162502, (D_rhopaloa_bves-PC: 0.124790, D_elegans_bves-PC: 0.093274): 0.033212): 0.023098, D_suzukii_bves-PC: 0.071965): 0.045381, D_eugracilis_bves-PC: 0.113497): 0.109111): 0.031182); Detailed output identifying parameters kappa (ts/tv) = 2.65472 Parameters in M8 (beta&w>1): p0 = 0.99459 p = 0.07811 q = 1.73129 (p1 = 0.00541) w = 5.65032 dN/dS (w) for site classes (K=11) p: 0.09946 0.09946 0.09946 0.09946 0.09946 0.09946 0.09946 0.09946 0.09946 0.09946 0.00541 w: 0.00000 0.00000 0.00000 0.00000 0.00002 0.00022 0.00185 0.01164 0.05972 0.29213 5.65032 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 11..1 0.043 903.4 266.6 0.0669 0.0034 0.0507 3.1 13.5 11..12 0.024 903.4 266.6 0.0669 0.0019 0.0286 1.7 7.6 12..2 0.016 903.4 266.6 0.0669 0.0013 0.0193 1.2 5.2 12..3 0.004 903.4 266.6 0.0669 0.0003 0.0044 0.3 1.2 11..13 0.031 903.4 266.6 0.0669 0.0025 0.0372 2.2 9.9 13..4 0.036 903.4 266.6 0.0669 0.0029 0.0429 2.6 11.4 13..14 0.109 903.4 266.6 0.0669 0.0087 0.1301 7.9 34.7 14..15 0.045 903.4 266.6 0.0669 0.0036 0.0541 3.3 14.4 15..16 0.023 903.4 266.6 0.0669 0.0018 0.0275 1.7 7.3 16..5 0.102 903.4 266.6 0.0669 0.0082 0.1222 7.4 32.6 16..8 0.163 903.4 266.6 0.0669 0.0130 0.1938 11.7 51.7 16..17 0.033 903.4 266.6 0.0669 0.0026 0.0396 2.4 10.6 17..9 0.125 903.4 266.6 0.0669 0.0100 0.1488 9.0 39.7 17..10 0.093 903.4 266.6 0.0669 0.0074 0.1112 6.7 29.7 15..6 0.072 903.4 266.6 0.0669 0.0057 0.0858 5.2 22.9 14..7 0.113 903.4 266.6 0.0669 0.0091 0.1353 8.2 36.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 39 G 0.950 5.382 40 S 0.999** 5.647 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 38 T 0.515 1.957 +- 1.820 39 G 0.965* 4.356 +- 2.453 40 S 0.995** 4.454 +- 2.409 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.015 0.144 0.840 ws: 0.166 0.171 0.162 0.137 0.110 0.086 0.065 0.047 0.033 0.022 Time used: 7:08
Model 1: NearlyNeutral -3150.585329 Model 2: PositiveSelection -3148.321012 Model 0: one-ratio -3175.059384 Model 3: discrete -3145.482796 Model 7: beta -3152.189208 Model 8: beta&w>1 -3145.542888 Model 0 vs 1 48.94811000000027 Model 2 vs 1 4.528634000000238 Model 8 vs 7 13.292639999999665 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 39 G 0.950 5.382 40 S 0.999** 5.647 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_bves-PC) Pr(w>1) post mean +- SE for w 38 T 0.515 1.957 +- 1.820 39 G 0.965* 4.356 +- 2.453 40 S 0.995** 4.454 +- 2.409