--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Nov 19 01:57:21 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/28/bun-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1785.13 -1801.27
2 -1784.96 -1803.44
--------------------------------------
TOTAL -1785.04 -1802.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.581602 0.006099 0.440886 0.737678 0.574211 1326.95 1413.98 1.000
r(A<->C){all} 0.116460 0.000830 0.065372 0.176433 0.114980 917.72 935.04 1.000
r(A<->G){all} 0.283141 0.002160 0.194390 0.371155 0.281966 691.78 793.11 1.000
r(A<->T){all} 0.179412 0.001817 0.098364 0.264455 0.176990 624.37 803.54 1.000
r(C<->G){all} 0.030736 0.000144 0.008551 0.053751 0.029551 1181.06 1186.23 1.000
r(C<->T){all} 0.314199 0.002745 0.220042 0.421601 0.311335 722.05 787.86 1.000
r(G<->T){all} 0.076052 0.000629 0.030283 0.123347 0.073424 679.62 841.29 1.000
pi(A){all} 0.213352 0.000233 0.184588 0.243273 0.212914 1100.47 1216.89 1.000
pi(C){all} 0.291931 0.000308 0.257384 0.324839 0.291609 1350.77 1371.94 1.000
pi(G){all} 0.344712 0.000354 0.309174 0.381064 0.344756 1232.42 1252.98 1.000
pi(T){all} 0.150006 0.000193 0.121740 0.175841 0.149616 829.14 914.82 1.001
alpha{1,2} 0.238626 0.008369 0.098109 0.440404 0.224758 909.93 974.09 1.000
alpha{3} 1.790466 0.702420 0.380481 3.434864 1.646187 1058.30 1088.41 1.000
pinvar{all} 0.321774 0.014547 0.067510 0.525933 0.335492 912.53 928.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1373.722058
Model 2: PositiveSelection -1372.841264
Model 0: one-ratio -1395.776798
Model 3: discrete -1372.837274
Model 7: beta -1375.451419
Model 8: beta&w>1 -1372.855132
Model 0 vs 1 44.109480000000076
Model 2 vs 1 1.7615880000003017
Model 8 vs 7 5.19257400000015
>C1
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPNGSA
ENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMSooooo
>C2
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPAVQSVVAPAAAGQAVQQQSAGAVAVTGVATSPASAVVPTSIPNGSA
ENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGPMS
>C3
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPAVQSVVAPAAAGQAVQQQSAGAVAVTGVATSPASAVVPTSIPNGSA
ENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGPMS
>C4
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAAVQSAVAPAAAGQAVQQQAAGAVAVAVAVTGVATSPASAVVPTSI
PNGSAENGSSAVESAVSVEQQVQQVTSAAAAAAAAAVTANGPMS
>C5
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAVQSAVAPAAAGQAVQQQQAAGGAVAVTGVATSPASAAVPTSIPNG
SAENGSSAVESAVSVEQQVQQVTSAAAAAVVTANGPMSoooooo
>C6
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAVQSAVAPAAAGQAVQGGQQQTAGAVAVTGVATSPASAVIPTIIPN
GSAENGGSAVESAAVSVEQQQQQQVTSAAATAVTTTNGPMSooo
>C7
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVPT
IIPNGSAENGGSAVELSAAAAEQQQVASAAAGAATTTNGPMSoo
>C8
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAATTAAGQAVQGGQQQTAGTVAVTGLATSPASAVVPTSIPNGSAEN
GGSAVESVVVSVEQQQQQQQVTSAAATAVTTTNGPMSooooooo
>C9
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAPAVQSAVAAAAGQAAQGGQVAAGAVTGVATSPASAVAPTTIPNGSAE
NGGSAVKSAVAVEQQQVTSAAAVPTANGPMSooooooooooooo
>C10
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAPAVQSAVAAAAGQAGQGGQVAAGAVTGVATSPASAVAPTTIPNGSAE
NGGSAVESAVAVEQQHVAAATAAAAVPTANGPMSoooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=215
C1 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C2 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C3 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C4 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C5 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C6 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C7 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C8 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C9 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
C10 MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
**************************************************
C1 VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
C2 VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
C3 VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
C4 VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
C5 VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
C6 VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
C7 VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
C8 VLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
C9 VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
C10 VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
**********:*********.***************:***:*********
C1 QAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASAVVP
C2 QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
C3 QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
C4 QAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASAVVP
C5 QAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASAAVP
C6 QAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASAVIP
C7 QAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVP
C8 QAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASAVVP
C9 QAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASAVAP
C10 QAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASAVAP
**** *. :***** * * * **:*:*******. *
C1 TSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTANGP
C2 TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
C3 TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
C4 TSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTANGP
C5 TSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTANGP
C6 TIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTTNGP
C7 TIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTTNGP
C8 TSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTTNGP
C9 TTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTANGP
C10 TTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTANGP
* *********.***: ..:.** ::* :. *:***
C1 MSooooo--------
C2 MS-------------
C3 MS-------------
C4 MS-------------
C5 MSoooooo-------
C6 MSooo----------
C7 MSoo-----------
C8 MSooooooo------
C9 MSooooooooooooo
C10 MSoooooooooo---
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 194 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 194 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [26254]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [26254]--->[24055]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/28/bun-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.546 Mb, Max= 31.164 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASAVVP
TSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTANGP
MSooooo--------
>C2
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
MS-------------
>C3
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
MS-------------
>C4
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASAVVP
TSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTANGP
MS-------------
>C5
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASAAVP
TSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTANGP
MSoooooo-------
>C6
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASAVIP
TIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTTNGP
MSooo----------
>C7
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVP
TIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTTNGP
MSoo-----------
>C8
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASAVVP
TSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTTNGP
MSooooooo------
>C9
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASAVAP
TTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTANGP
MSooooooooooooo
>C10
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASAVAP
TTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTANGP
MSoooooooooo---
FORMAT of file /tmp/tmp2400978216633239559aln Not Supported[FATAL:T-COFFEE]
>C1
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASAVVP
TSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTANGP
MSooooo--------
>C2
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
MS-------------
>C3
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
MS-------------
>C4
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASAVVP
TSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTANGP
MS-------------
>C5
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASAAVP
TSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTANGP
MSoooooo-------
>C6
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASAVIP
TIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTTNGP
MSooo----------
>C7
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVP
TIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTTNGP
MSoo-----------
>C8
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASAVVP
TSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTTNGP
MSooooooo------
>C9
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASAVAP
TTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTANGP
MSooooooooooooo
>C10
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASAVAP
TTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTANGP
MSoooooooooo---
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:215 S:89 BS:215
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 98.94 C1 C2 98.94
TOP 1 0 98.94 C2 C1 98.94
BOT 0 2 98.94 C1 C3 98.94
TOP 2 0 98.94 C3 C1 98.94
BOT 0 3 96.81 C1 C4 96.81
TOP 3 0 96.81 C4 C1 96.81
BOT 0 4 96.32 C1 C5 96.32
TOP 4 0 96.32 C5 C1 96.32
BOT 0 5 91.58 C1 C6 91.58
TOP 5 0 91.58 C6 C1 91.58
BOT 0 6 89.25 C1 C7 89.25
TOP 6 0 89.25 C7 C1 89.25
BOT 0 7 88.30 C1 C8 88.30
TOP 7 0 88.30 C8 C1 88.30
BOT 0 8 91.85 C1 C9 91.85
TOP 8 0 91.85 C9 C1 91.85
BOT 0 9 91.40 C1 C10 91.40
TOP 9 0 91.40 C10 C1 91.40
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 95.77 C2 C4 95.77
TOP 3 1 95.77 C4 C2 95.77
BOT 1 4 95.68 C2 C5 95.68
TOP 4 1 95.68 C5 C2 95.68
BOT 1 5 90.43 C2 C6 90.43
TOP 5 1 90.43 C6 C2 90.43
BOT 1 6 88.11 C2 C7 88.11
TOP 6 1 88.11 C7 C2 88.11
BOT 1 7 86.96 C2 C8 86.96
TOP 7 1 86.96 C8 C2 86.96
BOT 1 8 90.50 C2 C9 90.50
TOP 8 1 90.50 C9 C2 90.50
BOT 1 9 90.11 C2 C10 90.11
TOP 9 1 90.11 C10 C2 90.11
BOT 2 3 95.77 C3 C4 95.77
TOP 3 2 95.77 C4 C3 95.77
BOT 2 4 95.68 C3 C5 95.68
TOP 4 2 95.68 C5 C3 95.68
BOT 2 5 90.43 C3 C6 90.43
TOP 5 2 90.43 C6 C3 90.43
BOT 2 6 88.11 C3 C7 88.11
TOP 6 2 88.11 C7 C3 88.11
BOT 2 7 86.96 C3 C8 86.96
TOP 7 2 86.96 C8 C3 86.96
BOT 2 8 90.50 C3 C9 90.50
TOP 8 2 90.50 C9 C3 90.50
BOT 2 9 90.11 C3 C10 90.11
TOP 9 2 90.11 C10 C3 90.11
BOT 3 4 96.81 C4 C5 96.81
TOP 4 3 96.81 C5 C4 96.81
BOT 3 5 93.55 C4 C6 93.55
TOP 5 3 93.55 C6 C4 93.55
BOT 3 6 93.05 C4 C7 93.05
TOP 6 3 93.05 C7 C4 93.05
BOT 3 7 90.11 C4 C8 90.11
TOP 7 3 90.11 C8 C4 90.11
BOT 3 8 93.30 C4 C9 93.30
TOP 8 3 93.30 C9 C4 93.30
BOT 3 9 92.86 C4 C10 92.86
TOP 9 3 92.86 C10 C4 92.86
BOT 4 5 94.62 C5 C6 94.62
TOP 5 4 94.62 C6 C5 94.62
BOT 4 6 90.27 C5 C7 90.27
TOP 6 4 90.27 C7 C5 90.27
BOT 4 7 91.35 C5 C8 91.35
TOP 7 4 91.35 C8 C5 91.35
BOT 4 8 92.93 C5 C9 92.93
TOP 8 4 92.93 C9 C5 92.93
BOT 4 9 92.47 C5 C10 92.47
TOP 9 4 92.47 C10 C5 92.47
BOT 5 6 93.16 C6 C7 93.16
TOP 6 5 93.16 C7 C6 93.16
BOT 5 7 94.71 C6 C8 94.71
TOP 7 5 94.71 C8 C6 94.71
BOT 5 8 92.39 C6 C9 92.39
TOP 8 5 92.39 C9 C6 92.39
BOT 5 9 92.93 C6 C10 92.93
TOP 9 5 92.93 C10 C6 92.93
BOT 6 7 89.73 C7 C8 89.73
TOP 7 6 89.73 C8 C7 89.73
BOT 6 8 90.56 C7 C9 90.56
TOP 8 6 90.56 C9 C7 90.56
BOT 6 9 91.67 C7 C10 91.67
TOP 9 6 91.67 C10 C7 91.67
BOT 7 8 89.13 C8 C9 89.13
TOP 8 7 89.13 C9 C8 89.13
BOT 7 9 89.19 C8 C10 89.19
TOP 9 7 89.19 C10 C8 89.19
BOT 8 9 97.91 C9 C10 97.91
TOP 9 8 97.91 C10 C9 97.91
AVG 0 C1 * 93.71
AVG 1 C2 * 92.94
AVG 2 C3 * 92.94
AVG 3 C4 * 94.22
AVG 4 C5 * 94.01
AVG 5 C6 * 92.64
AVG 6 C7 * 90.43
AVG 7 C8 * 89.60
AVG 8 C9 * 92.12
AVG 9 C10 * 92.07
TOT TOT * 92.47
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGGGCACTATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
C2 ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
C3 ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
C4 ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
C5 ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
C6 ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
C7 ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
C8 ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
C9 ATGATGGGCACAATGTCGCTCCGCCAGCCAGAGAATTGGCTCTACGAGAT
C10 ATGATGGGCACAATGTCGCTCCGCCAGCCAGAGAATTGGCTCTACGAAAT
***********:******** ********************.*****.**
C1 TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCTAATGCAA
C2 TTGGCAGAAGGGCTACGATAGCCCCTGCTATGTGATGGTGCCCAATGCAA
C3 TTGGCAGAAGGGCTACGATAGCCCCTGCTATGTGATGGTGCCCAATGCAA
C4 CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
C5 TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
C6 TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
C7 TTGGCAGAAGGGCTACGACAGCCCCTGCTACGTGATGGTGCCCAATGCAA
C8 TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
C9 CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
C10 CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
***************** *********** *********** *******
C1 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C2 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C3 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C4 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C5 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C6 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C7 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C8 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C9 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
C10 AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
**************************************************
C1 GTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
C2 GTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
C3 GTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
C4 GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
C5 GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
C6 GTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTGGA
C7 GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
C8 GTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAACAAGCTGGA
C9 GTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTGGA
C10 GTTCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
** **.**.********.**************.*****************
C1 GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGC
C2 GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
C3 GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
C4 GCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGACACTGCAGC
C5 GCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGC
C6 GCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
C7 GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
C8 GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
C9 GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
C10 GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
*** *******.******************.***********.*******
C1 AGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACGCCCGCCATT
C2 AGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCATT
C3 AGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCATT
C4 AGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACGCCCGCCATT
C5 AGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACGCCCGCCATT
C6 AGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCATC
C7 AGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCATC
C8 AGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACGCCAGCCATT
C9 AGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACGCCCGCCATT
C10 AGTTGCAGATGCAGCTCCAAGTGGCCGCTCCCCCGGCCACGCCCGCCATT
** *****:******* **. * ***** ** ***********.*****
C1 CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG
C2 CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG
C3 CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG
C4 CAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCGGG
C5 CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGCTGCCGCGGG
C6 CAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCGGG
C7 CAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGCTGCCGCGGG
C8 CAAGCGGCGCCG---GCGGCAACG---------------ACTGCCGCGGG
C9 CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCGGG
C10 CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCGGG
**.*****.*** **** .... .**********
C1 TCAGGCAGTTCAG---------CAGCAGGCCGCTGGA------------G
C2 TCAGGCAGTTCAA---------CAGCAGTCCGCTGGA------------G
C3 TCAGGCAGTTCAA---------CAGCAGTCCGCTGGA------------G
C4 TCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGGTTGCGGTAG
C5 TCAGGCAGTTCAG---------CAGCAGCAGGCC------GCTGGAGGAG
C6 TCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT------------G
C7 TCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGGTGGCGGTGG
C8 TCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA------------A
C9 TCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA-------------
C10 TCAGGCAGGGCAGGGTGGT---CAGGTGGCCGCCGGT-------------
******** **. *** :* . **
C1 CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
C2 CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
C3 CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
C4 CGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
C5 CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGCGGTACCC
C6 CGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCGGTGATCCCA
C7 CGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCGGTGGTCCCC
C8 CGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCGGTGGTCCCC
C9 -----GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCAGTGGCGCCC
C10 -----GCGGTGACGGGAGTTGCCACCAGTCCAGCGTCCGCAGTGGCGCCC
*****..*.** * ******** **.** **.**.* *. **.
C1 ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC
C2 ACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAGAC
C3 ACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAGAC
C4 ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC
C5 ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC
C6 ACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGCTGTCGAGTC
C7 ACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAGCT
C8 ACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGCAGTCGAGTC
C9 ACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCAAGTC
C10 ACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAGTC
**** ********* ***** *********** .*******:***.**
C1 AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCA-------
C2 AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGG
C3 AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGG
C4 A---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACTTCAGCA----
C5 A---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCA-------
C6 AGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG-------------
C7 GTCAGCGGCAGCGGCGGAGCAGCAGCAG----------------------
C8 AGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAG----------
C9 A---GCGGTGGCGGTGGAGCAG------CAGCAGGTG-------------
C10 A---GCGGTAGCGGTGGAGCAG------CAGCATGTGGCGGCAGCA----
. * ** . *** .******
C1 --------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCCAATGGTCCC
C2 CAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCAATGGTCCC
C3 CAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCAATGGTCCC
C4 --------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCAAACGGTCCC
C5 --------------GCAGCGGCGGCAGCAGTGGTCACAGCCAATGGTCCC
C6 -----GTGACGTCAGCAGCGGCAACAGCGGTAACCACGACCAACGGTCCC
C7 -----GTGGCGTCGGCAGCGGCTGGAGCGGCAACCACGACCAACGGCCCC
C8 -----GTGACGTCAGCAGCGGCAACAGCGGTAACCACAACCAATGGTCCC
C9 --------------ACGTCAGCAGCAGCGGTACCCACAGCAAACGGTCCC
C10 --------------ACAGCAGCAGCAGCGGTACCCACAGCCAACGGACCT
.*. *.** . * *.* . *** .*.** ** **
C1 ATGTCC---------------------------------------
C2 ATGTCC---------------------------------------
C3 ATGTCC---------------------------------------
C4 ATGTCC---------------------------------------
C5 ATGTCC---------------------------------------
C6 ATGTCC---------------------------------------
C7 ATGTCC---------------------------------------
C8 ATGTCC---------------------------------------
C9 ATGTCC---------------------------------------
C10 ATGTCC---------------------------------------
******
>C1
ATGATGGGCACTATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCTAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGC
AGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACGCCCGCCATT
CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG
TCAGGCAGTTCAG---------CAGCAGGCCGCTGGA------------G
CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC
AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCA-------
--------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCCAATGGTCCC
ATGTCC---------------------------------------
>C2
ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
TTGGCAGAAGGGCTACGATAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
AGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCATT
CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG
TCAGGCAGTTCAA---------CAGCAGTCCGCTGGA------------G
CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
ACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAGAC
AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGG
CAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCAATGGTCCC
ATGTCC---------------------------------------
>C3
ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
TTGGCAGAAGGGCTACGATAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
AGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCATT
CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG
TCAGGCAGTTCAA---------CAGCAGTCCGCTGGA------------G
CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
ACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAGAC
AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGG
CAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCAATGGTCCC
ATGTCC---------------------------------------
>C4
ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT
CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGACACTGCAGC
AGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACGCCCGCCATT
CAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCGGG
TCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGGTTGCGGTAG
CGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC
ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC
A---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACTTCAGCA----
--------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCAAACGGTCCC
ATGTCC---------------------------------------
>C5
ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGC
AGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACGCCCGCCATT
CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGCTGCCGCGGG
TCAGGCAGTTCAG---------CAGCAGCAGGCC------GCTGGAGGAG
CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGCGGTACCC
ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC
A---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCA-------
--------------GCAGCGGCGGCAGCAGTGGTCACAGCCAATGGTCCC
ATGTCC---------------------------------------
>C6
ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
AGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCATC
CAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCGGG
TCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT------------G
CGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCGGTGATCCCA
ACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGCTGTCGAGTC
AGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG-------------
-----GTGACGTCAGCAGCGGCAACAGCGGTAACCACGACCAACGGTCCC
ATGTCC---------------------------------------
>C7
ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
TTGGCAGAAGGGCTACGACAGCCCCTGCTACGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
AGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCATC
CAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGCTGCCGCGGG
TCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGGTGGCGGTGG
CGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCGGTGGTCCCC
ACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAGCT
GTCAGCGGCAGCGGCGGAGCAGCAGCAG----------------------
-----GTGGCGTCGGCAGCGGCTGGAGCGGCAACCACGACCAACGGCCCC
ATGTCC---------------------------------------
>C8
ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT
TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAACAAGCTGGA
GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
AGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACGCCAGCCATT
CAAGCGGCGCCG---GCGGCAACG---------------ACTGCCGCGGG
TCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA------------A
CGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCGGTGGTCCCC
ACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGCAGTCGAGTC
AGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAG----------
-----GTGACGTCAGCAGCGGCAACAGCGGTAACCACAACCAATGGTCCC
ATGTCC---------------------------------------
>C9
ATGATGGGCACAATGTCGCTCCGCCAGCCAGAGAATTGGCTCTACGAGAT
CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
AGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACGCCCGCCATT
CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCGGG
TCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA-------------
-----GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCAGTGGCGCCC
ACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCAAGTC
A---GCGGTGGCGGTGGAGCAG------CAGCAGGTG-------------
--------------ACGTCAGCAGCAGCGGTACCCACAGCAAACGGTCCC
ATGTCC---------------------------------------
>C10
ATGATGGGCACAATGTCGCTCCGCCAGCCAGAGAATTGGCTCTACGAAAT
CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA
AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA
GTTCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA
GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC
AGTTGCAGATGCAGCTCCAAGTGGCCGCTCCCCCGGCCACGCCCGCCATT
CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCGGG
TCAGGCAGGGCAGGGTGGT---CAGGTGGCCGCCGGT-------------
-----GCGGTGACGGGAGTTGCCACCAGTCCAGCGTCCGCAGTGGCGCCC
ACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAGTC
A---GCGGTAGCGGTGGAGCAG------CAGCATGTGGCGGCAGCA----
--------------ACAGCAGCAGCAGCGGTACCCACAGCCAACGGACCT
ATGTCC---------------------------------------
>C1
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPoAVQSVVAPAAAGQAVQoooQQAAGooooAVAVTGVATSPASAVVP
TSIPNGSAENGSSAVESAAVSVEQQVQQVTSoooooAAAAAASVVTANGP
MS
>C2
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPoAVQSVVAPAAAGQAVQoooQQSAGooooAVAVTGVATSPASAVVP
TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
MS
>C3
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
QAAPoAVQSVVAPAAAGQAVQoooQQSAGooooAVAVTGVATSPASAVVP
TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
MS
>C4
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPAAVQSAVAPAAAGQAVQoooQQAAGAVAVAVAVTGVATSPASAVVP
TSIPNGSAENGSSAVESoAVSVEQQVQQVTSAooooAAAAAAAAVTANGP
MS
>C5
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPoAVQSAVAPAAAGQAVQoooQQQAooAGGAVAVTGVATSPASAAVP
TSIPNGSAENGSSAVESoAVSVEQQVQQVTSoooooooAAAAAVVTANGP
MS
>C6
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPoAVQSAVAPAAAGQAVQGGQQQTAGooooAVAVTGVATSPASAVIP
TIIPNGSAENGGSAVESAAVSVEQQQQQQooooooVTSAAATAVTTTNGP
MS
>C7
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPoAVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVP
TIIPNGSAENGGSAVELSAAAAEQQQoooooooooVASAAAGAATTTNGP
MS
>C8
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
QAAPoAAToooooTAAGQAVQGGQQQTAGooooTVAVTGLATSPASAVVP
TSIPNGSAENGGSAVESVVVSVEQQQQQQQoooooVTSAAATAVTTTNGP
MS
>C9
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAPoAVQSAVAoAAAGQAAQGGoQVAAGooooooAVTGVATSPASAVAP
TTIPNGSAENGGSAVKSoAVAVEQooQQVoooooooooTSAAAVPTANGP
MS
>C10
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
QAAPoAVQSAVAoAAAGQAGQGGoQVAAGooooooAVTGVATSPASAVAP
TTIPNGSAENGGSAVESoAVAVEQooQHVAAAooooooTAAAAVPTANGP
MS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 645 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479519836
Setting output file names to "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1828654505
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2739748591
Seed = 395949420
Swapseed = 1479519836
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 48 unique site patterns
Division 2 has 47 unique site patterns
Division 3 has 88 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2580.317534 -- -24.412588
Chain 2 -- -2527.642838 -- -24.412588
Chain 3 -- -2591.739952 -- -24.412588
Chain 4 -- -2594.491880 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2552.440492 -- -24.412588
Chain 2 -- -2494.236577 -- -24.412588
Chain 3 -- -2619.643505 -- -24.412588
Chain 4 -- -2601.928399 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2580.318] (-2527.643) (-2591.740) (-2594.492) * [-2552.440] (-2494.237) (-2619.644) (-2601.928)
500 -- [-1844.328] (-1862.527) (-1873.262) (-1856.106) * (-1847.743) (-1852.840) [-1834.148] (-1856.848) -- 0:00:00
1000 -- (-1798.605) (-1828.506) [-1827.863] (-1831.109) * [-1813.997] (-1833.722) (-1815.139) (-1827.246) -- 0:00:00
1500 -- (-1799.490) (-1813.646) (-1819.210) [-1800.895] * (-1796.165) (-1822.209) [-1796.958] (-1824.829) -- 0:00:00
2000 -- (-1794.415) [-1801.141] (-1821.330) (-1807.763) * (-1802.497) (-1823.874) [-1792.335] (-1827.536) -- 0:08:19
2500 -- (-1797.474) (-1807.204) (-1810.913) [-1791.547] * [-1803.502] (-1815.689) (-1786.866) (-1810.365) -- 0:06:39
3000 -- (-1785.379) (-1796.573) [-1810.969] (-1792.056) * (-1797.090) [-1804.502] (-1790.295) (-1799.000) -- 0:05:32
3500 -- (-1794.623) [-1789.418] (-1803.132) (-1794.552) * (-1799.485) (-1789.686) [-1789.007] (-1798.259) -- 0:04:44
4000 -- (-1789.999) [-1789.165] (-1805.887) (-1789.115) * (-1799.349) [-1796.342] (-1786.662) (-1799.588) -- 0:08:18
4500 -- (-1786.562) (-1788.005) [-1792.115] (-1794.883) * [-1791.211] (-1796.720) (-1791.838) (-1806.698) -- 0:07:22
5000 -- (-1793.035) (-1788.804) (-1792.708) [-1783.892] * (-1793.500) (-1801.241) [-1788.143] (-1803.609) -- 0:06:38
Average standard deviation of split frequencies: 0.056120
5500 -- (-1793.105) (-1791.044) (-1790.899) [-1798.051] * [-1799.620] (-1801.847) (-1788.236) (-1792.032) -- 0:06:01
6000 -- [-1784.655] (-1789.636) (-1787.979) (-1792.815) * [-1794.855] (-1798.874) (-1793.759) (-1806.227) -- 0:05:31
6500 -- (-1806.640) [-1795.102] (-1803.450) (-1792.145) * (-1795.672) (-1789.288) [-1796.010] (-1793.651) -- 0:07:38
7000 -- (-1795.620) [-1792.864] (-1801.254) (-1789.281) * [-1796.328] (-1793.654) (-1792.901) (-1795.095) -- 0:07:05
7500 -- (-1783.727) (-1793.065) [-1797.773] (-1784.467) * (-1792.781) [-1790.365] (-1794.044) (-1795.053) -- 0:06:37
8000 -- (-1789.917) (-1787.239) [-1789.510] (-1803.559) * (-1798.900) [-1797.212] (-1789.733) (-1789.677) -- 0:06:12
8500 -- [-1794.730] (-1796.799) (-1789.692) (-1804.785) * (-1794.446) (-1797.325) (-1799.863) [-1791.672] -- 0:07:46
9000 -- (-1798.313) [-1784.571] (-1800.069) (-1783.215) * (-1786.291) (-1784.291) (-1793.613) [-1789.835] -- 0:07:20
9500 -- (-1790.761) (-1791.934) [-1787.562] (-1795.188) * [-1787.437] (-1800.406) (-1799.805) (-1798.517) -- 0:06:57
10000 -- [-1796.299] (-1799.861) (-1797.178) (-1787.956) * (-1785.340) [-1795.686] (-1790.025) (-1806.593) -- 0:06:36
Average standard deviation of split frequencies: 0.047877
10500 -- [-1785.879] (-1802.681) (-1792.875) (-1797.904) * (-1796.226) [-1783.198] (-1796.233) (-1800.154) -- 0:06:16
11000 -- [-1787.585] (-1799.182) (-1797.187) (-1793.692) * (-1792.758) (-1798.422) [-1788.916] (-1792.798) -- 0:07:29
11500 -- (-1789.217) (-1798.183) [-1788.359] (-1800.902) * (-1790.267) (-1794.470) [-1789.798] (-1788.799) -- 0:07:09
12000 -- (-1786.386) [-1788.361] (-1791.195) (-1798.880) * (-1790.165) [-1789.675] (-1792.619) (-1799.131) -- 0:06:51
12500 -- (-1796.438) [-1783.577] (-1789.419) (-1797.062) * [-1788.982] (-1792.160) (-1790.409) (-1800.967) -- 0:06:35
13000 -- [-1789.237] (-1795.866) (-1797.970) (-1791.075) * (-1787.878) (-1797.847) [-1794.548] (-1790.634) -- 0:07:35
13500 -- (-1790.995) (-1790.254) [-1784.218] (-1793.647) * (-1793.076) (-1795.456) [-1789.890] (-1790.777) -- 0:07:18
14000 -- (-1787.627) (-1790.109) (-1792.462) [-1790.382] * [-1787.694] (-1800.208) (-1787.393) (-1791.639) -- 0:07:02
14500 -- (-1793.703) (-1785.811) [-1794.619] (-1795.726) * (-1785.384) [-1786.471] (-1797.453) (-1791.352) -- 0:06:47
15000 -- (-1791.283) (-1785.231) [-1789.357] (-1799.890) * (-1789.761) (-1786.350) (-1787.677) [-1791.839] -- 0:06:34
Average standard deviation of split frequencies: 0.029463
15500 -- (-1791.378) (-1795.109) [-1782.350] (-1796.811) * [-1786.926] (-1789.192) (-1798.350) (-1799.790) -- 0:07:24
16000 -- (-1790.790) (-1797.235) [-1786.966] (-1795.396) * (-1791.151) (-1788.359) (-1789.072) [-1800.568] -- 0:07:10
16500 -- (-1789.544) (-1802.389) (-1788.995) [-1789.322] * (-1792.301) (-1799.247) [-1787.950] (-1790.086) -- 0:06:57
17000 -- (-1789.438) [-1789.761] (-1787.160) (-1788.908) * [-1792.159] (-1793.974) (-1793.570) (-1794.596) -- 0:06:44
17500 -- (-1791.768) (-1785.959) [-1787.434] (-1796.233) * (-1792.302) (-1796.604) [-1787.219] (-1801.426) -- 0:07:29
18000 -- (-1790.318) [-1790.146] (-1792.951) (-1793.451) * (-1786.968) (-1807.683) [-1794.855] (-1799.281) -- 0:07:16
18500 -- [-1791.653] (-1789.384) (-1795.574) (-1799.982) * (-1790.999) (-1798.567) [-1785.583] (-1785.352) -- 0:07:04
19000 -- (-1785.616) (-1789.246) [-1787.149] (-1795.094) * (-1791.494) [-1795.604] (-1791.154) (-1791.638) -- 0:06:53
19500 -- (-1787.957) [-1783.895] (-1799.288) (-1794.461) * (-1789.054) (-1798.572) (-1794.213) [-1792.862] -- 0:06:42
20000 -- [-1787.266] (-1787.636) (-1792.365) (-1786.347) * (-1788.904) (-1799.052) [-1800.006] (-1791.762) -- 0:07:21
Average standard deviation of split frequencies: 0.036116
20500 -- [-1788.179] (-1784.096) (-1794.327) (-1793.795) * (-1796.219) (-1787.978) (-1792.816) [-1793.505] -- 0:07:10
21000 -- (-1788.588) [-1793.195] (-1800.139) (-1789.588) * (-1800.479) (-1788.432) [-1796.837] (-1800.550) -- 0:06:59
21500 -- (-1789.210) (-1796.921) [-1789.441] (-1794.712) * (-1794.327) (-1792.086) (-1794.436) [-1789.583] -- 0:06:49
22000 -- (-1789.748) (-1801.360) [-1790.351] (-1785.532) * [-1790.264] (-1796.398) (-1794.488) (-1794.274) -- 0:07:24
22500 -- [-1788.048] (-1791.639) (-1794.166) (-1791.474) * [-1789.069] (-1801.970) (-1784.267) (-1791.937) -- 0:07:14
23000 -- [-1788.910] (-1792.720) (-1792.616) (-1782.239) * [-1798.331] (-1794.368) (-1793.192) (-1797.512) -- 0:07:04
23500 -- (-1788.346) [-1784.308] (-1804.403) (-1783.549) * (-1793.850) (-1794.802) [-1787.646] (-1793.493) -- 0:06:55
24000 -- (-1790.604) (-1790.602) (-1787.241) [-1792.117] * (-1791.186) (-1793.427) (-1789.518) [-1795.563] -- 0:07:27
24500 -- [-1789.243] (-1791.719) (-1786.298) (-1793.779) * (-1792.456) (-1790.395) [-1788.660] (-1798.700) -- 0:07:17
25000 -- (-1797.131) (-1796.595) (-1789.571) [-1790.422] * (-1788.043) [-1790.718] (-1787.533) (-1798.084) -- 0:07:09
Average standard deviation of split frequencies: 0.042306
25500 -- (-1797.745) (-1792.666) [-1799.768] (-1785.402) * (-1793.775) [-1797.611] (-1801.748) (-1786.221) -- 0:07:00
26000 -- (-1803.349) (-1791.223) (-1797.998) [-1792.983] * (-1795.588) [-1793.088] (-1792.063) (-1782.947) -- 0:06:52
26500 -- (-1795.228) (-1787.857) [-1787.663] (-1791.975) * [-1792.847] (-1796.249) (-1794.876) (-1788.313) -- 0:07:20
27000 -- [-1794.288] (-1804.269) (-1794.860) (-1785.816) * (-1798.567) (-1788.919) [-1784.614] (-1787.978) -- 0:07:12
27500 -- (-1798.751) [-1799.875] (-1790.055) (-1793.589) * (-1791.157) [-1786.229] (-1790.467) (-1791.320) -- 0:07:04
28000 -- (-1796.250) (-1801.638) [-1795.400] (-1798.821) * (-1791.727) (-1788.259) (-1799.358) [-1797.650] -- 0:06:56
28500 -- (-1795.712) (-1789.606) (-1792.453) [-1792.723] * (-1788.062) (-1792.298) [-1789.185] (-1792.721) -- 0:07:23
29000 -- (-1803.983) [-1793.122] (-1790.147) (-1788.383) * (-1796.154) (-1797.109) [-1784.979] (-1793.849) -- 0:07:15
29500 -- [-1789.169] (-1799.785) (-1798.621) (-1793.155) * (-1794.384) (-1789.824) [-1789.763] (-1795.030) -- 0:07:07
30000 -- (-1793.638) (-1801.072) (-1790.119) [-1786.841] * (-1791.144) (-1799.327) (-1791.563) [-1787.488] -- 0:07:00
Average standard deviation of split frequencies: 0.037838
30500 -- (-1795.853) (-1791.209) [-1788.234] (-1792.343) * (-1794.510) (-1792.861) (-1791.108) [-1792.548] -- 0:06:53
31000 -- [-1793.040] (-1804.199) (-1792.406) (-1790.590) * (-1790.001) (-1796.075) [-1786.885] (-1798.588) -- 0:07:17
31500 -- (-1789.335) (-1795.016) (-1797.907) [-1786.682] * [-1793.499] (-1793.834) (-1787.216) (-1795.821) -- 0:07:10
32000 -- (-1788.435) (-1799.420) [-1791.278] (-1784.554) * [-1787.725] (-1801.121) (-1786.493) (-1810.382) -- 0:07:03
32500 -- (-1786.202) (-1802.750) [-1791.512] (-1793.115) * (-1790.091) (-1792.613) [-1789.375] (-1803.648) -- 0:06:56
33000 -- [-1786.701] (-1796.175) (-1789.335) (-1794.194) * [-1789.543] (-1791.704) (-1789.935) (-1817.275) -- 0:07:19
33500 -- [-1787.781] (-1797.616) (-1785.733) (-1793.121) * (-1793.479) [-1791.608] (-1789.401) (-1797.031) -- 0:07:12
34000 -- (-1793.281) (-1796.449) [-1792.861] (-1792.006) * (-1794.399) (-1794.605) [-1790.863] (-1791.822) -- 0:07:06
34500 -- (-1788.967) [-1787.501] (-1797.546) (-1799.417) * (-1791.983) [-1787.402] (-1799.112) (-1791.252) -- 0:06:59
35000 -- (-1794.973) [-1792.839] (-1796.795) (-1797.486) * [-1791.133] (-1788.367) (-1796.782) (-1804.914) -- 0:06:53
Average standard deviation of split frequencies: 0.032233
35500 -- (-1795.904) (-1793.048) [-1785.605] (-1787.852) * (-1794.110) [-1787.702] (-1796.289) (-1786.995) -- 0:07:14
36000 -- [-1794.939] (-1801.724) (-1790.171) (-1794.728) * (-1798.723) [-1787.205] (-1787.459) (-1784.819) -- 0:07:08
36500 -- [-1787.889] (-1787.188) (-1790.492) (-1792.044) * (-1790.617) (-1790.109) [-1785.436] (-1790.351) -- 0:07:02
37000 -- [-1782.475] (-1809.791) (-1798.780) (-1786.770) * (-1793.003) (-1793.408) [-1785.004] (-1786.412) -- 0:06:56
37500 -- (-1801.065) [-1788.450] (-1790.291) (-1786.132) * (-1790.249) (-1789.396) (-1789.112) [-1786.783] -- 0:07:16
38000 -- (-1799.341) (-1790.453) (-1792.592) [-1785.479] * (-1789.605) (-1791.800) (-1797.675) [-1786.898] -- 0:07:10
38500 -- (-1806.051) [-1789.310] (-1792.908) (-1786.734) * (-1792.771) (-1791.353) (-1795.162) [-1792.766] -- 0:07:04
39000 -- (-1787.852) (-1787.683) (-1797.157) [-1788.428] * [-1789.548] (-1790.777) (-1795.957) (-1792.272) -- 0:06:58
39500 -- [-1792.536] (-1787.398) (-1788.749) (-1794.473) * [-1788.858] (-1797.679) (-1791.085) (-1790.939) -- 0:06:53
40000 -- [-1789.060] (-1795.007) (-1796.614) (-1791.335) * (-1788.594) (-1789.523) [-1794.449] (-1801.629) -- 0:07:12
Average standard deviation of split frequencies: 0.023184
40500 -- (-1795.832) (-1794.615) (-1791.831) [-1785.274] * [-1790.419] (-1789.042) (-1791.688) (-1784.539) -- 0:07:06
41000 -- (-1794.100) (-1789.171) (-1790.162) [-1784.916] * [-1792.780] (-1792.558) (-1795.736) (-1789.359) -- 0:07:01
41500 -- (-1804.030) (-1799.371) [-1796.281] (-1793.778) * (-1800.971) (-1790.032) [-1792.348] (-1795.155) -- 0:06:55
42000 -- (-1787.910) (-1791.320) [-1797.869] (-1798.765) * (-1791.801) [-1794.155] (-1800.232) (-1791.655) -- 0:07:13
42500 -- (-1793.958) (-1793.173) [-1786.096] (-1795.074) * (-1799.656) (-1804.643) (-1795.856) [-1795.379] -- 0:07:08
43000 -- [-1790.351] (-1791.160) (-1793.268) (-1798.942) * (-1789.684) (-1796.521) (-1800.929) [-1788.679] -- 0:07:02
43500 -- (-1791.087) (-1790.006) (-1797.854) [-1793.235] * (-1792.178) (-1790.469) (-1794.469) [-1788.823] -- 0:06:57
44000 -- [-1789.986] (-1788.250) (-1787.077) (-1793.813) * [-1790.369] (-1787.059) (-1795.612) (-1792.745) -- 0:06:52
44500 -- (-1796.327) (-1789.603) [-1790.080] (-1791.712) * [-1790.193] (-1787.735) (-1803.269) (-1806.329) -- 0:07:09
45000 -- [-1786.719] (-1797.044) (-1791.681) (-1787.095) * (-1809.046) (-1790.430) [-1797.770] (-1799.529) -- 0:07:04
Average standard deviation of split frequencies: 0.029167
45500 -- [-1787.510] (-1790.071) (-1795.090) (-1793.203) * (-1795.463) [-1794.786] (-1793.817) (-1793.330) -- 0:06:59
46000 -- (-1792.015) (-1787.212) [-1792.607] (-1792.020) * (-1793.462) [-1790.892] (-1801.399) (-1801.198) -- 0:06:54
46500 -- (-1792.268) (-1793.100) (-1792.772) [-1789.161] * (-1799.663) (-1787.509) [-1791.681] (-1791.048) -- 0:07:10
47000 -- (-1800.750) (-1786.962) [-1784.062] (-1786.830) * [-1800.709] (-1791.811) (-1801.936) (-1788.330) -- 0:07:05
47500 -- (-1795.657) (-1786.972) (-1802.017) [-1786.776] * [-1790.748] (-1788.695) (-1794.689) (-1794.708) -- 0:07:01
48000 -- (-1794.677) (-1795.812) (-1788.775) [-1784.971] * [-1790.510] (-1792.636) (-1791.810) (-1797.250) -- 0:06:56
48500 -- (-1794.999) (-1793.604) (-1794.535) [-1790.071] * (-1793.846) (-1786.664) (-1791.854) [-1789.630] -- 0:07:11
49000 -- [-1786.379] (-1795.217) (-1792.944) (-1787.875) * (-1796.665) (-1791.079) [-1792.771] (-1795.832) -- 0:07:06
49500 -- (-1791.835) [-1786.998] (-1786.040) (-1790.877) * [-1795.625] (-1788.323) (-1786.239) (-1789.324) -- 0:07:02
50000 -- (-1787.235) [-1784.684] (-1788.695) (-1794.444) * (-1797.640) [-1789.631] (-1798.004) (-1797.434) -- 0:06:58
Average standard deviation of split frequencies: 0.032922
50500 -- [-1800.971] (-1790.932) (-1784.563) (-1785.039) * (-1798.416) [-1792.957] (-1798.728) (-1787.837) -- 0:06:53
51000 -- [-1787.496] (-1800.261) (-1785.014) (-1790.043) * (-1799.393) (-1786.999) (-1801.602) [-1787.735] -- 0:07:07
51500 -- (-1791.429) (-1796.618) (-1792.577) [-1788.054] * (-1795.516) [-1794.634] (-1792.161) (-1787.255) -- 0:07:03
52000 -- (-1791.435) (-1798.099) [-1793.529] (-1785.767) * (-1791.971) (-1792.772) (-1793.574) [-1788.180] -- 0:06:59
52500 -- (-1793.855) (-1791.488) (-1796.108) [-1791.911] * (-1804.259) (-1792.469) [-1788.600] (-1791.155) -- 0:06:55
53000 -- (-1788.541) [-1793.674] (-1794.833) (-1791.627) * (-1792.214) [-1787.483] (-1793.379) (-1799.811) -- 0:07:08
53500 -- (-1788.629) [-1786.489] (-1796.864) (-1802.834) * (-1804.918) (-1784.539) [-1790.886] (-1792.288) -- 0:07:04
54000 -- (-1798.646) [-1789.717] (-1803.639) (-1797.362) * (-1795.276) (-1796.117) [-1785.587] (-1801.051) -- 0:07:00
54500 -- (-1792.363) (-1789.010) [-1797.761] (-1790.755) * (-1792.287) [-1784.299] (-1788.407) (-1796.740) -- 0:06:56
55000 -- (-1789.504) (-1809.700) (-1789.652) [-1788.679] * (-1783.523) [-1786.861] (-1788.546) (-1793.523) -- 0:06:52
Average standard deviation of split frequencies: 0.026549
55500 -- (-1791.873) (-1795.770) (-1792.247) [-1788.428] * (-1786.656) (-1786.577) [-1786.654] (-1792.821) -- 0:07:05
56000 -- (-1794.263) (-1788.318) [-1794.978] (-1792.302) * (-1789.719) [-1786.334] (-1794.763) (-1795.299) -- 0:07:01
56500 -- [-1798.001] (-1793.572) (-1791.321) (-1796.086) * (-1802.201) [-1792.092] (-1797.058) (-1785.027) -- 0:06:57
57000 -- (-1792.292) [-1792.014] (-1795.568) (-1789.632) * (-1790.088) [-1789.333] (-1797.220) (-1789.634) -- 0:06:53
57500 -- (-1787.137) [-1790.265] (-1794.802) (-1792.040) * (-1791.286) (-1787.890) (-1796.793) [-1790.518] -- 0:07:06
58000 -- (-1790.479) (-1790.191) (-1793.699) [-1785.145] * (-1792.821) (-1791.650) (-1783.686) [-1788.163] -- 0:07:02
58500 -- (-1800.242) [-1798.256] (-1788.297) (-1787.944) * [-1793.241] (-1794.084) (-1791.834) (-1788.640) -- 0:06:58
59000 -- [-1795.786] (-1790.328) (-1790.664) (-1796.652) * (-1790.936) [-1788.053] (-1799.118) (-1792.480) -- 0:06:54
59500 -- (-1793.727) [-1789.728] (-1794.243) (-1788.631) * (-1806.273) (-1795.764) [-1788.638] (-1797.555) -- 0:07:06
60000 -- [-1800.669] (-1794.748) (-1792.324) (-1794.918) * (-1789.940) (-1785.539) (-1793.051) [-1793.717] -- 0:07:03
Average standard deviation of split frequencies: 0.024507
60500 -- [-1786.109] (-1788.037) (-1796.947) (-1788.210) * (-1795.515) [-1790.011] (-1792.507) (-1786.657) -- 0:06:59
61000 -- (-1792.242) (-1794.756) [-1794.429] (-1789.673) * (-1796.725) (-1795.924) (-1799.411) [-1787.392] -- 0:06:55
61500 -- [-1784.761] (-1803.296) (-1790.260) (-1792.987) * (-1802.575) [-1790.137] (-1791.386) (-1795.346) -- 0:06:52
62000 -- (-1789.824) (-1801.509) (-1785.229) [-1793.140] * (-1793.540) (-1790.993) [-1789.459] (-1787.650) -- 0:07:03
62500 -- (-1796.441) (-1792.078) [-1789.149] (-1792.491) * (-1792.382) (-1791.857) [-1785.845] (-1791.426) -- 0:07:00
63000 -- (-1788.974) (-1790.809) (-1788.345) [-1796.983] * [-1791.395] (-1793.530) (-1798.061) (-1796.281) -- 0:06:56
63500 -- (-1805.870) (-1792.126) [-1788.078] (-1797.196) * (-1793.069) (-1789.179) (-1796.524) [-1790.430] -- 0:06:52
64000 -- (-1786.527) (-1793.012) [-1790.321] (-1796.123) * (-1787.740) (-1799.611) [-1792.601] (-1795.616) -- 0:07:04
64500 -- (-1787.871) (-1803.471) (-1788.842) [-1786.408] * (-1790.607) (-1791.259) [-1786.424] (-1786.760) -- 0:07:00
65000 -- (-1787.526) (-1795.258) (-1792.046) [-1781.407] * [-1787.712] (-1792.428) (-1789.173) (-1792.188) -- 0:06:57
Average standard deviation of split frequencies: 0.019779
65500 -- (-1788.553) (-1796.746) (-1793.768) [-1785.078] * (-1792.402) (-1791.760) [-1789.752] (-1797.340) -- 0:06:53
66000 -- [-1791.570] (-1787.932) (-1793.537) (-1792.253) * (-1794.458) [-1785.923] (-1792.282) (-1796.851) -- 0:06:50
66500 -- [-1797.172] (-1792.398) (-1793.022) (-1794.273) * [-1784.116] (-1787.604) (-1796.907) (-1794.500) -- 0:07:01
67000 -- [-1786.815] (-1785.850) (-1792.784) (-1790.995) * [-1782.760] (-1803.485) (-1788.790) (-1795.032) -- 0:06:57
67500 -- (-1789.290) (-1795.811) [-1785.581] (-1784.442) * (-1791.327) (-1800.291) [-1790.659] (-1793.586) -- 0:06:54
68000 -- [-1788.001] (-1787.894) (-1785.368) (-1796.554) * (-1790.762) (-1789.682) [-1787.789] (-1792.620) -- 0:06:51
68500 -- (-1794.612) (-1786.729) [-1785.545] (-1792.500) * [-1781.928] (-1801.977) (-1797.826) (-1794.106) -- 0:07:01
69000 -- [-1795.708] (-1788.621) (-1788.834) (-1792.389) * (-1790.476) [-1786.337] (-1794.972) (-1796.995) -- 0:06:58
69500 -- (-1799.174) (-1790.977) (-1790.369) [-1784.345] * (-1801.710) (-1791.451) [-1789.822] (-1794.013) -- 0:06:55
70000 -- (-1799.217) (-1788.804) (-1785.320) [-1787.475] * [-1791.364] (-1790.297) (-1794.998) (-1788.826) -- 0:06:51
Average standard deviation of split frequencies: 0.020526
70500 -- (-1795.143) (-1793.865) [-1793.675] (-1785.764) * [-1791.529] (-1791.121) (-1797.135) (-1792.387) -- 0:06:48
71000 -- (-1796.073) [-1787.991] (-1785.085) (-1793.478) * (-1790.027) (-1786.047) [-1793.801] (-1789.590) -- 0:06:58
71500 -- (-1795.877) (-1798.622) (-1788.732) [-1794.919] * (-1788.329) [-1787.266] (-1795.105) (-1786.715) -- 0:06:55
72000 -- (-1800.300) [-1801.342] (-1787.497) (-1795.897) * (-1790.001) (-1789.864) [-1792.382] (-1791.141) -- 0:06:52
72500 -- (-1799.182) (-1790.718) [-1791.776] (-1787.898) * (-1789.344) [-1786.341] (-1790.069) (-1801.579) -- 0:06:49
73000 -- (-1796.301) (-1796.404) [-1788.037] (-1792.187) * (-1795.301) (-1797.122) (-1802.778) [-1791.249] -- 0:06:59
73500 -- (-1791.035) (-1795.205) (-1795.178) [-1785.277] * [-1787.862] (-1785.784) (-1811.188) (-1788.663) -- 0:06:55
74000 -- (-1793.977) [-1794.420] (-1789.965) (-1796.618) * (-1795.748) (-1793.025) (-1796.073) [-1791.129] -- 0:06:52
74500 -- [-1789.551] (-1789.894) (-1788.131) (-1788.797) * (-1790.278) (-1787.817) [-1788.610] (-1791.785) -- 0:06:49
75000 -- (-1797.322) (-1793.758) [-1787.783] (-1793.001) * (-1792.237) [-1789.411] (-1792.078) (-1794.689) -- 0:06:59
Average standard deviation of split frequencies: 0.017654
75500 -- (-1797.137) [-1787.054] (-1791.146) (-1787.506) * (-1793.063) [-1786.731] (-1790.745) (-1797.167) -- 0:06:56
76000 -- (-1786.388) [-1787.871] (-1791.597) (-1788.007) * (-1787.502) [-1790.079] (-1800.258) (-1798.479) -- 0:06:53
76500 -- (-1795.740) (-1791.854) (-1790.309) [-1791.267] * [-1789.327] (-1799.483) (-1798.063) (-1793.222) -- 0:06:50
77000 -- (-1801.161) (-1799.027) (-1792.312) [-1789.982] * [-1791.201] (-1794.306) (-1787.135) (-1792.078) -- 0:06:47
77500 -- [-1789.754] (-1796.234) (-1790.237) (-1793.924) * (-1791.383) (-1785.599) [-1792.149] (-1802.162) -- 0:06:56
78000 -- (-1790.497) (-1792.661) [-1786.517] (-1800.113) * (-1799.966) [-1792.441] (-1794.060) (-1789.832) -- 0:06:53
78500 -- (-1787.089) [-1797.722] (-1793.805) (-1791.239) * (-1797.037) (-1792.002) [-1795.340] (-1792.854) -- 0:06:50
79000 -- [-1786.735] (-1789.853) (-1792.178) (-1799.320) * (-1797.152) (-1793.584) [-1786.187] (-1795.056) -- 0:06:48
79500 -- (-1794.975) (-1788.514) [-1783.866] (-1787.583) * (-1804.216) [-1797.942] (-1785.964) (-1789.798) -- 0:06:56
80000 -- (-1798.622) (-1800.110) (-1785.566) [-1793.618] * (-1793.833) (-1793.611) (-1792.006) [-1786.467] -- 0:06:54
Average standard deviation of split frequencies: 0.012662
80500 -- (-1794.823) (-1799.167) [-1787.198] (-1798.995) * (-1797.890) (-1802.828) (-1795.650) [-1792.091] -- 0:06:51
81000 -- (-1797.292) (-1795.082) [-1785.001] (-1800.256) * (-1800.810) (-1793.203) (-1798.834) [-1790.633] -- 0:06:48
81500 -- (-1799.714) [-1788.845] (-1787.658) (-1802.524) * (-1791.555) [-1796.265] (-1788.267) (-1789.140) -- 0:06:45
82000 -- (-1788.347) (-1786.025) (-1789.447) [-1794.523] * (-1794.376) (-1793.596) (-1796.407) [-1792.008] -- 0:06:54
82500 -- [-1790.296] (-1791.393) (-1788.774) (-1786.004) * [-1795.726] (-1797.263) (-1792.316) (-1800.544) -- 0:06:51
83000 -- (-1795.195) (-1789.505) (-1795.741) [-1786.899] * [-1794.502] (-1786.981) (-1788.895) (-1791.200) -- 0:06:48
83500 -- [-1791.548] (-1793.658) (-1784.854) (-1790.700) * (-1797.501) (-1794.525) (-1788.955) [-1796.196] -- 0:06:46
84000 -- (-1788.287) [-1795.073] (-1803.938) (-1793.956) * (-1796.664) [-1790.057] (-1791.220) (-1801.763) -- 0:06:54
84500 -- (-1786.641) [-1786.481] (-1794.929) (-1796.666) * (-1792.804) (-1795.100) (-1788.441) [-1796.133] -- 0:06:51
85000 -- (-1797.163) [-1785.672] (-1792.027) (-1793.549) * (-1793.253) [-1793.972] (-1791.258) (-1796.882) -- 0:06:49
Average standard deviation of split frequencies: 0.010506
85500 -- (-1794.632) [-1785.112] (-1797.195) (-1786.895) * [-1788.747] (-1785.796) (-1790.945) (-1794.141) -- 0:06:46
86000 -- (-1798.455) (-1790.646) [-1794.896] (-1794.391) * (-1801.935) (-1790.191) [-1790.604] (-1797.596) -- 0:06:43
86500 -- (-1798.229) (-1795.740) [-1791.988] (-1790.701) * (-1794.731) (-1794.141) (-1788.789) [-1790.216] -- 0:06:51
87000 -- (-1793.184) (-1789.964) [-1789.143] (-1793.853) * (-1799.523) (-1789.173) (-1798.026) [-1786.462] -- 0:06:49
87500 -- (-1798.057) [-1780.853] (-1795.165) (-1797.837) * (-1794.241) [-1790.223] (-1804.278) (-1792.583) -- 0:06:46
88000 -- (-1798.361) (-1800.891) (-1796.055) [-1784.857] * (-1792.694) [-1789.270] (-1802.567) (-1793.590) -- 0:06:44
88500 -- [-1789.451] (-1789.750) (-1801.362) (-1796.840) * (-1799.566) [-1789.845] (-1798.689) (-1797.580) -- 0:06:51
89000 -- [-1792.600] (-1791.377) (-1790.926) (-1785.605) * (-1787.898) (-1789.282) [-1792.567] (-1787.558) -- 0:06:49
89500 -- [-1791.485] (-1795.329) (-1789.471) (-1793.225) * (-1799.066) (-1791.640) (-1796.451) [-1788.860] -- 0:06:46
90000 -- (-1795.976) [-1785.109] (-1790.264) (-1785.834) * (-1797.087) (-1788.001) (-1787.436) [-1785.626] -- 0:06:44
Average standard deviation of split frequencies: 0.014298
90500 -- [-1795.330] (-1793.579) (-1785.314) (-1793.929) * [-1787.687] (-1789.117) (-1792.387) (-1793.957) -- 0:06:52
91000 -- (-1790.522) (-1798.234) (-1787.485) [-1786.539] * (-1790.998) [-1790.502] (-1790.914) (-1803.089) -- 0:06:49
91500 -- (-1800.726) [-1794.305] (-1794.331) (-1793.992) * (-1791.015) (-1798.022) (-1790.397) [-1788.049] -- 0:06:47
92000 -- [-1791.464] (-1792.758) (-1799.597) (-1786.053) * (-1809.988) (-1799.207) (-1791.130) [-1805.099] -- 0:06:44
92500 -- (-1789.265) (-1794.977) [-1790.831] (-1795.299) * (-1800.833) [-1784.833] (-1798.765) (-1796.677) -- 0:06:42
93000 -- (-1789.501) (-1793.684) (-1793.130) [-1786.529] * (-1798.070) (-1794.660) [-1796.378] (-1797.815) -- 0:06:49
93500 -- (-1794.319) [-1784.816] (-1790.260) (-1786.933) * (-1789.015) (-1794.253) (-1795.391) [-1795.341] -- 0:06:47
94000 -- [-1786.133] (-1785.945) (-1796.707) (-1790.203) * (-1796.601) (-1795.921) (-1800.579) [-1789.961] -- 0:06:44
94500 -- (-1791.657) [-1792.721] (-1791.202) (-1795.770) * (-1789.327) (-1791.849) (-1794.604) [-1791.204] -- 0:06:42
95000 -- (-1792.891) (-1792.398) [-1793.117] (-1798.344) * (-1799.313) [-1791.597] (-1794.307) (-1786.438) -- 0:06:49
Average standard deviation of split frequencies: 0.013095
95500 -- (-1794.265) (-1787.447) [-1794.344] (-1785.689) * (-1798.647) (-1788.997) (-1807.621) [-1793.388] -- 0:06:47
96000 -- (-1801.832) [-1787.597] (-1790.534) (-1787.545) * (-1805.985) (-1789.226) [-1795.298] (-1790.688) -- 0:06:44
96500 -- (-1794.139) (-1802.636) [-1788.963] (-1789.024) * [-1785.044] (-1787.972) (-1791.884) (-1791.219) -- 0:06:42
97000 -- (-1792.962) [-1785.990] (-1785.689) (-1796.475) * [-1790.724] (-1796.067) (-1795.666) (-1789.795) -- 0:06:49
97500 -- (-1788.479) [-1794.026] (-1794.268) (-1794.452) * (-1795.679) (-1795.759) [-1795.240] (-1790.625) -- 0:06:47
98000 -- (-1794.109) (-1797.151) [-1788.964] (-1796.127) * (-1794.392) [-1796.141] (-1794.692) (-1801.209) -- 0:06:44
98500 -- (-1797.468) (-1793.527) (-1793.829) [-1796.725] * (-1790.277) [-1795.415] (-1803.251) (-1782.223) -- 0:06:42
99000 -- (-1795.768) (-1790.432) (-1793.641) [-1790.671] * (-1803.710) (-1789.477) (-1796.184) [-1796.254] -- 0:06:40
99500 -- (-1793.099) (-1787.833) (-1790.621) [-1792.438] * (-1791.559) [-1793.279] (-1796.949) (-1793.277) -- 0:06:47
100000 -- (-1798.719) [-1792.816] (-1795.178) (-1794.480) * (-1791.430) (-1788.963) (-1791.287) [-1791.772] -- 0:06:45
Average standard deviation of split frequencies: 0.013658
100500 -- (-1792.502) (-1797.809) [-1793.258] (-1792.772) * (-1811.640) [-1791.163] (-1787.433) (-1799.529) -- 0:06:42
101000 -- [-1795.746] (-1800.492) (-1796.484) (-1792.197) * [-1786.715] (-1793.293) (-1803.123) (-1798.837) -- 0:06:40
101500 -- (-1789.849) (-1794.209) [-1795.472] (-1788.707) * [-1787.839] (-1788.184) (-1794.246) (-1790.881) -- 0:06:47
102000 -- (-1794.686) (-1790.087) (-1797.056) [-1794.573] * (-1795.377) (-1788.538) (-1795.519) [-1796.821] -- 0:06:44
102500 -- (-1789.384) (-1800.486) (-1795.200) [-1791.652] * (-1785.581) (-1794.919) (-1790.904) [-1787.378] -- 0:06:42
103000 -- (-1789.019) (-1792.550) [-1793.909] (-1789.885) * (-1787.193) [-1794.055] (-1791.678) (-1786.477) -- 0:06:40
103500 -- (-1791.059) (-1803.132) [-1788.917] (-1783.988) * (-1793.797) [-1792.143] (-1796.858) (-1792.923) -- 0:06:38
104000 -- (-1790.150) (-1792.883) (-1789.528) [-1793.301] * (-1790.305) [-1786.398] (-1791.162) (-1791.945) -- 0:06:44
104500 -- (-1794.741) (-1789.848) (-1789.579) [-1789.855] * (-1789.958) (-1794.081) (-1786.592) [-1793.155] -- 0:06:42
105000 -- (-1789.076) (-1795.974) (-1794.171) [-1787.342] * (-1793.811) (-1796.624) [-1794.092] (-1788.691) -- 0:06:40
Average standard deviation of split frequencies: 0.015936
105500 -- (-1801.298) (-1789.349) [-1787.590] (-1788.149) * [-1797.909] (-1792.631) (-1793.666) (-1796.152) -- 0:06:38
106000 -- (-1797.721) [-1792.745] (-1796.474) (-1799.621) * (-1789.424) [-1792.536] (-1789.689) (-1807.481) -- 0:06:44
106500 -- (-1792.025) [-1787.873] (-1797.189) (-1789.495) * (-1793.500) (-1790.446) (-1789.419) [-1788.811] -- 0:06:42
107000 -- (-1789.280) (-1788.319) (-1794.808) [-1793.929] * (-1792.682) (-1794.037) (-1795.102) [-1791.417] -- 0:06:40
107500 -- (-1795.571) [-1788.000] (-1800.637) (-1791.175) * (-1800.672) (-1787.779) [-1791.439] (-1794.522) -- 0:06:38
108000 -- (-1795.358) (-1788.640) (-1798.493) [-1787.267] * (-1797.005) [-1795.025] (-1800.839) (-1800.071) -- 0:06:44
108500 -- (-1790.754) (-1798.395) (-1799.178) [-1793.217] * (-1792.418) (-1794.670) (-1796.050) [-1788.704] -- 0:06:42
109000 -- (-1791.056) [-1790.531] (-1797.568) (-1792.575) * (-1795.390) (-1793.312) (-1788.183) [-1788.701] -- 0:06:40
109500 -- (-1783.161) [-1792.039] (-1785.224) (-1805.493) * [-1794.919] (-1808.498) (-1793.348) (-1790.848) -- 0:06:38
110000 -- (-1789.919) [-1794.558] (-1795.885) (-1794.594) * (-1793.377) (-1794.919) [-1792.520] (-1794.894) -- 0:06:36
Average standard deviation of split frequencies: 0.013489
110500 -- (-1803.636) (-1787.492) [-1798.749] (-1792.448) * [-1791.732] (-1785.367) (-1796.830) (-1791.003) -- 0:06:42
111000 -- (-1788.754) [-1789.036] (-1794.040) (-1790.278) * [-1789.070] (-1791.086) (-1801.853) (-1795.680) -- 0:06:40
111500 -- (-1786.585) [-1785.988] (-1790.893) (-1786.894) * (-1795.012) [-1796.513] (-1793.293) (-1786.838) -- 0:06:38
112000 -- (-1788.070) (-1786.005) (-1788.164) [-1786.008] * (-1788.658) (-1787.879) [-1789.991] (-1798.929) -- 0:06:36
112500 -- (-1785.091) (-1792.575) [-1790.697] (-1792.959) * [-1792.887] (-1791.075) (-1800.609) (-1792.808) -- 0:06:42
113000 -- (-1792.408) (-1793.012) [-1793.809] (-1794.819) * (-1797.227) (-1786.982) (-1801.408) [-1789.901] -- 0:06:40
113500 -- (-1785.996) [-1799.640] (-1794.198) (-1792.689) * (-1787.333) [-1792.622] (-1797.434) (-1802.572) -- 0:06:38
114000 -- (-1794.998) (-1795.579) (-1793.625) [-1796.057] * (-1786.369) (-1796.157) [-1781.532] (-1796.663) -- 0:06:36
114500 -- [-1790.983] (-1799.641) (-1793.887) (-1796.215) * (-1790.047) (-1799.052) [-1787.127] (-1792.498) -- 0:06:34
115000 -- (-1789.819) (-1792.843) (-1786.645) [-1793.295] * (-1788.514) [-1792.948] (-1787.792) (-1785.877) -- 0:06:40
Average standard deviation of split frequencies: 0.012191
115500 -- [-1787.673] (-1794.746) (-1790.272) (-1791.034) * (-1794.968) (-1788.559) (-1797.221) [-1786.909] -- 0:06:38
116000 -- (-1801.751) (-1788.585) (-1788.639) [-1794.819] * [-1789.836] (-1792.122) (-1785.040) (-1789.807) -- 0:06:36
116500 -- (-1791.969) (-1787.468) (-1787.920) [-1793.841] * (-1794.307) (-1791.893) [-1789.882] (-1789.410) -- 0:06:34
117000 -- (-1788.203) (-1791.810) [-1782.788] (-1787.684) * (-1795.519) [-1795.498] (-1798.836) (-1789.112) -- 0:06:39
117500 -- [-1786.768] (-1794.700) (-1789.491) (-1794.611) * (-1798.564) (-1794.190) (-1797.107) [-1790.896] -- 0:06:38
118000 -- [-1790.193] (-1795.327) (-1795.162) (-1788.372) * (-1796.002) (-1794.600) (-1798.061) [-1788.532] -- 0:06:36
118500 -- (-1794.964) (-1798.853) [-1787.578] (-1791.250) * (-1792.930) (-1798.016) [-1791.404] (-1792.124) -- 0:06:34
119000 -- (-1793.590) [-1795.294] (-1786.615) (-1792.725) * [-1796.913] (-1799.492) (-1795.653) (-1797.297) -- 0:06:39
119500 -- (-1793.150) [-1793.284] (-1793.931) (-1790.692) * (-1788.645) (-1793.831) (-1792.970) [-1789.062] -- 0:06:37
120000 -- (-1799.504) (-1797.581) [-1789.983] (-1788.977) * (-1796.804) [-1798.897] (-1799.141) (-1787.681) -- 0:06:36
Average standard deviation of split frequencies: 0.009116
120500 -- (-1794.607) (-1791.286) (-1789.568) [-1793.049] * (-1797.584) (-1797.573) (-1795.673) [-1780.084] -- 0:06:34
121000 -- (-1792.029) (-1795.727) [-1783.817] (-1791.134) * [-1800.062] (-1798.678) (-1795.488) (-1789.028) -- 0:06:32
121500 -- (-1800.015) [-1790.687] (-1791.881) (-1786.341) * (-1800.126) (-1805.909) (-1789.512) [-1783.841] -- 0:06:37
122000 -- [-1789.895] (-1787.584) (-1795.347) (-1789.838) * (-1793.053) (-1788.945) (-1794.938) [-1790.267] -- 0:06:35
122500 -- [-1785.628] (-1782.716) (-1787.158) (-1787.843) * (-1787.260) (-1786.131) (-1798.947) [-1781.567] -- 0:06:33
123000 -- (-1790.859) [-1791.643] (-1786.918) (-1801.246) * (-1786.049) (-1790.826) (-1791.087) [-1788.938] -- 0:06:32
123500 -- (-1801.945) [-1789.222] (-1784.935) (-1812.144) * (-1795.146) (-1783.901) (-1799.208) [-1785.408] -- 0:06:37
124000 -- [-1793.016] (-1792.184) (-1801.357) (-1787.990) * [-1787.263] (-1790.338) (-1791.969) (-1796.933) -- 0:06:35
124500 -- [-1794.692] (-1791.919) (-1786.617) (-1795.508) * [-1788.031] (-1795.315) (-1794.276) (-1797.272) -- 0:06:33
125000 -- (-1800.489) (-1790.256) [-1791.035] (-1791.764) * (-1800.738) [-1786.037] (-1795.482) (-1800.212) -- 0:06:32
Average standard deviation of split frequencies: 0.006859
125500 -- (-1802.873) [-1789.633] (-1787.452) (-1787.283) * (-1803.685) (-1786.844) (-1795.206) [-1789.763] -- 0:06:37
126000 -- (-1796.544) (-1787.407) [-1789.487] (-1792.816) * (-1797.544) (-1803.159) [-1790.107] (-1789.708) -- 0:06:35
126500 -- [-1786.463] (-1791.815) (-1794.489) (-1792.721) * (-1791.685) [-1785.335] (-1794.252) (-1791.148) -- 0:06:33
127000 -- (-1790.362) (-1795.398) [-1788.461] (-1796.785) * (-1794.893) (-1793.485) (-1795.344) [-1790.865] -- 0:06:31
127500 -- (-1795.572) (-1793.523) (-1786.394) [-1800.249] * (-1786.410) (-1787.853) (-1795.363) [-1785.389] -- 0:06:30
128000 -- (-1787.159) (-1803.545) [-1788.924] (-1794.033) * (-1783.718) (-1795.491) (-1800.766) [-1785.704] -- 0:06:35
128500 -- [-1790.200] (-1789.249) (-1786.646) (-1799.227) * (-1798.090) (-1797.600) (-1788.850) [-1787.350] -- 0:06:33
129000 -- (-1792.437) (-1798.229) [-1791.669] (-1788.129) * (-1793.915) (-1787.451) [-1786.924] (-1795.547) -- 0:06:31
129500 -- (-1793.942) (-1796.879) (-1791.870) [-1789.024] * (-1793.707) [-1788.987] (-1792.149) (-1802.652) -- 0:06:29
130000 -- (-1791.499) [-1791.273] (-1790.947) (-1793.667) * (-1796.513) (-1792.613) [-1795.742] (-1800.724) -- 0:06:34
Average standard deviation of split frequencies: 0.009320
130500 -- (-1798.867) (-1787.843) (-1796.670) [-1792.742] * (-1789.001) [-1785.933] (-1788.711) (-1788.023) -- 0:06:33
131000 -- (-1783.470) (-1793.552) [-1792.513] (-1788.080) * [-1797.559] (-1789.082) (-1799.444) (-1795.084) -- 0:06:31
131500 -- (-1787.070) (-1801.824) (-1789.925) [-1796.509] * (-1797.496) (-1792.491) (-1790.697) [-1797.303] -- 0:06:29
132000 -- (-1795.761) (-1794.284) [-1790.283] (-1794.363) * (-1800.411) (-1786.493) (-1787.591) [-1788.702] -- 0:06:27
132500 -- (-1795.068) [-1794.050] (-1799.499) (-1793.232) * (-1793.969) (-1804.446) [-1794.513] (-1796.134) -- 0:06:32
133000 -- (-1796.252) [-1786.351] (-1796.186) (-1792.539) * (-1790.526) (-1796.673) [-1790.126] (-1794.122) -- 0:06:31
133500 -- (-1787.681) (-1789.579) [-1798.538] (-1795.583) * [-1796.818] (-1789.218) (-1795.845) (-1790.192) -- 0:06:29
134000 -- (-1793.859) [-1794.627] (-1790.963) (-1790.697) * (-1793.270) (-1787.488) (-1804.804) [-1792.568] -- 0:06:27
134500 -- [-1803.000] (-1807.076) (-1811.121) (-1794.725) * (-1794.494) (-1788.273) [-1802.838] (-1798.737) -- 0:06:32
135000 -- (-1798.234) [-1790.045] (-1801.872) (-1804.657) * (-1783.365) [-1787.585] (-1797.597) (-1792.860) -- 0:06:30
Average standard deviation of split frequencies: 0.010110
135500 -- [-1790.820] (-1793.310) (-1794.702) (-1794.449) * (-1795.118) (-1796.929) [-1798.606] (-1789.673) -- 0:06:29
136000 -- (-1791.811) [-1787.783] (-1792.110) (-1788.030) * (-1792.625) (-1789.970) [-1788.599] (-1784.258) -- 0:06:27
136500 -- (-1794.239) (-1794.537) (-1790.742) [-1787.526] * (-1792.210) [-1792.026] (-1787.677) (-1795.349) -- 0:06:32
137000 -- [-1793.353] (-1798.335) (-1807.530) (-1791.428) * (-1795.686) [-1790.605] (-1796.404) (-1787.548) -- 0:06:30
137500 -- (-1793.937) (-1791.072) [-1786.142] (-1799.979) * (-1795.228) (-1788.051) (-1786.758) [-1788.593] -- 0:06:28
138000 -- (-1792.719) (-1791.746) [-1790.678] (-1791.015) * (-1792.340) (-1795.800) [-1784.538] (-1791.104) -- 0:06:27
138500 -- (-1798.732) (-1798.016) [-1792.064] (-1794.577) * (-1791.799) (-1788.787) (-1789.506) [-1792.293] -- 0:06:25
139000 -- (-1803.288) (-1802.673) (-1792.463) [-1790.386] * (-1803.663) (-1793.532) [-1788.989] (-1789.226) -- 0:06:30
139500 -- (-1795.185) (-1784.425) [-1785.001] (-1798.083) * (-1794.778) (-1798.881) (-1789.897) [-1789.431] -- 0:06:28
140000 -- (-1795.778) (-1799.987) [-1787.138] (-1793.130) * (-1803.018) (-1801.124) [-1790.355] (-1789.223) -- 0:06:27
Average standard deviation of split frequencies: 0.015080
140500 -- [-1789.796] (-1802.664) (-1782.019) (-1802.460) * (-1792.421) (-1799.058) [-1788.755] (-1794.612) -- 0:06:25
141000 -- (-1789.526) (-1791.129) (-1792.894) [-1792.999] * [-1788.029] (-1788.535) (-1800.452) (-1791.070) -- 0:06:29
141500 -- (-1788.319) (-1790.254) [-1786.910] (-1797.494) * [-1789.121] (-1790.546) (-1795.092) (-1790.730) -- 0:06:28
142000 -- (-1789.244) (-1793.356) [-1790.113] (-1795.237) * (-1789.103) [-1789.246] (-1788.232) (-1785.566) -- 0:06:26
142500 -- (-1785.180) (-1796.742) (-1795.180) [-1791.862] * [-1786.623] (-1787.556) (-1792.592) (-1787.494) -- 0:06:25
143000 -- [-1790.346] (-1790.163) (-1792.182) (-1792.737) * [-1791.853] (-1787.536) (-1791.751) (-1787.757) -- 0:06:29
143500 -- (-1783.810) (-1788.959) (-1793.441) [-1787.018] * [-1786.955] (-1788.726) (-1795.405) (-1801.797) -- 0:06:27
144000 -- (-1801.898) (-1790.513) (-1811.491) [-1789.963] * (-1797.444) [-1788.210] (-1794.352) (-1791.575) -- 0:06:26
144500 -- (-1791.484) (-1792.279) [-1791.020] (-1795.627) * [-1791.107] (-1789.630) (-1792.129) (-1788.299) -- 0:06:24
145000 -- (-1788.227) [-1791.375] (-1793.980) (-1793.874) * (-1790.818) (-1800.650) [-1788.551] (-1788.239) -- 0:06:23
Average standard deviation of split frequencies: 0.016682
145500 -- (-1795.708) (-1789.144) [-1792.423] (-1803.471) * [-1790.874] (-1795.091) (-1800.061) (-1793.142) -- 0:06:27
146000 -- (-1797.982) [-1788.489] (-1794.219) (-1795.442) * (-1796.752) (-1800.256) (-1803.635) [-1784.767] -- 0:06:26
146500 -- (-1793.775) [-1785.187] (-1789.852) (-1805.663) * (-1793.133) (-1791.359) [-1785.084] (-1796.449) -- 0:06:24
147000 -- (-1791.415) (-1789.615) (-1802.663) [-1786.714] * (-1788.268) [-1789.171] (-1782.051) (-1788.998) -- 0:06:22
147500 -- (-1789.949) (-1787.720) (-1790.207) [-1787.640] * (-1795.976) [-1789.252] (-1790.193) (-1793.791) -- 0:06:27
148000 -- (-1788.449) (-1803.316) [-1796.461] (-1785.872) * (-1790.229) (-1794.260) [-1799.784] (-1794.570) -- 0:06:25
148500 -- (-1792.549) (-1803.525) [-1797.275] (-1791.753) * (-1794.654) (-1794.161) [-1789.365] (-1800.294) -- 0:06:24
149000 -- (-1788.240) (-1807.522) (-1798.489) [-1790.951] * (-1785.938) (-1795.419) [-1783.851] (-1793.047) -- 0:06:22
149500 -- (-1785.132) (-1801.510) [-1795.118] (-1788.601) * (-1796.177) [-1789.925] (-1793.058) (-1795.047) -- 0:06:21
150000 -- [-1791.553] (-1814.170) (-1801.708) (-1792.814) * (-1798.148) [-1784.753] (-1788.679) (-1783.835) -- 0:06:25
Average standard deviation of split frequencies: 0.014862
150500 -- [-1792.154] (-1794.589) (-1791.041) (-1792.551) * (-1786.389) (-1789.047) (-1787.413) [-1788.186] -- 0:06:23
151000 -- (-1791.815) (-1798.527) (-1796.279) [-1786.995] * (-1787.710) (-1785.898) (-1803.185) [-1784.755] -- 0:06:22
151500 -- [-1788.295] (-1795.379) (-1796.654) (-1788.645) * (-1796.719) (-1790.125) (-1793.068) [-1789.897] -- 0:06:20
152000 -- (-1794.009) (-1789.879) (-1800.976) [-1782.781] * (-1793.354) [-1789.344] (-1813.526) (-1793.257) -- 0:06:24
152500 -- (-1794.431) (-1785.201) (-1798.009) [-1786.559] * (-1788.473) (-1790.817) (-1795.173) [-1787.290] -- 0:06:23
153000 -- (-1797.238) (-1785.744) (-1794.319) [-1792.774] * (-1793.155) [-1794.621] (-1790.875) (-1792.339) -- 0:06:21
153500 -- (-1787.600) (-1786.560) [-1791.067] (-1796.839) * (-1782.352) (-1789.993) (-1792.751) [-1790.122] -- 0:06:20
154000 -- (-1791.093) (-1783.521) (-1793.231) [-1784.703] * [-1788.085] (-1793.358) (-1790.064) (-1788.020) -- 0:06:19
154500 -- [-1790.022] (-1787.423) (-1787.323) (-1787.560) * (-1796.014) (-1797.149) (-1789.741) [-1788.580] -- 0:06:23
155000 -- (-1795.735) (-1787.280) [-1790.612] (-1799.227) * (-1795.485) [-1789.349] (-1797.905) (-1786.474) -- 0:06:21
Average standard deviation of split frequencies: 0.015865
155500 -- [-1791.853] (-1794.156) (-1794.289) (-1788.848) * (-1781.716) (-1796.884) (-1782.826) [-1799.103] -- 0:06:20
156000 -- (-1790.143) (-1789.527) [-1785.349] (-1789.328) * (-1789.925) [-1784.595] (-1795.303) (-1792.096) -- 0:06:18
156500 -- (-1793.208) (-1787.190) (-1790.067) [-1792.210] * (-1789.191) [-1792.728] (-1788.866) (-1793.977) -- 0:06:22
157000 -- [-1782.089] (-1791.712) (-1789.775) (-1788.660) * (-1798.276) (-1796.130) (-1790.852) [-1783.382] -- 0:06:21
157500 -- (-1787.541) (-1785.609) (-1789.472) [-1797.379] * (-1797.999) (-1791.652) (-1795.854) [-1786.298] -- 0:06:19
158000 -- (-1781.760) [-1793.102] (-1788.545) (-1794.081) * (-1797.672) (-1790.001) [-1792.677] (-1788.957) -- 0:06:18
158500 -- (-1789.187) (-1797.826) [-1783.404] (-1793.696) * (-1790.670) (-1800.464) (-1786.845) [-1789.444] -- 0:06:22
159000 -- [-1786.487] (-1797.011) (-1793.709) (-1794.822) * (-1786.425) (-1792.935) (-1788.052) [-1788.506] -- 0:06:20
159500 -- (-1790.029) (-1792.940) [-1797.432] (-1791.302) * [-1786.073] (-1789.203) (-1791.121) (-1797.531) -- 0:06:19
160000 -- (-1789.393) (-1788.652) (-1783.079) [-1792.682] * [-1790.412] (-1788.389) (-1791.679) (-1790.716) -- 0:06:18
Average standard deviation of split frequencies: 0.018582
160500 -- (-1792.539) (-1807.875) [-1793.046] (-1794.274) * [-1810.249] (-1798.984) (-1791.538) (-1787.384) -- 0:06:16
161000 -- (-1787.961) (-1800.049) [-1790.432] (-1792.596) * (-1792.585) (-1793.924) (-1793.585) [-1788.840] -- 0:06:20
161500 -- (-1789.307) (-1794.355) (-1791.059) [-1786.093] * (-1794.126) [-1789.913] (-1797.597) (-1787.095) -- 0:06:19
162000 -- (-1793.847) [-1794.396] (-1796.462) (-1784.320) * [-1796.873] (-1792.961) (-1791.444) (-1786.412) -- 0:06:17
162500 -- (-1794.081) (-1801.678) (-1796.283) [-1790.669] * (-1792.947) (-1788.777) (-1793.647) [-1798.029] -- 0:06:16
163000 -- (-1798.834) (-1800.205) [-1797.008] (-1789.527) * (-1794.845) (-1790.055) [-1794.934] (-1797.835) -- 0:06:19
163500 -- (-1797.233) [-1800.948] (-1794.612) (-1793.867) * (-1804.043) (-1790.752) (-1798.947) [-1786.232] -- 0:06:18
164000 -- [-1797.006] (-1795.091) (-1789.618) (-1792.960) * (-1793.682) (-1787.015) [-1787.439] (-1786.862) -- 0:06:17
164500 -- (-1798.830) (-1801.911) [-1786.596] (-1786.502) * [-1791.492] (-1786.045) (-1790.355) (-1811.386) -- 0:06:15
165000 -- (-1792.311) (-1788.936) [-1787.966] (-1786.361) * (-1790.823) [-1793.128] (-1796.522) (-1787.678) -- 0:06:14
Average standard deviation of split frequencies: 0.021535
165500 -- (-1791.731) (-1785.374) [-1787.814] (-1787.495) * (-1794.324) (-1789.988) [-1794.246] (-1784.245) -- 0:06:18
166000 -- [-1786.855] (-1798.356) (-1786.888) (-1791.845) * (-1794.082) (-1792.129) (-1787.587) [-1788.111] -- 0:06:16
166500 -- (-1795.924) [-1791.552] (-1784.236) (-1795.041) * [-1793.820] (-1790.640) (-1788.704) (-1788.280) -- 0:06:15
167000 -- (-1794.290) (-1796.084) (-1805.127) [-1796.963] * [-1795.257] (-1793.322) (-1788.482) (-1793.691) -- 0:06:14
167500 -- [-1789.589] (-1796.010) (-1787.549) (-1801.558) * (-1797.680) (-1804.459) (-1800.694) [-1789.065] -- 0:06:17
168000 -- [-1790.552] (-1793.222) (-1789.647) (-1806.161) * [-1787.895] (-1798.296) (-1785.818) (-1801.757) -- 0:06:16
168500 -- [-1786.933] (-1797.817) (-1789.738) (-1791.068) * (-1791.062) (-1798.595) [-1783.622] (-1793.272) -- 0:06:15
169000 -- (-1802.016) (-1803.068) (-1789.928) [-1797.653] * [-1797.764] (-1802.423) (-1799.232) (-1785.625) -- 0:06:13
169500 -- (-1790.727) (-1802.896) [-1788.227] (-1791.561) * [-1785.055] (-1794.472) (-1803.268) (-1786.705) -- 0:06:12
170000 -- (-1793.233) (-1796.200) (-1790.628) [-1793.556] * [-1792.265] (-1790.583) (-1793.934) (-1796.337) -- 0:06:15
Average standard deviation of split frequencies: 0.021407
170500 -- (-1791.171) (-1797.436) [-1793.658] (-1789.911) * (-1787.680) (-1787.424) (-1784.765) [-1790.059] -- 0:06:14
171000 -- (-1795.369) (-1791.548) (-1793.002) [-1784.625] * (-1794.286) (-1793.118) [-1791.761] (-1785.864) -- 0:06:13
171500 -- (-1797.279) (-1797.218) [-1789.049] (-1787.140) * (-1792.331) [-1794.601] (-1791.059) (-1794.293) -- 0:06:11
172000 -- (-1792.649) (-1803.192) (-1800.441) [-1785.921] * (-1797.677) [-1799.866] (-1786.866) (-1798.345) -- 0:06:15
172500 -- [-1785.762] (-1801.252) (-1790.337) (-1786.460) * [-1783.854] (-1788.734) (-1788.852) (-1797.978) -- 0:06:14
173000 -- (-1786.860) (-1789.738) [-1793.003] (-1791.479) * (-1794.333) (-1789.227) (-1786.321) [-1781.598] -- 0:06:12
173500 -- (-1788.595) (-1796.233) (-1793.047) [-1788.826] * (-1797.528) (-1798.980) (-1794.211) [-1788.847] -- 0:06:11
174000 -- (-1789.467) [-1786.660] (-1784.631) (-1787.710) * (-1795.572) [-1792.013] (-1782.900) (-1787.218) -- 0:06:10
174500 -- (-1791.851) (-1788.457) (-1787.108) [-1788.284] * (-1794.863) (-1785.968) [-1788.236] (-1788.484) -- 0:06:13
175000 -- (-1792.629) (-1793.705) [-1793.806] (-1793.031) * (-1796.532) (-1787.384) (-1790.165) [-1796.685] -- 0:06:12
Average standard deviation of split frequencies: 0.021874
175500 -- [-1791.845] (-1793.656) (-1790.803) (-1798.733) * [-1791.906] (-1784.302) (-1784.481) (-1787.235) -- 0:06:11
176000 -- (-1798.143) [-1794.444] (-1791.126) (-1793.831) * (-1800.802) [-1793.756] (-1787.640) (-1783.486) -- 0:06:09
176500 -- [-1792.414] (-1786.519) (-1799.164) (-1788.535) * [-1794.676] (-1791.135) (-1790.871) (-1789.081) -- 0:06:13
177000 -- (-1786.338) (-1796.095) [-1787.144] (-1789.035) * (-1793.635) (-1803.405) (-1798.674) [-1786.075] -- 0:06:11
177500 -- (-1786.530) (-1796.917) [-1800.333] (-1801.040) * [-1795.426] (-1790.835) (-1795.864) (-1794.525) -- 0:06:10
178000 -- (-1789.089) [-1794.257] (-1791.448) (-1796.379) * (-1791.496) [-1793.496] (-1799.821) (-1793.823) -- 0:06:09
178500 -- (-1795.716) [-1787.785] (-1793.728) (-1789.234) * (-1791.995) [-1790.897] (-1804.713) (-1791.818) -- 0:06:12
179000 -- (-1793.131) (-1793.637) (-1801.307) [-1789.853] * (-1783.347) (-1786.293) [-1788.736] (-1799.559) -- 0:06:11
179500 -- (-1791.329) (-1796.172) (-1787.613) [-1784.997] * (-1792.809) [-1789.147] (-1791.706) (-1802.635) -- 0:06:10
180000 -- (-1793.244) (-1785.444) (-1788.464) [-1789.871] * (-1790.917) (-1788.475) [-1790.587] (-1794.272) -- 0:06:09
Average standard deviation of split frequencies: 0.019352
180500 -- (-1791.189) [-1792.240] (-1798.258) (-1786.594) * (-1784.919) [-1789.678] (-1793.390) (-1791.816) -- 0:06:07
181000 -- (-1787.076) (-1787.448) (-1796.860) [-1790.756] * [-1791.281] (-1796.771) (-1790.493) (-1793.011) -- 0:06:11
181500 -- (-1786.430) (-1796.904) [-1795.456] (-1800.730) * (-1792.710) (-1799.245) (-1786.949) [-1793.690] -- 0:06:09
182000 -- (-1806.968) (-1787.866) (-1786.448) [-1786.264] * (-1793.728) [-1794.250] (-1789.531) (-1803.084) -- 0:06:08
182500 -- (-1793.001) (-1800.008) [-1786.184] (-1787.565) * (-1790.028) (-1802.765) (-1794.509) [-1790.691] -- 0:06:07
183000 -- (-1792.334) (-1791.435) (-1794.096) [-1788.054] * (-1793.915) [-1791.292] (-1795.562) (-1784.149) -- 0:06:10
183500 -- (-1789.581) (-1802.869) [-1794.048] (-1797.286) * [-1799.446] (-1797.704) (-1797.655) (-1784.484) -- 0:06:09
184000 -- (-1787.885) [-1796.187] (-1795.089) (-1794.368) * [-1785.049] (-1799.945) (-1785.746) (-1794.640) -- 0:06:08
184500 -- (-1798.834) [-1794.494] (-1792.473) (-1793.219) * [-1796.019] (-1796.260) (-1791.608) (-1792.318) -- 0:06:06
185000 -- [-1795.391] (-1789.143) (-1787.842) (-1787.582) * (-1786.228) (-1793.299) [-1786.720] (-1789.623) -- 0:06:05
Average standard deviation of split frequencies: 0.019219
185500 -- (-1793.320) (-1787.414) [-1791.473] (-1790.175) * (-1791.689) (-1795.788) (-1787.841) [-1791.005] -- 0:06:08
186000 -- (-1789.255) (-1789.424) (-1798.015) [-1789.528] * (-1793.221) (-1792.298) (-1792.043) [-1783.699] -- 0:06:07
186500 -- (-1799.920) [-1787.124] (-1795.292) (-1789.255) * [-1790.799] (-1796.690) (-1792.584) (-1795.553) -- 0:06:06
187000 -- (-1790.399) [-1789.312] (-1793.784) (-1792.106) * (-1795.412) (-1789.913) [-1787.315] (-1793.788) -- 0:06:05
187500 -- [-1793.284] (-1787.378) (-1799.968) (-1791.439) * (-1806.118) (-1797.836) [-1790.765] (-1788.891) -- 0:06:08
188000 -- (-1796.012) (-1791.589) [-1792.322] (-1789.027) * (-1802.942) (-1790.006) [-1784.774] (-1786.645) -- 0:06:07
188500 -- (-1789.561) (-1787.012) [-1794.915] (-1793.216) * (-1793.718) (-1792.073) (-1788.140) [-1791.989] -- 0:06:05
189000 -- (-1796.953) (-1788.461) (-1793.385) [-1787.605] * (-1798.031) (-1795.034) [-1785.703] (-1786.521) -- 0:06:04
189500 -- (-1792.558) (-1794.256) (-1802.815) [-1795.063] * (-1803.015) (-1793.764) (-1789.684) [-1803.394] -- 0:06:03
190000 -- (-1787.703) [-1785.735] (-1793.408) (-1794.398) * (-1790.115) (-1793.071) [-1795.316] (-1792.114) -- 0:06:06
Average standard deviation of split frequencies: 0.021015
190500 -- (-1789.333) [-1783.876] (-1794.463) (-1788.676) * (-1794.915) [-1788.335] (-1791.453) (-1787.569) -- 0:06:05
191000 -- (-1796.342) (-1786.522) (-1787.756) [-1785.807] * [-1794.021] (-1799.793) (-1790.582) (-1789.898) -- 0:06:04
191500 -- (-1798.761) (-1788.199) [-1782.595] (-1788.841) * (-1796.536) (-1794.807) (-1792.242) [-1789.065] -- 0:06:03
192000 -- (-1797.567) [-1786.416] (-1793.075) (-1787.276) * (-1806.244) (-1790.714) [-1784.404] (-1802.378) -- 0:06:06
192500 -- (-1790.532) (-1789.591) (-1796.656) [-1788.965] * (-1790.498) (-1790.503) (-1799.738) [-1790.250] -- 0:06:04
193000 -- [-1788.646] (-1805.357) (-1790.907) (-1785.438) * (-1792.970) [-1788.913] (-1788.561) (-1790.066) -- 0:06:03
193500 -- (-1791.361) (-1790.708) (-1786.982) [-1792.783] * (-1789.134) (-1790.364) (-1793.907) [-1787.994] -- 0:06:02
194000 -- (-1786.925) (-1790.106) [-1786.343] (-1789.802) * (-1790.531) [-1789.964] (-1788.677) (-1798.688) -- 0:06:05
194500 -- (-1787.732) (-1790.548) (-1785.528) [-1792.510] * (-1790.127) (-1784.265) (-1789.250) [-1793.043] -- 0:06:04
195000 -- (-1787.714) [-1794.400] (-1780.427) (-1793.455) * (-1790.979) (-1802.671) [-1790.947] (-1802.951) -- 0:06:03
Average standard deviation of split frequencies: 0.020444
195500 -- (-1783.267) (-1792.392) [-1793.695] (-1816.811) * (-1803.794) (-1791.563) (-1787.326) [-1787.152] -- 0:06:02
196000 -- (-1790.670) [-1790.436] (-1787.832) (-1800.200) * (-1795.675) (-1792.683) [-1789.514] (-1785.647) -- 0:06:00
196500 -- (-1796.420) (-1790.056) [-1791.986] (-1789.875) * [-1787.919] (-1793.570) (-1789.074) (-1788.298) -- 0:06:03
197000 -- (-1799.059) [-1787.644] (-1788.544) (-1799.841) * (-1795.900) [-1796.374] (-1795.124) (-1801.021) -- 0:06:02
197500 -- (-1791.747) [-1791.401] (-1792.862) (-1799.012) * (-1788.036) (-1805.165) [-1786.060] (-1787.964) -- 0:06:01
198000 -- (-1791.482) [-1792.942] (-1795.578) (-1791.438) * [-1789.047] (-1786.058) (-1789.651) (-1790.823) -- 0:06:00
198500 -- [-1785.539] (-1789.323) (-1795.742) (-1791.331) * (-1786.839) (-1794.538) (-1791.899) [-1786.482] -- 0:06:03
199000 -- (-1801.004) (-1789.232) [-1790.680] (-1803.837) * [-1784.446] (-1793.036) (-1798.259) (-1802.290) -- 0:06:02
199500 -- (-1791.046) (-1796.694) [-1787.118] (-1788.110) * (-1791.795) [-1785.667] (-1787.895) (-1791.683) -- 0:06:01
200000 -- (-1790.207) (-1791.935) [-1788.459] (-1789.741) * (-1788.958) (-1802.398) (-1791.801) [-1791.446] -- 0:06:00
Average standard deviation of split frequencies: 0.022513
200500 -- (-1800.107) (-1793.419) (-1798.942) [-1785.611] * [-1788.993] (-1790.922) (-1790.414) (-1800.238) -- 0:05:58
201000 -- (-1790.705) (-1786.424) (-1795.355) [-1790.523] * (-1789.920) (-1791.602) [-1788.086] (-1795.035) -- 0:06:01
201500 -- (-1794.847) (-1798.795) (-1792.690) [-1796.456] * (-1789.661) [-1788.713] (-1791.504) (-1799.380) -- 0:06:00
202000 -- (-1789.352) (-1793.811) (-1787.603) [-1792.246] * [-1787.813] (-1800.454) (-1790.631) (-1791.062) -- 0:05:59
202500 -- [-1788.216] (-1796.318) (-1788.787) (-1786.515) * (-1793.589) (-1790.940) (-1789.555) [-1787.760] -- 0:05:58
203000 -- (-1791.470) (-1790.337) [-1787.933] (-1791.441) * (-1793.236) (-1783.774) [-1787.450] (-1798.325) -- 0:06:01
203500 -- (-1793.001) (-1801.375) [-1792.430] (-1796.399) * [-1796.419] (-1799.345) (-1794.608) (-1785.423) -- 0:06:00
204000 -- (-1792.249) (-1801.233) [-1796.938] (-1796.126) * [-1796.298] (-1789.736) (-1797.205) (-1789.159) -- 0:05:58
204500 -- (-1789.421) (-1789.959) (-1788.516) [-1801.635] * (-1788.314) [-1798.502] (-1796.782) (-1798.828) -- 0:05:57
205000 -- (-1791.569) (-1808.558) [-1786.047] (-1793.106) * [-1784.994] (-1799.607) (-1795.001) (-1793.042) -- 0:05:56
Average standard deviation of split frequencies: 0.020023
205500 -- [-1786.712] (-1790.921) (-1785.695) (-1794.971) * (-1793.520) (-1790.830) (-1795.208) [-1798.098] -- 0:05:59
206000 -- (-1786.211) (-1784.986) (-1789.311) [-1798.775] * (-1793.571) [-1793.878] (-1790.699) (-1787.792) -- 0:05:58
206500 -- (-1786.589) [-1788.602] (-1786.709) (-1789.377) * [-1786.458] (-1794.937) (-1790.766) (-1789.233) -- 0:05:57
207000 -- (-1797.459) (-1789.932) [-1789.215] (-1792.198) * (-1787.437) (-1792.136) (-1793.244) [-1786.649] -- 0:05:56
207500 -- (-1796.789) [-1791.615] (-1786.147) (-1795.369) * (-1785.805) [-1791.727] (-1790.780) (-1792.627) -- 0:05:59
208000 -- [-1791.644] (-1794.036) (-1794.622) (-1800.092) * (-1797.878) [-1786.253] (-1786.778) (-1789.284) -- 0:05:57
208500 -- (-1792.472) (-1800.227) (-1783.067) [-1792.599] * (-1794.498) (-1795.131) (-1789.093) [-1788.373] -- 0:05:56
209000 -- [-1800.179] (-1793.307) (-1795.653) (-1791.379) * [-1786.314] (-1798.056) (-1791.305) (-1797.061) -- 0:05:55
209500 -- (-1791.566) (-1791.673) [-1794.430] (-1791.658) * (-1784.341) (-1806.220) [-1792.133] (-1789.648) -- 0:05:58
210000 -- (-1784.487) (-1797.925) (-1793.720) [-1793.548] * [-1786.496] (-1795.877) (-1792.146) (-1791.396) -- 0:05:57
Average standard deviation of split frequencies: 0.019207
210500 -- [-1790.419] (-1796.826) (-1792.441) (-1795.821) * (-1797.566) (-1794.669) [-1795.956] (-1791.353) -- 0:05:56
211000 -- (-1790.783) (-1788.685) (-1792.638) [-1789.095] * [-1791.807] (-1792.139) (-1795.510) (-1796.509) -- 0:05:55
211500 -- (-1789.800) (-1789.775) (-1797.632) [-1791.543] * (-1797.228) (-1787.079) (-1795.983) [-1785.719] -- 0:05:54
212000 -- [-1783.047] (-1794.845) (-1791.815) (-1785.840) * (-1791.468) (-1785.397) (-1796.057) [-1799.363] -- 0:05:56
212500 -- (-1786.107) (-1800.288) (-1795.997) [-1784.673] * (-1791.494) [-1787.250] (-1793.891) (-1795.803) -- 0:05:55
213000 -- (-1798.426) (-1792.941) [-1793.014] (-1803.352) * (-1790.660) [-1794.702] (-1796.163) (-1796.668) -- 0:05:54
213500 -- [-1788.192] (-1793.004) (-1799.263) (-1786.376) * (-1805.235) [-1793.881] (-1791.266) (-1792.842) -- 0:05:53
214000 -- (-1787.870) [-1786.517] (-1798.943) (-1792.956) * [-1791.931] (-1792.050) (-1791.779) (-1797.981) -- 0:05:56
214500 -- (-1788.136) (-1789.549) (-1803.501) [-1796.876] * (-1790.550) [-1794.272] (-1796.397) (-1801.265) -- 0:05:55
215000 -- (-1794.558) (-1788.028) (-1794.295) [-1788.076] * (-1786.333) (-1791.019) (-1793.025) [-1792.887] -- 0:05:54
Average standard deviation of split frequencies: 0.017459
215500 -- [-1788.201] (-1792.210) (-1793.486) (-1794.562) * (-1794.888) (-1791.973) [-1801.026] (-1794.397) -- 0:05:53
216000 -- (-1791.271) (-1792.111) [-1796.243] (-1789.611) * [-1792.533] (-1797.514) (-1791.996) (-1789.996) -- 0:05:52
216500 -- [-1784.503] (-1796.620) (-1795.729) (-1789.137) * [-1786.764] (-1791.215) (-1790.605) (-1795.428) -- 0:05:54
217000 -- (-1801.310) (-1795.923) [-1782.576] (-1789.067) * (-1788.185) (-1790.769) [-1797.477] (-1791.159) -- 0:05:53
217500 -- [-1793.128] (-1792.252) (-1788.526) (-1791.690) * (-1796.007) (-1790.838) [-1795.698] (-1800.610) -- 0:05:52
218000 -- [-1786.394] (-1786.646) (-1795.571) (-1796.143) * [-1787.119] (-1797.373) (-1791.948) (-1799.971) -- 0:05:51
218500 -- (-1792.748) (-1795.306) (-1795.654) [-1789.158] * (-1802.369) [-1789.957] (-1786.744) (-1796.668) -- 0:05:54
219000 -- (-1785.283) [-1783.899] (-1802.235) (-1790.344) * (-1796.589) (-1787.149) [-1785.920] (-1801.850) -- 0:05:53
219500 -- (-1792.749) (-1790.192) (-1807.715) [-1788.846] * (-1794.665) [-1787.503] (-1790.817) (-1805.902) -- 0:05:52
220000 -- (-1785.824) (-1790.351) (-1803.443) [-1784.674] * [-1785.627] (-1793.233) (-1784.562) (-1786.120) -- 0:05:51
Average standard deviation of split frequencies: 0.017268
220500 -- (-1785.214) (-1798.862) (-1793.513) [-1783.988] * [-1786.370] (-1788.946) (-1796.772) (-1786.702) -- 0:05:49
221000 -- (-1794.369) (-1787.306) (-1796.702) [-1788.621] * (-1798.690) (-1791.759) (-1802.029) [-1791.621] -- 0:05:52
221500 -- (-1794.391) [-1784.180] (-1808.858) (-1800.381) * [-1783.379] (-1796.930) (-1792.271) (-1791.850) -- 0:05:51
222000 -- [-1791.358] (-1787.407) (-1796.275) (-1801.712) * (-1792.006) [-1794.921] (-1791.985) (-1796.017) -- 0:05:50
222500 -- [-1792.224] (-1792.993) (-1787.268) (-1794.193) * (-1797.087) (-1792.897) [-1790.328] (-1790.948) -- 0:05:49
223000 -- (-1790.917) (-1790.541) [-1787.315] (-1795.821) * (-1791.863) (-1787.988) [-1787.289] (-1784.316) -- 0:05:51
223500 -- (-1796.362) (-1790.315) (-1787.920) [-1799.964] * (-1800.515) (-1788.906) [-1784.924] (-1788.344) -- 0:05:50
224000 -- (-1789.227) (-1792.976) [-1787.317] (-1803.508) * (-1790.668) (-1799.023) [-1789.354] (-1784.090) -- 0:05:49
224500 -- [-1792.446] (-1788.060) (-1792.127) (-1795.292) * (-1790.460) (-1787.762) (-1790.518) [-1787.531] -- 0:05:48
225000 -- [-1783.090] (-1789.539) (-1792.930) (-1792.725) * [-1795.231] (-1795.513) (-1797.410) (-1794.126) -- 0:05:47
Average standard deviation of split frequencies: 0.017208
225500 -- (-1796.062) (-1795.574) [-1793.971] (-1791.005) * [-1787.588] (-1793.153) (-1792.381) (-1790.353) -- 0:05:50
226000 -- (-1795.851) (-1794.016) (-1793.977) [-1790.419] * [-1794.632] (-1791.421) (-1783.277) (-1796.367) -- 0:05:49
226500 -- (-1799.496) [-1798.374] (-1795.953) (-1797.870) * (-1796.316) (-1791.024) (-1789.821) [-1792.079] -- 0:05:48
227000 -- (-1789.258) (-1789.139) [-1788.597] (-1791.547) * (-1786.485) [-1792.899] (-1793.393) (-1797.159) -- 0:05:47
227500 -- [-1792.545] (-1790.064) (-1801.767) (-1792.113) * [-1789.954] (-1791.493) (-1795.735) (-1788.317) -- 0:05:49
228000 -- (-1797.536) (-1796.331) (-1794.460) [-1788.556] * (-1792.072) (-1793.981) (-1789.732) [-1790.047] -- 0:05:48
228500 -- (-1797.126) [-1794.102] (-1797.593) (-1787.009) * (-1783.732) (-1784.616) [-1790.685] (-1791.755) -- 0:05:47
229000 -- (-1789.912) (-1791.259) (-1800.209) [-1791.505] * (-1791.458) (-1795.253) [-1785.010] (-1784.975) -- 0:05:46
229500 -- (-1786.720) [-1794.140] (-1788.503) (-1791.590) * (-1790.892) [-1789.958] (-1793.864) (-1805.379) -- 0:05:49
230000 -- [-1792.186] (-1787.997) (-1787.753) (-1794.411) * (-1792.391) (-1790.448) [-1797.830] (-1795.404) -- 0:05:48
Average standard deviation of split frequencies: 0.016349
230500 -- (-1801.439) (-1785.397) (-1792.885) [-1791.610] * (-1785.277) (-1791.948) (-1793.201) [-1791.882] -- 0:05:47
231000 -- (-1788.170) (-1791.100) [-1785.820] (-1799.393) * (-1786.348) [-1781.327] (-1783.931) (-1788.568) -- 0:05:46
231500 -- [-1785.831] (-1791.760) (-1789.729) (-1800.049) * (-1795.006) (-1789.492) [-1787.887] (-1791.211) -- 0:05:45
232000 -- (-1794.803) (-1790.915) (-1796.559) [-1793.473] * (-1786.587) [-1794.055] (-1797.400) (-1790.406) -- 0:05:47
232500 -- (-1791.520) [-1789.745] (-1791.073) (-1804.030) * [-1790.101] (-1792.038) (-1792.395) (-1802.458) -- 0:05:46
233000 -- (-1794.143) [-1787.940] (-1794.570) (-1803.952) * (-1784.204) (-1798.784) (-1795.473) [-1796.181] -- 0:05:45
233500 -- (-1794.749) [-1786.136] (-1790.378) (-1804.292) * (-1789.417) (-1801.483) (-1796.878) [-1787.038] -- 0:05:44
234000 -- (-1787.736) [-1787.095] (-1792.568) (-1799.243) * (-1786.988) [-1798.023] (-1796.149) (-1795.917) -- 0:05:46
234500 -- (-1790.533) (-1789.141) [-1786.190] (-1796.214) * (-1789.903) (-1797.100) [-1791.379] (-1805.077) -- 0:05:46
235000 -- (-1796.866) (-1793.161) [-1789.327] (-1785.092) * (-1793.240) (-1803.018) [-1794.029] (-1789.061) -- 0:05:45
Average standard deviation of split frequencies: 0.014315
235500 -- (-1797.455) [-1785.846] (-1787.550) (-1784.112) * [-1792.622] (-1799.795) (-1797.096) (-1791.058) -- 0:05:44
236000 -- (-1800.073) [-1786.104] (-1795.883) (-1787.155) * (-1800.678) (-1787.218) (-1794.914) [-1788.745] -- 0:05:43
236500 -- (-1793.609) [-1797.984] (-1793.997) (-1789.203) * [-1795.647] (-1787.541) (-1789.723) (-1783.586) -- 0:05:45
237000 -- (-1797.749) (-1790.289) (-1789.390) [-1791.308] * (-1791.591) (-1793.189) (-1788.275) [-1788.608] -- 0:05:44
237500 -- (-1792.264) (-1793.653) (-1786.546) [-1786.789] * (-1797.027) (-1798.077) (-1785.134) [-1788.234] -- 0:05:43
238000 -- (-1788.047) (-1799.418) [-1787.773] (-1807.135) * (-1795.629) (-1798.187) [-1785.890] (-1803.772) -- 0:05:42
238500 -- (-1787.200) (-1793.507) (-1787.864) [-1792.871] * (-1791.998) [-1789.260] (-1794.305) (-1792.271) -- 0:05:44
239000 -- (-1794.513) [-1790.600] (-1784.748) (-1793.615) * (-1806.707) (-1797.927) (-1788.662) [-1785.967] -- 0:05:43
239500 -- (-1785.821) [-1789.026] (-1785.802) (-1791.816) * [-1792.235] (-1798.064) (-1798.139) (-1786.734) -- 0:05:42
240000 -- [-1784.996] (-1797.945) (-1784.232) (-1792.576) * (-1791.134) [-1792.896] (-1809.733) (-1799.820) -- 0:05:42
Average standard deviation of split frequencies: 0.013711
240500 -- (-1787.851) (-1790.085) [-1788.701] (-1789.437) * (-1795.812) [-1790.896] (-1803.010) (-1795.178) -- 0:05:44
241000 -- [-1786.370] (-1798.284) (-1786.781) (-1800.227) * [-1788.299] (-1793.405) (-1802.363) (-1791.343) -- 0:05:43
241500 -- (-1790.348) (-1793.820) [-1791.877] (-1789.345) * [-1787.567] (-1808.639) (-1799.804) (-1799.490) -- 0:05:42
242000 -- [-1787.333] (-1799.008) (-1788.400) (-1794.088) * (-1790.313) (-1801.951) [-1785.855] (-1802.942) -- 0:05:41
242500 -- (-1797.354) [-1792.085] (-1786.000) (-1806.952) * [-1786.060] (-1790.583) (-1788.019) (-1795.301) -- 0:05:40
243000 -- (-1797.589) (-1787.831) [-1785.025] (-1797.979) * [-1787.181] (-1795.576) (-1796.122) (-1792.213) -- 0:05:42
243500 -- [-1790.843] (-1782.909) (-1793.291) (-1788.579) * [-1787.609] (-1793.890) (-1785.593) (-1788.505) -- 0:05:41
244000 -- (-1805.164) [-1787.065] (-1793.672) (-1792.026) * [-1787.967] (-1797.657) (-1792.224) (-1793.190) -- 0:05:40
244500 -- (-1798.860) (-1788.332) [-1798.390] (-1789.665) * (-1789.724) (-1789.708) [-1796.066] (-1795.907) -- 0:05:39
245000 -- (-1799.981) (-1793.005) [-1794.049] (-1791.627) * [-1796.260] (-1793.241) (-1788.134) (-1798.389) -- 0:05:42
Average standard deviation of split frequencies: 0.012616
245500 -- (-1795.005) (-1787.801) [-1791.843] (-1791.747) * [-1793.521] (-1791.122) (-1792.697) (-1802.419) -- 0:05:41
246000 -- (-1785.956) [-1790.183] (-1791.098) (-1790.857) * (-1797.333) [-1790.575] (-1800.673) (-1804.016) -- 0:05:40
246500 -- (-1788.393) [-1794.990] (-1799.307) (-1788.194) * (-1799.033) [-1795.067] (-1797.090) (-1792.362) -- 0:05:39
247000 -- (-1794.691) (-1786.371) (-1794.308) [-1791.582] * (-1791.106) (-1796.169) (-1804.065) [-1789.913] -- 0:05:38
247500 -- [-1803.334] (-1790.690) (-1786.269) (-1793.112) * (-1787.939) (-1801.327) [-1790.303] (-1789.674) -- 0:05:40
248000 -- (-1796.350) (-1788.559) (-1792.978) [-1785.939] * (-1794.010) (-1795.296) [-1788.934] (-1789.357) -- 0:05:39
248500 -- (-1794.493) (-1796.374) (-1793.505) [-1795.032] * [-1788.953] (-1791.583) (-1793.436) (-1787.668) -- 0:05:38
249000 -- (-1797.064) (-1797.650) (-1792.359) [-1794.288] * (-1799.292) (-1796.130) [-1792.947] (-1796.174) -- 0:05:37
249500 -- (-1783.721) [-1796.816] (-1787.305) (-1796.643) * (-1793.765) [-1794.774] (-1793.968) (-1792.373) -- 0:05:39
250000 -- (-1796.649) (-1789.685) (-1791.498) [-1794.935] * (-1786.219) (-1800.882) [-1789.735] (-1793.337) -- 0:05:39
Average standard deviation of split frequencies: 0.012537
250500 -- [-1787.412] (-1793.228) (-1793.774) (-1794.611) * (-1794.056) (-1787.999) (-1793.540) [-1787.006] -- 0:05:38
251000 -- (-1791.394) (-1793.491) (-1797.342) [-1781.368] * (-1789.715) (-1793.615) [-1788.360] (-1790.061) -- 0:05:37
251500 -- (-1784.167) (-1796.484) [-1787.200] (-1787.587) * (-1797.897) [-1788.405] (-1800.362) (-1794.626) -- 0:05:39
252000 -- (-1798.959) [-1790.664] (-1789.617) (-1787.787) * (-1785.260) (-1787.369) [-1790.964] (-1792.021) -- 0:05:38
252500 -- [-1793.418] (-1802.901) (-1786.885) (-1787.214) * (-1796.360) (-1794.686) [-1784.795] (-1787.201) -- 0:05:37
253000 -- (-1792.821) [-1792.436] (-1791.663) (-1789.774) * (-1796.678) (-1793.376) [-1787.881] (-1793.093) -- 0:05:36
253500 -- (-1801.681) [-1788.364] (-1791.489) (-1784.711) * (-1788.091) (-1793.206) [-1795.807] (-1795.528) -- 0:05:35
254000 -- (-1796.668) (-1795.376) (-1799.861) [-1790.552] * (-1793.130) (-1792.570) (-1793.263) [-1785.139] -- 0:05:37
254500 -- [-1787.164] (-1794.297) (-1793.219) (-1787.987) * (-1792.276) (-1787.479) (-1796.460) [-1785.718] -- 0:05:36
255000 -- (-1789.918) [-1795.583] (-1786.923) (-1798.841) * (-1799.188) [-1796.120] (-1792.906) (-1797.174) -- 0:05:35
Average standard deviation of split frequencies: 0.011969
255500 -- (-1791.847) (-1789.146) [-1785.417] (-1790.809) * (-1798.914) [-1796.350] (-1797.905) (-1796.305) -- 0:05:35
256000 -- [-1788.356] (-1791.531) (-1796.231) (-1782.869) * [-1791.715] (-1798.283) (-1805.786) (-1792.981) -- 0:05:37
256500 -- (-1801.578) (-1792.431) (-1791.550) [-1784.926] * (-1801.757) (-1787.587) [-1794.367] (-1795.898) -- 0:05:36
257000 -- [-1796.275] (-1793.462) (-1795.100) (-1786.570) * (-1797.472) [-1788.601] (-1787.777) (-1795.049) -- 0:05:35
257500 -- [-1789.774] (-1790.640) (-1793.140) (-1799.042) * (-1792.202) [-1787.382] (-1786.670) (-1798.897) -- 0:05:34
258000 -- [-1789.883] (-1790.688) (-1797.745) (-1793.498) * (-1795.744) (-1793.993) [-1789.767] (-1790.352) -- 0:05:33
258500 -- (-1791.894) (-1790.257) [-1788.215] (-1792.898) * (-1795.342) [-1792.054] (-1790.898) (-1796.452) -- 0:05:35
259000 -- (-1791.579) (-1797.629) (-1791.910) [-1794.554] * (-1791.795) (-1798.587) [-1785.489] (-1796.140) -- 0:05:34
259500 -- (-1787.594) (-1806.758) [-1789.542] (-1793.248) * [-1785.609] (-1791.057) (-1794.074) (-1795.081) -- 0:05:33
260000 -- (-1790.386) [-1788.967] (-1795.912) (-1794.961) * [-1789.005] (-1788.266) (-1798.080) (-1787.001) -- 0:05:33
Average standard deviation of split frequencies: 0.012508
260500 -- (-1789.790) (-1787.305) (-1792.709) [-1791.910] * (-1793.859) [-1790.431] (-1797.122) (-1791.163) -- 0:05:34
261000 -- (-1789.219) (-1786.332) (-1806.345) [-1799.530] * (-1796.588) (-1785.239) [-1794.368] (-1784.429) -- 0:05:34
261500 -- [-1789.243] (-1792.906) (-1799.949) (-1799.908) * [-1789.836] (-1798.584) (-1790.869) (-1791.681) -- 0:05:33
262000 -- (-1784.948) [-1789.610] (-1788.007) (-1795.419) * [-1795.535] (-1794.096) (-1812.243) (-1791.059) -- 0:05:32
262500 -- (-1794.340) (-1783.319) [-1789.074] (-1791.935) * (-1792.197) (-1798.786) [-1791.624] (-1786.223) -- 0:05:31
263000 -- (-1796.970) [-1793.848] (-1792.411) (-1789.970) * (-1782.387) [-1795.558] (-1788.332) (-1790.286) -- 0:05:33
263500 -- (-1793.233) (-1787.907) (-1794.566) [-1791.797] * (-1793.353) [-1789.798] (-1788.332) (-1788.665) -- 0:05:32
264000 -- [-1785.205] (-1786.636) (-1802.270) (-1790.723) * (-1797.769) (-1799.551) (-1791.805) [-1784.537] -- 0:05:31
264500 -- [-1785.304] (-1806.501) (-1791.938) (-1803.746) * (-1805.724) [-1800.196] (-1795.729) (-1797.017) -- 0:05:30
265000 -- (-1788.089) (-1797.289) [-1787.243] (-1794.087) * (-1796.399) (-1795.085) [-1794.811] (-1793.625) -- 0:05:32
Average standard deviation of split frequencies: 0.012701
265500 -- (-1793.225) (-1788.795) (-1798.589) [-1784.658] * (-1789.579) (-1787.644) (-1789.296) [-1789.290] -- 0:05:31
266000 -- (-1800.985) (-1792.655) (-1788.804) [-1790.721] * (-1789.779) (-1791.912) [-1789.301] (-1792.629) -- 0:05:31
266500 -- (-1793.400) [-1788.380] (-1790.587) (-1795.980) * (-1791.307) (-1793.166) (-1794.253) [-1791.409] -- 0:05:30
267000 -- (-1791.311) (-1794.752) (-1795.137) [-1790.436] * (-1792.448) (-1796.444) [-1785.151] (-1800.765) -- 0:05:29
267500 -- (-1791.251) (-1796.314) (-1798.468) [-1787.269] * [-1784.231] (-1796.834) (-1790.832) (-1792.547) -- 0:05:31
268000 -- (-1798.348) [-1794.871] (-1812.019) (-1787.747) * (-1786.208) (-1787.885) (-1801.763) [-1788.618] -- 0:05:30
268500 -- (-1796.490) (-1802.993) [-1794.534] (-1794.844) * [-1789.479] (-1791.496) (-1785.632) (-1787.498) -- 0:05:29
269000 -- (-1793.666) (-1790.439) [-1793.417] (-1793.680) * (-1790.817) (-1800.378) [-1786.286] (-1790.464) -- 0:05:28
269500 -- (-1804.146) [-1789.215] (-1790.692) (-1794.026) * (-1794.715) (-1784.846) [-1789.523] (-1789.424) -- 0:05:30
270000 -- (-1790.184) (-1796.634) [-1795.433] (-1786.735) * (-1789.296) [-1792.961] (-1791.948) (-1792.667) -- 0:05:29
Average standard deviation of split frequencies: 0.013062
270500 -- (-1794.390) (-1788.951) (-1797.497) [-1785.391] * [-1787.083] (-1789.575) (-1800.769) (-1792.506) -- 0:05:29
271000 -- (-1788.625) (-1803.259) (-1791.666) [-1788.247] * [-1789.849] (-1790.041) (-1794.426) (-1800.098) -- 0:05:28
271500 -- (-1790.277) (-1782.952) (-1799.650) [-1791.874] * (-1797.843) [-1786.973] (-1801.273) (-1785.326) -- 0:05:30
272000 -- [-1791.143] (-1783.280) (-1798.384) (-1796.366) * (-1795.028) [-1785.413] (-1790.119) (-1790.920) -- 0:05:29
272500 -- (-1795.931) (-1786.054) [-1794.823] (-1801.968) * (-1794.677) (-1790.540) (-1794.752) [-1789.053] -- 0:05:28
273000 -- (-1799.883) (-1784.717) (-1794.321) [-1789.631] * (-1794.246) [-1790.735] (-1799.195) (-1796.477) -- 0:05:27
273500 -- [-1786.723] (-1794.167) (-1789.704) (-1801.468) * [-1797.356] (-1795.126) (-1796.558) (-1789.623) -- 0:05:26
274000 -- (-1789.323) (-1788.430) (-1792.266) [-1793.763] * (-1794.982) (-1790.949) (-1788.964) [-1793.087] -- 0:05:28
274500 -- (-1789.565) (-1782.386) [-1790.827] (-1788.391) * (-1795.729) (-1801.115) (-1796.966) [-1788.428] -- 0:05:27
275000 -- (-1796.473) [-1785.990] (-1785.830) (-1788.149) * (-1788.496) (-1786.213) [-1790.243] (-1792.031) -- 0:05:26
Average standard deviation of split frequencies: 0.012098
275500 -- (-1791.886) (-1793.642) [-1785.664] (-1796.288) * (-1806.193) (-1791.317) (-1802.289) [-1791.364] -- 0:05:26
276000 -- (-1788.898) [-1790.713] (-1795.827) (-1792.633) * (-1791.007) [-1791.490] (-1792.957) (-1791.112) -- 0:05:27
276500 -- (-1799.127) [-1786.083] (-1789.775) (-1791.491) * [-1785.880] (-1795.460) (-1796.990) (-1792.724) -- 0:05:27
277000 -- (-1795.387) (-1785.115) (-1784.687) [-1792.673] * (-1791.384) (-1797.984) [-1788.803] (-1797.222) -- 0:05:26
277500 -- [-1791.094] (-1794.387) (-1793.931) (-1789.203) * (-1797.069) (-1787.747) [-1794.637] (-1793.725) -- 0:05:25
278000 -- (-1790.238) (-1791.282) [-1789.998] (-1802.247) * (-1798.595) [-1793.506] (-1787.685) (-1793.730) -- 0:05:24
278500 -- (-1788.952) (-1794.756) [-1790.096] (-1786.948) * (-1797.619) (-1788.090) [-1795.269] (-1791.868) -- 0:05:26
279000 -- [-1790.332] (-1784.696) (-1795.194) (-1794.432) * [-1787.625] (-1790.963) (-1793.837) (-1790.180) -- 0:05:25
279500 -- [-1794.443] (-1788.074) (-1794.703) (-1795.490) * (-1794.471) (-1798.883) (-1791.285) [-1787.425] -- 0:05:24
280000 -- (-1789.228) [-1788.786] (-1796.744) (-1798.470) * (-1789.975) [-1797.948] (-1789.267) (-1792.795) -- 0:05:24
Average standard deviation of split frequencies: 0.012037
280500 -- (-1790.979) (-1793.337) [-1784.320] (-1796.109) * (-1787.191) [-1790.485] (-1799.146) (-1786.668) -- 0:05:25
281000 -- (-1793.883) (-1785.478) (-1794.558) [-1788.998] * (-1791.103) [-1788.919] (-1789.905) (-1790.699) -- 0:05:24
281500 -- (-1795.447) (-1797.674) (-1785.449) [-1791.713] * [-1791.935] (-1788.491) (-1788.766) (-1802.408) -- 0:05:24
282000 -- (-1786.867) (-1788.952) [-1787.032] (-1786.465) * (-1787.580) (-1791.685) [-1792.888] (-1795.503) -- 0:05:23
282500 -- [-1784.522] (-1794.962) (-1803.981) (-1796.262) * (-1801.084) [-1792.142] (-1802.188) (-1785.039) -- 0:05:22
283000 -- (-1787.676) (-1793.694) [-1797.235] (-1796.030) * (-1791.850) (-1796.871) (-1794.909) [-1793.529] -- 0:05:24
283500 -- [-1787.166] (-1788.104) (-1791.927) (-1787.984) * (-1791.436) (-1798.152) (-1783.591) [-1796.377] -- 0:05:23
284000 -- [-1789.293] (-1793.343) (-1794.189) (-1791.863) * [-1798.070] (-1797.300) (-1792.157) (-1797.728) -- 0:05:22
284500 -- [-1791.044] (-1792.511) (-1791.950) (-1794.471) * (-1792.609) [-1790.181] (-1794.084) (-1794.099) -- 0:05:21
285000 -- (-1806.368) [-1788.674] (-1792.352) (-1790.763) * (-1797.134) (-1789.855) [-1789.706] (-1795.650) -- 0:05:23
Average standard deviation of split frequencies: 0.012087
285500 -- (-1791.849) [-1785.203] (-1796.387) (-1795.563) * (-1799.260) (-1791.428) (-1792.276) [-1793.615] -- 0:05:22
286000 -- [-1790.355] (-1789.364) (-1797.903) (-1790.518) * (-1792.969) (-1795.592) [-1787.331] (-1795.191) -- 0:05:22
286500 -- (-1800.801) [-1783.296] (-1797.894) (-1787.389) * (-1789.212) (-1796.505) (-1805.495) [-1789.516] -- 0:05:21
287000 -- (-1797.454) [-1785.801] (-1789.943) (-1797.672) * (-1794.642) (-1806.184) (-1788.861) [-1788.702] -- 0:05:22
287500 -- (-1793.666) (-1782.471) [-1788.137] (-1791.415) * (-1789.012) (-1796.365) (-1794.825) [-1787.292] -- 0:05:22
288000 -- (-1799.586) [-1792.814] (-1787.827) (-1788.797) * (-1797.325) [-1792.385] (-1798.296) (-1789.587) -- 0:05:21
288500 -- [-1789.317] (-1787.740) (-1783.021) (-1792.272) * (-1802.419) [-1782.549] (-1797.482) (-1788.059) -- 0:05:20
289000 -- (-1794.610) [-1794.600] (-1795.842) (-1787.439) * (-1801.493) [-1790.346] (-1789.178) (-1794.121) -- 0:05:19
289500 -- (-1785.568) (-1796.593) (-1791.312) [-1793.432] * [-1786.415] (-1787.136) (-1799.343) (-1794.548) -- 0:05:21
290000 -- (-1788.766) [-1789.081] (-1785.431) (-1794.897) * (-1796.240) (-1793.486) (-1787.205) [-1787.223] -- 0:05:20
Average standard deviation of split frequencies: 0.011217
290500 -- (-1790.279) (-1790.700) [-1789.479] (-1795.073) * [-1785.938] (-1799.024) (-1788.740) (-1793.818) -- 0:05:19
291000 -- (-1798.689) (-1798.689) (-1791.770) [-1794.048] * (-1792.676) [-1784.364] (-1790.149) (-1796.464) -- 0:05:19
291500 -- (-1791.402) [-1787.027] (-1798.575) (-1802.866) * (-1789.474) (-1789.752) [-1783.837] (-1796.529) -- 0:05:20
292000 -- (-1791.472) (-1795.072) [-1790.859] (-1795.674) * (-1795.250) (-1790.587) [-1790.500] (-1790.287) -- 0:05:20
292500 -- [-1788.486] (-1795.733) (-1805.866) (-1800.290) * (-1802.156) (-1792.525) (-1798.147) [-1787.255] -- 0:05:19
293000 -- [-1792.745] (-1794.688) (-1787.776) (-1796.201) * (-1804.194) (-1795.603) [-1800.483] (-1793.518) -- 0:05:18
293500 -- (-1798.710) (-1788.679) (-1796.113) [-1790.132] * (-1799.783) (-1792.730) (-1787.893) [-1790.607] -- 0:05:17
294000 -- (-1783.631) (-1790.247) (-1793.071) [-1791.694] * (-1795.826) [-1792.470] (-1788.269) (-1790.315) -- 0:05:19
294500 -- [-1788.780] (-1791.062) (-1792.045) (-1789.280) * (-1795.637) (-1796.310) [-1791.026] (-1792.202) -- 0:05:18
295000 -- [-1785.987] (-1789.699) (-1793.174) (-1801.402) * (-1799.490) (-1796.001) (-1801.261) [-1788.070] -- 0:05:17
Average standard deviation of split frequencies: 0.010485
295500 -- (-1792.734) [-1787.969] (-1799.780) (-1794.873) * (-1801.542) (-1786.067) [-1788.433] (-1796.257) -- 0:05:17
296000 -- [-1786.608] (-1790.196) (-1794.336) (-1790.716) * (-1792.614) (-1794.354) (-1802.114) [-1786.594] -- 0:05:18
296500 -- [-1783.557] (-1789.306) (-1790.702) (-1797.160) * (-1787.857) (-1798.658) [-1794.638] (-1794.719) -- 0:05:17
297000 -- (-1791.819) [-1790.120] (-1790.882) (-1793.972) * [-1789.638] (-1792.970) (-1786.505) (-1795.413) -- 0:05:17
297500 -- (-1792.071) (-1795.635) [-1791.117] (-1794.330) * (-1789.576) [-1794.091] (-1789.738) (-1797.450) -- 0:05:16
298000 -- [-1787.721] (-1786.171) (-1797.426) (-1791.338) * (-1794.265) (-1790.122) [-1788.089] (-1797.003) -- 0:05:18
298500 -- [-1785.698] (-1801.264) (-1794.077) (-1795.378) * [-1784.563] (-1801.957) (-1804.180) (-1788.014) -- 0:05:17
299000 -- (-1786.942) (-1785.921) (-1792.040) [-1789.998] * [-1781.109] (-1794.352) (-1796.605) (-1793.996) -- 0:05:16
299500 -- [-1784.671] (-1787.870) (-1792.414) (-1793.238) * (-1787.385) (-1801.120) (-1796.502) [-1788.241] -- 0:05:15
300000 -- (-1781.414) (-1788.233) (-1799.568) [-1784.437] * [-1791.294] (-1792.697) (-1788.628) (-1793.090) -- 0:05:15
Average standard deviation of split frequencies: 0.010322
300500 -- (-1790.207) [-1791.319] (-1794.748) (-1801.513) * (-1797.170) (-1791.917) (-1794.991) [-1793.627] -- 0:05:16
301000 -- (-1795.522) (-1789.313) (-1790.628) [-1788.461] * (-1806.421) (-1789.162) [-1790.988] (-1791.123) -- 0:05:15
301500 -- (-1794.433) [-1788.336] (-1791.960) (-1795.127) * (-1798.909) [-1801.027] (-1791.147) (-1792.133) -- 0:05:15
302000 -- (-1788.109) (-1790.624) [-1788.639] (-1803.562) * [-1794.406] (-1799.136) (-1798.377) (-1785.002) -- 0:05:14
302500 -- (-1790.699) (-1797.548) (-1794.190) [-1793.202] * (-1799.012) (-1791.715) (-1789.103) [-1785.449] -- 0:05:15
303000 -- (-1795.326) (-1792.120) [-1787.740] (-1794.094) * (-1798.476) (-1795.427) (-1784.433) [-1790.283] -- 0:05:15
303500 -- [-1795.303] (-1792.596) (-1796.709) (-1784.878) * (-1794.854) (-1799.160) (-1787.548) [-1790.139] -- 0:05:14
304000 -- (-1799.776) [-1795.616] (-1791.680) (-1787.453) * [-1785.510] (-1784.732) (-1796.767) (-1796.016) -- 0:05:13
304500 -- (-1797.101) (-1795.956) [-1788.675] (-1795.134) * (-1793.215) (-1789.836) [-1789.656] (-1791.400) -- 0:05:12
305000 -- (-1793.553) [-1790.182] (-1798.151) (-1801.198) * [-1796.577] (-1789.395) (-1806.156) (-1791.363) -- 0:05:14
Average standard deviation of split frequencies: 0.008986
305500 -- (-1791.691) [-1801.550] (-1794.731) (-1797.885) * (-1792.916) (-1788.674) [-1791.999] (-1785.425) -- 0:05:13
306000 -- (-1790.147) [-1796.912] (-1799.260) (-1787.097) * (-1793.418) (-1795.535) [-1789.282] (-1788.576) -- 0:05:12
306500 -- (-1796.521) (-1797.011) (-1789.812) [-1791.527] * (-1791.708) (-1791.500) [-1789.276] (-1796.389) -- 0:05:12
307000 -- (-1796.608) [-1790.759] (-1787.168) (-1790.613) * (-1791.359) [-1792.326] (-1789.018) (-1788.267) -- 0:05:13
307500 -- (-1795.660) [-1783.799] (-1795.945) (-1787.091) * (-1791.210) (-1788.191) (-1798.347) [-1788.055] -- 0:05:13
308000 -- (-1794.553) (-1788.605) (-1803.182) [-1791.184] * (-1798.066) [-1797.723] (-1791.555) (-1785.763) -- 0:05:12
308500 -- (-1788.858) (-1794.135) (-1804.551) [-1795.351] * [-1789.299] (-1790.748) (-1798.333) (-1790.927) -- 0:05:11
309000 -- (-1794.127) (-1798.873) [-1781.647] (-1783.136) * (-1796.077) (-1787.956) [-1794.397] (-1792.571) -- 0:05:10
309500 -- (-1797.079) (-1804.690) (-1786.169) [-1782.576] * (-1791.364) (-1793.451) (-1795.236) [-1785.864] -- 0:05:12
310000 -- [-1792.899] (-1793.313) (-1799.093) (-1793.639) * (-1799.493) (-1801.853) (-1797.471) [-1787.045] -- 0:05:11
Average standard deviation of split frequencies: 0.008725
310500 -- (-1791.902) (-1798.409) [-1795.280] (-1788.470) * (-1784.434) [-1790.766] (-1785.769) (-1792.321) -- 0:05:10
311000 -- (-1793.542) (-1801.724) (-1799.837) [-1792.005] * (-1792.387) (-1785.777) [-1793.359] (-1792.382) -- 0:05:10
311500 -- (-1791.940) (-1800.660) (-1793.721) [-1794.558] * [-1790.246] (-1788.760) (-1796.140) (-1791.672) -- 0:05:11
312000 -- (-1786.993) [-1790.608] (-1785.315) (-1795.730) * (-1786.323) (-1789.952) (-1791.182) [-1788.022] -- 0:05:10
312500 -- (-1802.917) (-1797.638) [-1787.989] (-1792.897) * [-1790.509] (-1798.809) (-1795.338) (-1784.843) -- 0:05:10
313000 -- [-1787.952] (-1802.807) (-1790.826) (-1783.828) * (-1797.115) (-1790.808) (-1795.463) [-1792.226] -- 0:05:09
313500 -- (-1787.523) (-1805.265) (-1788.059) [-1788.817] * (-1793.130) (-1790.259) [-1794.868] (-1788.865) -- 0:05:08
314000 -- (-1792.307) [-1799.532] (-1801.529) (-1785.422) * (-1791.361) (-1793.099) [-1790.742] (-1790.768) -- 0:05:10
314500 -- [-1794.905] (-1787.815) (-1795.562) (-1794.152) * (-1792.334) (-1796.574) (-1791.026) [-1785.135] -- 0:05:09
315000 -- (-1796.618) (-1789.921) [-1792.319] (-1792.573) * (-1795.511) (-1793.881) (-1793.718) [-1791.667] -- 0:05:08
Average standard deviation of split frequencies: 0.008578
315500 -- (-1785.006) (-1801.006) (-1788.229) [-1788.371] * (-1790.511) (-1788.004) (-1805.383) [-1796.067] -- 0:05:08
316000 -- (-1790.292) (-1792.478) [-1787.422] (-1793.867) * [-1783.706] (-1793.167) (-1797.452) (-1792.342) -- 0:05:09
316500 -- [-1794.932] (-1791.178) (-1794.892) (-1784.284) * (-1792.055) (-1790.670) [-1785.415] (-1787.773) -- 0:05:08
317000 -- (-1791.918) [-1789.231] (-1802.439) (-1799.015) * (-1789.548) (-1806.790) [-1789.223] (-1793.613) -- 0:05:08
317500 -- (-1789.668) (-1796.026) [-1788.552] (-1790.121) * [-1789.952] (-1805.405) (-1794.248) (-1787.857) -- 0:05:07
318000 -- [-1787.705] (-1791.396) (-1803.257) (-1802.400) * [-1789.693] (-1789.398) (-1789.073) (-1788.006) -- 0:05:08
318500 -- [-1789.210] (-1798.299) (-1800.031) (-1808.773) * (-1789.345) (-1795.689) (-1786.872) [-1791.400] -- 0:05:08
319000 -- [-1791.104] (-1794.417) (-1798.404) (-1795.216) * (-1793.569) (-1799.875) [-1784.436] (-1786.675) -- 0:05:07
319500 -- [-1782.255] (-1793.056) (-1793.332) (-1787.911) * (-1792.523) (-1802.279) (-1788.854) [-1784.791] -- 0:05:06
320000 -- (-1792.192) (-1785.469) [-1794.252] (-1792.331) * [-1795.263] (-1794.018) (-1790.388) (-1791.055) -- 0:05:06
Average standard deviation of split frequencies: 0.007840
320500 -- (-1794.059) [-1789.364] (-1788.394) (-1791.305) * (-1789.416) (-1803.235) [-1792.287] (-1791.526) -- 0:05:07
321000 -- (-1788.829) (-1793.752) (-1793.841) [-1794.369] * [-1788.851] (-1798.255) (-1798.891) (-1788.494) -- 0:05:06
321500 -- [-1799.802] (-1786.603) (-1799.847) (-1796.782) * (-1784.100) (-1797.972) (-1795.843) [-1792.631] -- 0:05:06
322000 -- (-1798.705) (-1793.367) [-1796.699] (-1798.653) * [-1789.298] (-1798.125) (-1787.815) (-1804.357) -- 0:05:05
322500 -- (-1800.746) [-1792.412] (-1793.991) (-1788.434) * [-1787.500] (-1792.706) (-1786.721) (-1795.602) -- 0:05:06
323000 -- (-1803.033) (-1793.126) (-1793.835) [-1784.780] * [-1786.040] (-1797.468) (-1805.264) (-1788.995) -- 0:05:06
323500 -- (-1798.051) (-1787.230) (-1801.199) [-1782.708] * (-1796.059) (-1795.248) (-1814.274) [-1781.575] -- 0:05:05
324000 -- (-1796.214) (-1793.611) [-1799.579] (-1799.301) * (-1788.854) (-1798.283) (-1805.379) [-1787.408] -- 0:05:04
324500 -- (-1791.720) (-1790.940) (-1794.150) [-1795.467] * (-1791.560) [-1790.029] (-1796.776) (-1796.609) -- 0:05:03
325000 -- [-1794.760] (-1793.625) (-1785.055) (-1800.223) * [-1799.434] (-1788.412) (-1793.676) (-1793.809) -- 0:05:05
Average standard deviation of split frequencies: 0.006387
325500 -- (-1799.000) (-1795.516) (-1790.473) [-1797.821] * (-1805.213) (-1796.290) (-1793.037) [-1791.984] -- 0:05:04
326000 -- (-1802.616) (-1790.117) (-1791.647) [-1792.981] * (-1796.209) [-1785.126] (-1788.261) (-1802.973) -- 0:05:03
326500 -- (-1803.391) (-1794.200) (-1789.855) [-1789.985] * (-1788.859) (-1789.800) [-1783.717] (-1801.243) -- 0:05:03
327000 -- (-1798.816) (-1797.276) [-1787.933] (-1792.514) * (-1783.690) [-1789.356] (-1789.328) (-1793.913) -- 0:05:04
327500 -- [-1781.301] (-1794.600) (-1794.392) (-1792.800) * (-1787.415) (-1791.698) [-1786.984] (-1791.531) -- 0:05:03
328000 -- [-1790.389] (-1791.040) (-1787.459) (-1788.642) * (-1797.230) [-1786.282] (-1799.527) (-1793.546) -- 0:05:03
328500 -- [-1791.545] (-1793.482) (-1786.162) (-1789.972) * (-1789.082) (-1800.349) [-1790.912] (-1791.938) -- 0:05:02
329000 -- [-1794.393] (-1782.882) (-1792.662) (-1803.877) * (-1797.804) (-1786.478) (-1793.977) [-1783.081] -- 0:05:03
329500 -- (-1800.253) (-1790.047) (-1796.004) [-1783.958] * [-1794.972] (-1793.605) (-1789.045) (-1807.895) -- 0:05:03
330000 -- (-1790.964) (-1789.939) (-1787.721) [-1786.126] * (-1795.050) (-1788.948) [-1788.200] (-1792.860) -- 0:05:02
Average standard deviation of split frequencies: 0.005821
330500 -- (-1790.171) (-1790.326) (-1788.373) [-1791.842] * (-1795.572) (-1792.699) (-1792.735) [-1789.640] -- 0:05:01
331000 -- (-1787.289) [-1793.885] (-1794.664) (-1791.681) * (-1791.128) (-1799.029) (-1786.021) [-1793.979] -- 0:05:01
331500 -- [-1795.402] (-1790.821) (-1789.821) (-1787.210) * (-1794.892) (-1796.156) (-1790.078) [-1789.286] -- 0:05:02
332000 -- (-1789.134) (-1797.310) [-1786.438] (-1786.552) * (-1792.061) (-1794.411) (-1794.110) [-1785.415] -- 0:05:01
332500 -- (-1793.476) (-1795.291) [-1796.551] (-1790.548) * (-1796.979) [-1794.181] (-1788.896) (-1792.979) -- 0:05:01
333000 -- [-1788.253] (-1794.982) (-1795.031) (-1786.663) * (-1795.312) [-1789.823] (-1783.659) (-1788.380) -- 0:05:00
333500 -- (-1790.498) [-1789.270] (-1801.318) (-1793.636) * (-1798.122) (-1792.826) [-1785.925] (-1795.166) -- 0:05:01
334000 -- [-1786.629] (-1794.762) (-1793.967) (-1792.860) * (-1795.469) (-1788.954) [-1783.175] (-1793.215) -- 0:05:01
334500 -- (-1797.534) [-1792.325] (-1805.039) (-1798.132) * (-1803.461) (-1790.424) [-1786.829] (-1791.277) -- 0:05:00
335000 -- [-1790.820] (-1793.958) (-1790.500) (-1800.588) * (-1792.967) [-1783.040] (-1791.988) (-1804.394) -- 0:04:59
Average standard deviation of split frequencies: 0.007366
335500 -- (-1789.562) [-1790.354] (-1787.451) (-1797.258) * [-1790.823] (-1798.157) (-1792.774) (-1796.390) -- 0:04:59
336000 -- [-1789.886] (-1786.697) (-1789.764) (-1792.024) * (-1792.768) (-1794.968) [-1783.004] (-1785.386) -- 0:05:00
336500 -- (-1785.124) [-1785.869] (-1788.366) (-1803.492) * (-1791.151) (-1796.635) (-1787.759) [-1788.171] -- 0:04:59
337000 -- (-1787.104) [-1792.656] (-1785.843) (-1791.151) * (-1796.934) [-1794.352] (-1794.060) (-1794.187) -- 0:04:59
337500 -- (-1787.026) [-1786.902] (-1792.255) (-1803.530) * (-1802.565) [-1794.268] (-1788.503) (-1796.357) -- 0:04:58
338000 -- (-1799.796) (-1789.131) [-1784.618] (-1789.634) * (-1796.453) (-1791.329) [-1792.347] (-1798.800) -- 0:04:59
338500 -- (-1795.054) [-1791.759] (-1786.208) (-1802.375) * (-1802.069) [-1792.825] (-1797.709) (-1803.018) -- 0:04:58
339000 -- (-1786.240) [-1792.083] (-1792.305) (-1788.996) * [-1785.776] (-1794.708) (-1789.732) (-1784.985) -- 0:04:58
339500 -- [-1788.355] (-1796.956) (-1802.624) (-1791.067) * (-1791.779) (-1794.445) (-1787.899) [-1785.720] -- 0:04:57
340000 -- [-1788.684] (-1793.158) (-1787.299) (-1796.386) * (-1797.969) [-1793.563] (-1803.407) (-1793.083) -- 0:04:57
Average standard deviation of split frequencies: 0.008764
340500 -- [-1793.990] (-1794.119) (-1788.185) (-1795.735) * [-1788.110] (-1789.866) (-1802.642) (-1792.812) -- 0:04:58
341000 -- [-1789.206] (-1791.988) (-1798.022) (-1799.424) * (-1786.927) [-1790.680] (-1789.381) (-1796.120) -- 0:04:57
341500 -- (-1793.186) (-1797.675) [-1793.749] (-1800.047) * (-1794.399) (-1796.494) [-1795.740] (-1795.486) -- 0:04:56
342000 -- (-1792.718) (-1798.953) [-1792.151] (-1789.084) * [-1791.844] (-1793.660) (-1812.595) (-1790.908) -- 0:04:56
342500 -- (-1787.075) [-1787.102] (-1795.125) (-1795.379) * (-1789.184) [-1784.500] (-1789.458) (-1794.587) -- 0:04:57
343000 -- [-1791.386] (-1782.179) (-1785.885) (-1805.504) * [-1790.258] (-1785.477) (-1788.836) (-1791.608) -- 0:04:56
343500 -- [-1786.816] (-1802.350) (-1794.347) (-1788.321) * (-1790.104) (-1793.848) (-1799.850) [-1788.490] -- 0:04:56
344000 -- (-1803.365) [-1790.398] (-1791.007) (-1789.255) * (-1792.729) [-1786.101] (-1788.449) (-1796.147) -- 0:04:55
344500 -- (-1791.036) (-1789.590) (-1794.524) [-1789.468] * (-1796.498) (-1788.761) [-1784.785] (-1795.591) -- 0:04:54
345000 -- (-1794.297) [-1786.481] (-1812.750) (-1786.144) * (-1792.493) (-1792.768) [-1795.751] (-1798.547) -- 0:04:56
Average standard deviation of split frequencies: 0.009310
345500 -- (-1794.730) (-1798.610) [-1793.776] (-1786.665) * [-1795.372] (-1788.753) (-1798.110) (-1791.307) -- 0:04:55
346000 -- [-1784.702] (-1791.966) (-1800.713) (-1788.040) * [-1788.593] (-1786.439) (-1803.582) (-1788.888) -- 0:04:54
346500 -- (-1787.068) (-1797.524) (-1816.662) [-1789.231] * (-1796.726) (-1790.782) (-1789.838) [-1790.571] -- 0:04:54
347000 -- [-1785.855] (-1793.152) (-1794.351) (-1789.633) * (-1795.474) (-1795.373) [-1790.201] (-1789.852) -- 0:04:55
347500 -- (-1797.450) (-1798.589) [-1788.993] (-1795.495) * (-1796.112) (-1795.936) [-1793.978] (-1787.361) -- 0:04:54
348000 -- [-1789.473] (-1788.829) (-1791.097) (-1801.082) * (-1794.619) (-1790.285) [-1791.164] (-1787.261) -- 0:04:54
348500 -- (-1786.177) [-1791.706] (-1789.441) (-1800.249) * (-1797.355) (-1796.728) [-1788.110] (-1786.285) -- 0:04:53
349000 -- (-1793.853) (-1789.412) (-1789.943) [-1800.211] * (-1793.121) [-1792.229] (-1801.984) (-1786.877) -- 0:04:54
349500 -- (-1788.352) (-1805.864) [-1791.179] (-1791.471) * (-1785.283) (-1787.784) (-1798.080) [-1790.306] -- 0:04:54
350000 -- [-1791.008] (-1797.251) (-1796.082) (-1797.782) * [-1789.231] (-1791.403) (-1792.352) (-1796.694) -- 0:04:53
Average standard deviation of split frequencies: 0.009858
350500 -- (-1797.402) (-1799.829) [-1787.339] (-1792.745) * [-1789.156] (-1794.887) (-1788.502) (-1796.505) -- 0:04:52
351000 -- (-1791.304) (-1790.794) [-1798.384] (-1790.529) * (-1789.065) (-1790.797) (-1799.970) [-1795.736] -- 0:04:52
351500 -- (-1804.086) [-1795.377] (-1802.252) (-1794.981) * [-1788.573] (-1797.070) (-1792.291) (-1799.234) -- 0:04:53
352000 -- (-1802.715) (-1794.980) (-1799.393) [-1802.601] * (-1784.649) [-1793.322] (-1787.159) (-1805.955) -- 0:04:52
352500 -- (-1795.512) [-1798.674] (-1794.165) (-1795.267) * (-1787.380) (-1795.065) [-1788.202] (-1795.403) -- 0:04:52
353000 -- (-1798.785) [-1792.168] (-1791.106) (-1799.373) * (-1787.489) (-1793.511) (-1795.415) [-1781.847] -- 0:04:51
353500 -- (-1808.725) (-1792.315) (-1784.640) [-1791.417] * (-1796.223) (-1785.111) [-1789.573] (-1789.133) -- 0:04:52
354000 -- (-1794.533) (-1783.841) (-1791.428) [-1789.153] * [-1786.828] (-1787.931) (-1793.762) (-1795.604) -- 0:04:51
354500 -- [-1796.209] (-1789.527) (-1789.123) (-1791.668) * (-1786.725) [-1791.437] (-1797.604) (-1791.607) -- 0:04:51
355000 -- (-1798.374) (-1793.552) [-1784.012] (-1792.472) * (-1791.996) [-1785.490] (-1794.686) (-1788.731) -- 0:04:50
Average standard deviation of split frequencies: 0.009490
355500 -- (-1792.240) (-1790.425) [-1786.454] (-1797.120) * [-1788.408] (-1794.303) (-1791.192) (-1793.426) -- 0:04:50
356000 -- [-1797.697] (-1790.598) (-1788.801) (-1784.632) * (-1789.868) [-1790.338] (-1788.632) (-1795.768) -- 0:04:51
356500 -- (-1797.591) (-1788.256) [-1784.736] (-1790.432) * (-1795.874) [-1787.878] (-1793.032) (-1798.277) -- 0:04:50
357000 -- (-1794.810) (-1790.097) [-1793.599] (-1790.776) * (-1798.846) [-1788.050] (-1796.132) (-1800.050) -- 0:04:49
357500 -- (-1794.161) (-1788.739) [-1793.435] (-1801.057) * [-1791.869] (-1791.505) (-1796.569) (-1789.153) -- 0:04:49
358000 -- (-1785.244) (-1792.849) [-1794.424] (-1801.673) * (-1787.981) (-1788.215) (-1785.716) [-1790.767] -- 0:04:50
358500 -- [-1801.711] (-1789.522) (-1803.851) (-1801.272) * (-1794.206) (-1796.451) (-1795.859) [-1792.685] -- 0:04:49
359000 -- [-1788.900] (-1790.388) (-1793.525) (-1791.633) * (-1797.896) (-1791.544) (-1801.354) [-1788.946] -- 0:04:49
359500 -- [-1795.527] (-1799.716) (-1790.560) (-1792.437) * (-1788.734) (-1796.093) [-1786.686] (-1790.219) -- 0:04:48
360000 -- (-1789.820) (-1782.348) (-1796.599) [-1795.577] * (-1791.250) (-1788.948) [-1793.356] (-1794.490) -- 0:04:49
Average standard deviation of split frequencies: 0.007951
360500 -- [-1787.480] (-1793.171) (-1793.213) (-1793.745) * (-1792.268) (-1793.576) [-1788.788] (-1792.324) -- 0:04:49
361000 -- (-1788.527) (-1789.620) [-1790.367] (-1798.638) * (-1793.326) [-1790.141] (-1788.746) (-1805.660) -- 0:04:48
361500 -- [-1790.787] (-1793.471) (-1798.713) (-1798.628) * (-1790.181) (-1795.544) [-1793.749] (-1790.298) -- 0:04:47
362000 -- (-1789.496) [-1793.761] (-1788.934) (-1799.990) * (-1786.196) (-1788.468) (-1792.776) [-1788.296] -- 0:04:47
362500 -- (-1799.968) [-1793.662] (-1794.117) (-1788.187) * [-1787.598] (-1790.610) (-1788.776) (-1790.297) -- 0:04:48
363000 -- (-1793.809) (-1793.718) (-1788.036) [-1794.502] * (-1787.569) [-1796.594] (-1790.221) (-1789.583) -- 0:04:47
363500 -- (-1796.453) (-1790.515) (-1792.609) [-1786.718] * (-1786.929) (-1802.839) [-1792.403] (-1786.496) -- 0:04:47
364000 -- [-1786.840] (-1789.527) (-1789.702) (-1794.534) * [-1793.413] (-1794.123) (-1792.047) (-1793.576) -- 0:04:46
364500 -- [-1787.894] (-1784.560) (-1798.701) (-1790.687) * [-1787.303] (-1785.889) (-1796.295) (-1793.401) -- 0:04:47
365000 -- (-1790.784) [-1791.881] (-1797.262) (-1786.338) * (-1790.327) (-1794.309) (-1789.814) [-1787.193] -- 0:04:47
Average standard deviation of split frequencies: 0.007835
365500 -- (-1798.819) (-1790.911) (-1794.732) [-1787.070] * (-1798.172) (-1791.357) [-1793.458] (-1792.487) -- 0:04:46
366000 -- (-1804.681) [-1795.888] (-1793.905) (-1791.022) * [-1792.162] (-1784.353) (-1796.110) (-1792.062) -- 0:04:45
366500 -- (-1803.763) (-1801.012) (-1788.581) [-1796.336] * (-1803.663) (-1794.397) (-1794.897) [-1783.713] -- 0:04:45
367000 -- (-1794.778) (-1792.542) [-1782.198] (-1799.820) * [-1794.490] (-1795.497) (-1797.569) (-1790.471) -- 0:04:46
367500 -- (-1791.530) (-1795.666) [-1791.123] (-1792.161) * (-1792.438) [-1787.947] (-1790.151) (-1785.053) -- 0:04:45
368000 -- (-1807.223) (-1788.997) [-1789.243] (-1786.462) * (-1788.074) (-1785.446) (-1793.741) [-1781.897] -- 0:04:45
368500 -- (-1794.536) (-1790.245) (-1794.676) [-1789.325] * (-1797.870) (-1787.865) (-1790.311) [-1792.288] -- 0:04:44
369000 -- (-1792.940) (-1793.074) (-1790.824) [-1788.881] * (-1796.612) [-1793.042] (-1797.033) (-1794.471) -- 0:04:45
369500 -- (-1789.288) [-1794.164] (-1795.034) (-1795.928) * [-1787.184] (-1787.559) (-1802.021) (-1794.577) -- 0:04:44
370000 -- (-1798.483) [-1802.695] (-1797.920) (-1790.551) * (-1793.455) (-1795.715) [-1787.395] (-1788.305) -- 0:04:44
Average standard deviation of split frequencies: 0.006677
370500 -- (-1799.776) [-1797.245] (-1804.965) (-1791.146) * [-1788.890] (-1796.339) (-1793.396) (-1790.335) -- 0:04:43
371000 -- (-1792.808) [-1784.808] (-1796.378) (-1793.083) * [-1794.633] (-1791.670) (-1793.292) (-1793.466) -- 0:04:44
371500 -- (-1796.508) (-1790.154) [-1787.697] (-1789.156) * (-1792.425) [-1796.355] (-1789.098) (-1794.394) -- 0:04:44
372000 -- (-1789.052) (-1786.845) [-1800.487] (-1798.856) * (-1791.764) [-1794.930] (-1795.986) (-1799.125) -- 0:04:43
372500 -- (-1785.609) (-1789.786) [-1800.473] (-1791.252) * (-1791.753) [-1778.894] (-1792.234) (-1789.510) -- 0:04:43
373000 -- (-1791.995) (-1791.114) [-1782.874] (-1784.853) * [-1795.165] (-1796.542) (-1796.582) (-1789.136) -- 0:04:44
373500 -- (-1790.856) (-1793.020) [-1785.271] (-1794.075) * [-1791.036] (-1795.474) (-1788.230) (-1791.335) -- 0:04:43
374000 -- (-1788.836) (-1794.657) (-1783.706) [-1797.776] * (-1796.991) [-1793.204] (-1789.747) (-1789.432) -- 0:04:42
374500 -- (-1782.976) (-1798.337) (-1784.384) [-1787.256] * (-1789.351) (-1788.617) (-1790.186) [-1790.277] -- 0:04:42
375000 -- (-1784.227) (-1789.843) (-1793.584) [-1794.525] * [-1787.722] (-1803.996) (-1790.299) (-1790.119) -- 0:04:43
Average standard deviation of split frequencies: 0.005955
375500 -- (-1793.201) (-1807.652) (-1786.364) [-1794.146] * (-1793.505) [-1787.663] (-1791.483) (-1787.922) -- 0:04:42
376000 -- [-1786.226] (-1802.825) (-1785.966) (-1794.639) * (-1797.936) (-1798.858) [-1789.319] (-1790.825) -- 0:04:42
376500 -- (-1788.464) (-1794.930) (-1785.776) [-1793.369] * (-1792.350) (-1802.290) [-1797.359] (-1795.407) -- 0:04:41
377000 -- (-1793.487) [-1789.522] (-1790.500) (-1800.328) * (-1793.134) (-1797.884) (-1800.455) [-1793.209] -- 0:04:40
377500 -- [-1783.296] (-1784.934) (-1788.352) (-1798.895) * [-1792.264] (-1798.490) (-1796.449) (-1788.258) -- 0:04:41
378000 -- (-1790.994) [-1779.979] (-1798.044) (-1810.320) * (-1795.139) (-1787.233) (-1795.647) [-1782.623] -- 0:04:41
378500 -- (-1800.575) (-1789.460) (-1794.274) [-1795.799] * (-1790.989) (-1794.781) (-1794.995) [-1782.892] -- 0:04:40
379000 -- (-1795.664) [-1784.525] (-1788.452) (-1794.331) * (-1799.479) [-1785.312] (-1798.695) (-1788.360) -- 0:04:40
379500 -- (-1793.510) [-1786.725] (-1785.966) (-1788.351) * [-1796.298] (-1788.531) (-1796.401) (-1798.313) -- 0:04:41
380000 -- (-1797.815) [-1793.137] (-1793.255) (-1792.418) * (-1791.125) (-1784.260) [-1790.621] (-1795.704) -- 0:04:40
Average standard deviation of split frequencies: 0.006605
380500 -- (-1792.158) (-1793.907) [-1789.167] (-1788.006) * (-1791.322) [-1788.673] (-1788.628) (-1790.968) -- 0:04:40
381000 -- (-1789.052) (-1787.225) [-1782.169] (-1790.429) * (-1795.626) [-1791.108] (-1795.254) (-1790.552) -- 0:04:39
381500 -- (-1793.069) (-1797.965) (-1797.809) [-1796.312] * (-1790.818) (-1788.456) (-1796.074) [-1790.749] -- 0:04:38
382000 -- (-1790.328) [-1786.111] (-1797.994) (-1796.887) * [-1788.608] (-1801.570) (-1793.917) (-1798.799) -- 0:04:39
382500 -- (-1790.846) (-1788.126) (-1790.543) [-1788.762] * (-1797.055) [-1794.094] (-1790.807) (-1787.276) -- 0:04:39
383000 -- (-1792.488) (-1785.970) (-1793.249) [-1787.523] * (-1792.461) (-1790.130) (-1791.025) [-1788.065] -- 0:04:38
383500 -- (-1790.472) [-1791.322] (-1798.010) (-1797.954) * (-1791.102) (-1790.867) (-1800.332) [-1784.302] -- 0:04:38
384000 -- [-1789.971] (-1790.883) (-1798.496) (-1800.967) * (-1796.917) (-1794.684) (-1801.872) [-1791.315] -- 0:04:39
384500 -- (-1789.879) (-1795.907) (-1790.241) [-1795.654] * (-1797.869) (-1791.941) (-1789.455) [-1784.281] -- 0:04:38
385000 -- (-1794.725) (-1795.884) (-1793.754) [-1789.703] * (-1796.041) (-1791.476) (-1796.733) [-1783.658] -- 0:04:37
Average standard deviation of split frequencies: 0.005496
385500 -- (-1796.406) [-1803.616] (-1792.695) (-1793.570) * (-1787.647) (-1800.148) (-1796.803) [-1803.348] -- 0:04:37
386000 -- [-1787.557] (-1790.767) (-1796.656) (-1801.472) * (-1793.309) (-1792.822) (-1790.037) [-1791.618] -- 0:04:38
386500 -- (-1795.153) (-1790.076) [-1798.790] (-1792.034) * (-1796.407) (-1783.990) (-1788.041) [-1786.906] -- 0:04:37
387000 -- (-1797.878) (-1800.394) (-1793.557) [-1788.885] * (-1800.016) (-1788.623) (-1788.107) [-1787.829] -- 0:04:37
387500 -- [-1796.461] (-1796.252) (-1789.678) (-1799.553) * (-1798.588) (-1792.054) (-1788.984) [-1787.510] -- 0:04:36
388000 -- (-1796.877) [-1790.681] (-1787.883) (-1792.270) * (-1797.900) (-1786.681) (-1791.773) [-1796.447] -- 0:04:36
388500 -- [-1794.829] (-1793.578) (-1790.493) (-1796.553) * (-1795.043) [-1794.117] (-1791.603) (-1790.851) -- 0:04:37
389000 -- (-1795.625) [-1797.126] (-1797.880) (-1797.235) * (-1792.588) (-1795.979) (-1799.313) [-1784.742] -- 0:04:36
389500 -- [-1792.129] (-1805.338) (-1790.879) (-1790.990) * (-1788.532) (-1790.309) [-1787.680] (-1798.080) -- 0:04:35
390000 -- (-1795.298) (-1795.034) (-1798.294) [-1786.213] * [-1789.334] (-1788.380) (-1790.977) (-1801.309) -- 0:04:36
Average standard deviation of split frequencies: 0.006134
390500 -- [-1787.441] (-1790.675) (-1794.138) (-1797.025) * (-1790.912) (-1787.970) (-1788.325) [-1790.136] -- 0:04:36
391000 -- (-1798.383) (-1784.428) (-1785.556) [-1782.986] * [-1794.758] (-1797.445) (-1792.710) (-1795.259) -- 0:04:35
391500 -- (-1798.407) [-1786.727] (-1787.153) (-1783.281) * (-1792.450) (-1793.876) [-1792.577] (-1795.811) -- 0:04:35
392000 -- (-1788.045) (-1791.411) (-1798.922) [-1787.856] * [-1787.695] (-1787.069) (-1797.403) (-1786.304) -- 0:04:34
392500 -- (-1794.259) (-1800.055) (-1791.505) [-1784.698] * (-1793.757) (-1792.122) [-1792.051] (-1799.696) -- 0:04:35
393000 -- (-1803.743) (-1804.033) [-1787.070] (-1792.939) * [-1804.000] (-1795.504) (-1793.466) (-1790.278) -- 0:04:34
393500 -- (-1795.531) (-1794.891) [-1790.022] (-1792.479) * (-1802.685) (-1791.139) (-1799.518) [-1789.539] -- 0:04:34
394000 -- (-1797.342) [-1794.948] (-1800.309) (-1797.108) * [-1791.889] (-1796.004) (-1792.840) (-1797.435) -- 0:04:33
394500 -- (-1798.800) (-1798.053) [-1793.062] (-1797.187) * (-1797.058) [-1789.597] (-1800.777) (-1795.123) -- 0:04:34
395000 -- (-1791.156) [-1790.207] (-1801.096) (-1788.760) * (-1800.186) (-1787.634) (-1790.187) [-1786.191] -- 0:04:34
Average standard deviation of split frequencies: 0.006944
395500 -- (-1792.805) [-1791.013] (-1797.745) (-1786.028) * (-1791.582) [-1790.947] (-1795.109) (-1794.505) -- 0:04:33
396000 -- (-1798.503) (-1790.492) (-1790.871) [-1797.886] * (-1786.682) [-1787.810] (-1802.875) (-1785.115) -- 0:04:34
396500 -- (-1797.350) (-1787.084) [-1784.282] (-1788.195) * (-1796.988) (-1797.107) (-1799.869) [-1794.852] -- 0:04:33
397000 -- (-1799.104) (-1784.902) [-1788.362] (-1789.227) * (-1796.251) [-1784.190] (-1791.565) (-1799.212) -- 0:04:33
397500 -- (-1790.879) [-1789.615] (-1805.051) (-1792.922) * (-1791.677) (-1794.837) (-1789.075) [-1791.535] -- 0:04:32
398000 -- [-1798.869] (-1788.641) (-1791.672) (-1789.934) * (-1788.884) [-1793.751] (-1794.411) (-1804.542) -- 0:04:33
398500 -- (-1795.765) (-1789.477) (-1799.695) [-1786.595] * [-1787.700] (-1793.919) (-1792.197) (-1788.519) -- 0:04:33
399000 -- (-1792.673) (-1794.739) [-1788.504] (-1790.320) * (-1793.884) [-1792.100] (-1786.292) (-1790.864) -- 0:04:32
399500 -- (-1797.765) (-1795.384) (-1793.277) [-1790.373] * (-1795.644) (-1787.791) [-1786.534] (-1797.685) -- 0:04:32
400000 -- (-1795.618) (-1800.209) (-1794.793) [-1791.480] * (-1798.732) [-1801.013] (-1790.686) (-1792.059) -- 0:04:33
Average standard deviation of split frequencies: 0.006569
400500 -- [-1783.861] (-1785.652) (-1795.543) (-1788.130) * (-1791.804) [-1791.868] (-1795.542) (-1794.456) -- 0:04:32
401000 -- (-1787.661) (-1797.488) [-1790.589] (-1792.432) * [-1792.370] (-1788.815) (-1792.856) (-1790.179) -- 0:04:31
401500 -- (-1787.432) (-1788.287) (-1790.286) [-1785.997] * (-1791.646) [-1794.152] (-1785.288) (-1794.123) -- 0:04:31
402000 -- (-1788.828) (-1789.468) [-1787.327] (-1808.335) * [-1788.586] (-1805.061) (-1791.654) (-1790.057) -- 0:04:32
402500 -- (-1794.725) (-1786.996) (-1793.086) [-1798.355] * (-1787.592) (-1790.942) [-1795.960] (-1790.925) -- 0:04:31
403000 -- (-1791.520) (-1788.839) [-1781.246] (-1794.984) * [-1787.823] (-1787.817) (-1796.641) (-1795.446) -- 0:04:31
403500 -- (-1799.637) (-1792.698) [-1787.114] (-1792.747) * [-1790.096] (-1788.650) (-1789.993) (-1798.059) -- 0:04:30
404000 -- (-1794.625) [-1794.032] (-1794.440) (-1790.192) * (-1798.927) (-1792.316) (-1791.250) [-1789.164] -- 0:04:31
404500 -- [-1800.054] (-1784.320) (-1790.942) (-1791.228) * [-1786.587] (-1789.477) (-1796.141) (-1797.481) -- 0:04:30
405000 -- [-1795.623] (-1788.092) (-1795.723) (-1786.281) * (-1790.414) (-1787.075) (-1803.274) [-1800.860] -- 0:04:30
Average standard deviation of split frequencies: 0.007547
405500 -- [-1789.330] (-1789.649) (-1787.652) (-1788.299) * (-1785.323) (-1796.544) (-1790.957) [-1790.203] -- 0:04:31
406000 -- [-1786.266] (-1797.459) (-1791.695) (-1785.354) * (-1797.666) (-1789.017) [-1795.534] (-1788.968) -- 0:04:30
406500 -- (-1785.650) [-1787.396] (-1794.241) (-1794.060) * (-1796.884) (-1793.649) (-1793.737) [-1790.477] -- 0:04:30
407000 -- (-1783.569) (-1795.398) (-1787.214) [-1789.581] * (-1807.164) (-1786.459) [-1789.631] (-1789.338) -- 0:04:29
407500 -- (-1787.826) (-1787.259) (-1790.192) [-1790.494] * [-1794.611] (-1791.193) (-1791.798) (-1796.509) -- 0:04:30
408000 -- (-1781.400) [-1786.115] (-1791.544) (-1785.135) * (-1787.537) (-1791.702) (-1791.637) [-1795.684] -- 0:04:29
408500 -- [-1783.360] (-1794.946) (-1793.847) (-1796.983) * (-1797.300) (-1795.954) [-1788.786] (-1801.524) -- 0:04:29
409000 -- (-1786.632) (-1791.682) [-1792.558] (-1798.435) * (-1798.488) (-1796.472) (-1793.799) [-1793.572] -- 0:04:28
409500 -- (-1789.518) (-1792.792) [-1794.092] (-1789.831) * (-1794.958) [-1791.317] (-1784.022) (-1788.576) -- 0:04:29
410000 -- (-1785.104) (-1799.853) (-1792.178) [-1793.194] * (-1792.400) (-1793.918) (-1791.138) [-1794.640] -- 0:04:29
Average standard deviation of split frequencies: 0.007653
410500 -- [-1788.257] (-1805.063) (-1793.617) (-1789.189) * (-1788.779) (-1789.353) (-1794.791) [-1797.971] -- 0:04:28
411000 -- [-1789.667] (-1797.254) (-1793.917) (-1790.383) * (-1792.975) [-1788.521] (-1788.176) (-1799.776) -- 0:04:27
411500 -- (-1792.210) (-1781.233) (-1790.150) [-1791.776] * [-1786.245] (-1794.510) (-1789.382) (-1796.544) -- 0:04:28
412000 -- (-1795.081) [-1790.760] (-1782.867) (-1798.247) * (-1806.068) (-1794.420) [-1793.720] (-1794.095) -- 0:04:28
412500 -- (-1792.215) (-1789.928) [-1792.158] (-1796.564) * (-1789.923) (-1804.832) [-1797.006] (-1791.269) -- 0:04:27
413000 -- [-1793.354] (-1799.096) (-1793.454) (-1788.794) * (-1784.767) (-1788.991) [-1790.937] (-1797.068) -- 0:04:27
413500 -- [-1792.018] (-1790.440) (-1791.550) (-1793.035) * (-1792.695) (-1790.324) [-1788.379] (-1800.513) -- 0:04:28
414000 -- [-1791.710] (-1794.060) (-1795.103) (-1795.833) * (-1791.486) (-1791.196) [-1788.957] (-1785.644) -- 0:04:27
414500 -- (-1800.137) [-1786.769] (-1793.533) (-1789.534) * (-1794.452) (-1797.093) (-1792.726) [-1783.790] -- 0:04:26
415000 -- (-1804.230) (-1795.784) [-1788.326] (-1798.452) * (-1787.361) (-1785.496) [-1786.114] (-1798.821) -- 0:04:27
Average standard deviation of split frequencies: 0.006705
415500 -- (-1800.939) (-1795.734) [-1788.492] (-1796.279) * (-1792.654) (-1788.449) [-1792.312] (-1795.687) -- 0:04:27
416000 -- (-1811.730) (-1788.356) [-1792.475] (-1791.673) * (-1795.241) [-1796.696] (-1786.124) (-1789.588) -- 0:04:26
416500 -- [-1791.213] (-1798.325) (-1791.780) (-1800.246) * (-1794.895) (-1804.891) [-1788.540] (-1795.640) -- 0:04:26
417000 -- (-1790.397) [-1787.262] (-1796.106) (-1796.632) * (-1791.213) [-1792.429] (-1795.138) (-1787.569) -- 0:04:27
417500 -- (-1782.974) [-1787.505] (-1798.945) (-1787.639) * (-1800.369) (-1790.414) [-1787.239] (-1792.311) -- 0:04:26
418000 -- (-1790.963) (-1799.705) (-1800.839) [-1788.247] * (-1798.083) [-1795.757] (-1792.236) (-1789.299) -- 0:04:25
418500 -- [-1792.616] (-1793.675) (-1793.737) (-1789.840) * (-1791.968) (-1789.104) [-1786.973] (-1802.279) -- 0:04:25
419000 -- (-1794.979) (-1794.215) (-1789.813) [-1786.913] * (-1792.848) [-1792.683] (-1794.252) (-1803.832) -- 0:04:26
419500 -- [-1794.208] (-1789.431) (-1789.679) (-1790.899) * [-1792.635] (-1790.093) (-1791.602) (-1793.946) -- 0:04:25
420000 -- (-1796.112) [-1793.190] (-1787.667) (-1795.444) * [-1785.640] (-1795.253) (-1797.188) (-1791.724) -- 0:04:25
Average standard deviation of split frequencies: 0.007844
420500 -- (-1795.653) [-1793.797] (-1790.864) (-1791.440) * [-1790.370] (-1795.713) (-1788.821) (-1789.290) -- 0:04:24
421000 -- (-1791.509) (-1787.992) [-1790.302] (-1798.449) * (-1796.732) (-1798.032) [-1793.455] (-1793.266) -- 0:04:25
421500 -- [-1786.103] (-1787.239) (-1799.920) (-1795.891) * (-1795.137) [-1790.346] (-1783.339) (-1791.484) -- 0:04:24
422000 -- (-1786.757) (-1793.064) (-1792.764) [-1782.914] * (-1797.052) [-1788.729] (-1791.758) (-1793.604) -- 0:04:24
422500 -- [-1781.389] (-1787.323) (-1791.644) (-1795.266) * (-1798.239) [-1784.905] (-1795.416) (-1795.865) -- 0:04:23
423000 -- (-1794.051) [-1780.977] (-1791.735) (-1795.354) * (-1798.043) (-1793.920) (-1796.153) [-1794.630] -- 0:04:24
423500 -- (-1791.441) (-1791.912) (-1805.471) [-1790.071] * [-1794.337] (-1803.233) (-1793.978) (-1798.460) -- 0:04:24
424000 -- [-1783.883] (-1790.688) (-1793.935) (-1797.806) * [-1787.016] (-1790.295) (-1795.785) (-1791.517) -- 0:04:23
424500 -- (-1794.867) (-1795.123) (-1794.349) [-1791.468] * (-1799.931) (-1787.482) [-1789.948] (-1791.563) -- 0:04:23
425000 -- (-1796.081) (-1789.297) [-1790.983] (-1788.831) * [-1785.032] (-1789.612) (-1793.344) (-1794.779) -- 0:04:23
Average standard deviation of split frequencies: 0.007193
425500 -- (-1786.948) [-1795.902] (-1796.328) (-1795.466) * [-1784.169] (-1797.292) (-1793.188) (-1796.382) -- 0:04:23
426000 -- (-1795.465) (-1794.140) (-1795.783) [-1796.157] * (-1791.218) [-1792.123] (-1787.746) (-1794.053) -- 0:04:22
426500 -- (-1797.528) (-1780.380) [-1791.740] (-1795.957) * (-1797.362) (-1799.083) (-1788.680) [-1791.034] -- 0:04:22
427000 -- [-1791.720] (-1797.597) (-1795.167) (-1783.556) * (-1792.359) (-1799.130) [-1791.989] (-1796.220) -- 0:04:23
427500 -- (-1790.914) (-1783.844) (-1790.780) [-1795.259] * (-1789.934) (-1792.342) (-1785.715) [-1785.820] -- 0:04:22
428000 -- (-1792.665) (-1791.880) [-1786.470] (-1803.703) * (-1791.555) (-1798.324) (-1785.964) [-1787.012] -- 0:04:21
428500 -- (-1790.028) [-1785.287] (-1792.057) (-1796.773) * [-1789.426] (-1806.216) (-1800.430) (-1794.398) -- 0:04:22
429000 -- (-1800.431) [-1792.944] (-1792.351) (-1795.479) * (-1791.408) (-1815.468) [-1795.452] (-1797.982) -- 0:04:22
429500 -- (-1789.672) (-1796.900) [-1788.183] (-1785.160) * (-1799.153) (-1800.540) [-1783.619] (-1794.811) -- 0:04:21
430000 -- [-1790.270] (-1796.919) (-1793.883) (-1790.355) * (-1794.419) (-1805.771) (-1791.671) [-1800.193] -- 0:04:21
Average standard deviation of split frequencies: 0.005108
430500 -- (-1785.485) (-1793.292) [-1789.961] (-1788.560) * [-1794.354] (-1794.452) (-1794.455) (-1802.626) -- 0:04:21
431000 -- [-1791.449] (-1795.435) (-1790.315) (-1797.612) * (-1790.263) [-1788.406] (-1790.641) (-1805.452) -- 0:04:21
431500 -- (-1789.321) [-1794.104] (-1794.779) (-1795.785) * (-1793.732) (-1794.076) [-1789.258] (-1799.849) -- 0:04:20
432000 -- [-1786.986] (-1788.391) (-1795.434) (-1801.163) * (-1792.483) (-1798.618) [-1794.699] (-1795.902) -- 0:04:20
432500 -- (-1787.258) [-1794.098] (-1786.415) (-1793.813) * (-1788.231) [-1792.431] (-1793.927) (-1799.404) -- 0:04:21
433000 -- (-1800.248) (-1789.230) [-1788.940] (-1788.194) * (-1796.080) [-1789.205] (-1786.143) (-1801.507) -- 0:04:20
433500 -- (-1798.719) [-1791.507] (-1788.112) (-1784.928) * (-1800.303) (-1787.100) [-1786.017] (-1792.546) -- 0:04:20
434000 -- (-1792.308) (-1792.327) [-1786.878] (-1794.524) * (-1794.597) [-1787.141] (-1786.525) (-1792.650) -- 0:04:20
434500 -- [-1791.790] (-1782.640) (-1793.677) (-1789.254) * (-1795.067) (-1791.399) (-1790.458) [-1790.217] -- 0:04:20
435000 -- (-1787.375) [-1785.476] (-1794.073) (-1801.567) * [-1790.915] (-1786.215) (-1801.893) (-1790.699) -- 0:04:19
Average standard deviation of split frequencies: 0.004685
435500 -- [-1790.424] (-1784.284) (-1799.723) (-1790.533) * (-1792.204) [-1785.032] (-1800.038) (-1793.640) -- 0:04:19
436000 -- (-1791.741) [-1788.037] (-1794.417) (-1791.340) * [-1796.843] (-1792.293) (-1808.211) (-1792.021) -- 0:04:18
436500 -- [-1796.878] (-1789.366) (-1786.140) (-1796.140) * (-1791.731) (-1796.224) [-1800.734] (-1791.317) -- 0:04:19
437000 -- (-1787.174) (-1806.348) [-1791.595] (-1800.650) * [-1785.012] (-1804.616) (-1803.012) (-1793.891) -- 0:04:18
437500 -- (-1789.112) [-1783.081] (-1796.399) (-1791.692) * (-1795.464) [-1789.755] (-1811.710) (-1793.676) -- 0:04:18
438000 -- [-1785.155] (-1795.765) (-1793.171) (-1807.529) * (-1803.692) (-1793.832) (-1800.796) [-1782.596] -- 0:04:17
438500 -- (-1795.500) [-1786.426] (-1792.332) (-1791.639) * [-1802.716] (-1788.249) (-1793.831) (-1784.818) -- 0:04:18
439000 -- (-1789.429) (-1790.432) [-1792.688] (-1789.876) * (-1789.222) (-1789.053) (-1789.580) [-1791.105] -- 0:04:18
439500 -- (-1790.860) (-1786.729) [-1790.053] (-1794.188) * [-1785.748] (-1790.154) (-1788.287) (-1792.960) -- 0:04:17
440000 -- (-1797.073) (-1785.495) [-1786.071] (-1788.946) * (-1786.293) [-1793.180] (-1797.922) (-1797.570) -- 0:04:17
Average standard deviation of split frequencies: 0.004546
440500 -- (-1796.398) [-1791.857] (-1786.371) (-1793.740) * (-1792.950) (-1792.062) [-1786.895] (-1793.673) -- 0:04:17
441000 -- (-1791.892) [-1792.437] (-1799.262) (-1800.446) * (-1798.471) (-1795.412) [-1792.970] (-1791.500) -- 0:04:17
441500 -- (-1799.546) (-1790.703) [-1781.077] (-1800.688) * [-1784.317] (-1797.975) (-1786.422) (-1797.319) -- 0:04:16
442000 -- (-1794.136) (-1798.005) (-1792.060) [-1791.715] * (-1804.785) [-1800.091] (-1796.839) (-1788.994) -- 0:04:16
442500 -- (-1793.349) [-1794.472] (-1794.455) (-1796.927) * (-1801.507) [-1791.646] (-1795.590) (-1788.320) -- 0:04:15
443000 -- (-1790.441) (-1787.180) (-1798.179) [-1789.439] * (-1789.414) [-1789.551] (-1793.838) (-1790.490) -- 0:04:16
443500 -- (-1787.278) [-1783.786] (-1796.012) (-1794.244) * (-1799.812) (-1794.326) (-1793.154) [-1794.633] -- 0:04:15
444000 -- (-1796.284) (-1784.930) [-1788.703] (-1789.229) * (-1791.930) [-1789.427] (-1795.951) (-1786.354) -- 0:04:15
444500 -- (-1788.192) (-1791.131) [-1790.640] (-1800.860) * [-1788.777] (-1792.664) (-1796.664) (-1801.236) -- 0:04:14
445000 -- (-1792.226) (-1787.781) [-1797.004] (-1799.169) * (-1789.584) [-1789.928] (-1795.997) (-1794.649) -- 0:04:15
Average standard deviation of split frequencies: 0.004580
445500 -- (-1792.595) (-1791.968) (-1791.050) [-1790.737] * (-1788.916) (-1797.477) (-1790.011) [-1796.452] -- 0:04:15
446000 -- (-1792.408) (-1785.493) (-1796.274) [-1785.111] * (-1787.567) [-1783.742] (-1791.500) (-1790.592) -- 0:04:14
446500 -- (-1793.220) [-1791.158] (-1792.710) (-1798.271) * (-1787.927) [-1786.523] (-1793.174) (-1795.334) -- 0:04:14
447000 -- [-1786.693] (-1803.199) (-1794.211) (-1791.934) * (-1784.080) (-1790.276) (-1796.056) [-1792.698] -- 0:04:14
447500 -- (-1795.035) (-1790.223) (-1788.853) [-1786.807] * (-1792.825) [-1789.834] (-1794.679) (-1802.780) -- 0:04:14
448000 -- (-1805.649) (-1791.907) [-1793.092] (-1789.557) * (-1788.856) [-1791.747] (-1786.817) (-1797.687) -- 0:04:13
448500 -- [-1793.276] (-1796.532) (-1799.342) (-1788.530) * (-1797.956) (-1789.099) (-1795.148) [-1793.938] -- 0:04:13
449000 -- (-1788.076) (-1789.408) [-1794.690] (-1788.189) * [-1784.938] (-1794.316) (-1796.122) (-1795.711) -- 0:04:12
449500 -- [-1785.300] (-1791.322) (-1797.918) (-1800.133) * (-1794.401) [-1787.964] (-1799.144) (-1794.436) -- 0:04:13
450000 -- (-1788.832) [-1789.609] (-1785.787) (-1792.298) * [-1783.828] (-1795.255) (-1801.694) (-1797.872) -- 0:04:13
Average standard deviation of split frequencies: 0.004271
450500 -- [-1785.600] (-1788.258) (-1794.811) (-1793.926) * (-1793.071) (-1788.061) (-1796.173) [-1789.328] -- 0:04:12
451000 -- [-1787.643] (-1790.032) (-1784.566) (-1795.528) * (-1791.120) (-1797.419) (-1790.120) [-1785.815] -- 0:04:11
451500 -- (-1799.840) (-1798.676) [-1791.574] (-1801.756) * [-1788.041] (-1794.950) (-1795.960) (-1796.077) -- 0:04:12
452000 -- (-1789.988) (-1794.992) [-1787.082] (-1796.707) * (-1787.003) [-1794.238] (-1795.399) (-1793.005) -- 0:04:12
452500 -- [-1789.253] (-1788.689) (-1791.447) (-1792.230) * [-1786.523] (-1793.839) (-1788.308) (-1790.416) -- 0:04:11
453000 -- (-1791.504) (-1794.512) [-1785.801] (-1794.623) * (-1791.173) (-1789.579) [-1794.791] (-1795.128) -- 0:04:11
453500 -- (-1793.668) [-1795.591] (-1792.735) (-1799.107) * (-1799.985) (-1791.725) (-1797.655) [-1796.663] -- 0:04:11
454000 -- (-1792.517) (-1794.012) [-1783.048] (-1806.449) * (-1792.623) (-1797.535) (-1789.929) [-1791.469] -- 0:04:11
454500 -- (-1797.184) [-1790.252] (-1795.003) (-1787.722) * (-1787.420) (-1794.052) [-1788.807] (-1785.130) -- 0:04:10
455000 -- (-1788.794) (-1792.178) (-1791.754) [-1794.477] * (-1784.655) (-1794.301) (-1799.866) [-1791.872] -- 0:04:10
Average standard deviation of split frequencies: 0.003446
455500 -- (-1794.782) (-1786.997) (-1788.155) [-1795.349] * (-1791.470) [-1788.335] (-1791.262) (-1793.733) -- 0:04:11
456000 -- (-1810.261) (-1792.107) [-1781.911] (-1783.433) * (-1793.603) [-1790.837] (-1797.745) (-1790.355) -- 0:04:10
456500 -- (-1801.384) (-1790.461) [-1796.644] (-1801.693) * (-1798.672) (-1788.418) [-1783.612] (-1790.654) -- 0:04:10
457000 -- (-1789.637) [-1785.718] (-1780.808) (-1795.846) * (-1792.635) (-1798.731) [-1786.254] (-1796.823) -- 0:04:09
457500 -- (-1793.393) (-1802.664) (-1791.278) [-1795.032] * (-1789.588) [-1795.302] (-1799.611) (-1800.311) -- 0:04:09
458000 -- (-1790.463) (-1799.460) [-1790.554] (-1795.132) * (-1791.573) (-1784.933) [-1794.494] (-1787.199) -- 0:04:09
458500 -- [-1784.808] (-1787.641) (-1799.763) (-1787.888) * [-1791.219] (-1786.947) (-1789.000) (-1793.416) -- 0:04:09
459000 -- (-1796.822) (-1789.576) [-1785.153] (-1790.604) * (-1802.001) (-1800.680) (-1792.392) [-1787.761] -- 0:04:08
459500 -- (-1795.269) [-1792.708] (-1788.120) (-1795.887) * (-1795.377) (-1788.595) (-1786.554) [-1790.374] -- 0:04:08
460000 -- (-1802.350) [-1794.445] (-1787.929) (-1785.099) * (-1790.974) (-1789.041) (-1795.854) [-1793.247] -- 0:04:08
Average standard deviation of split frequencies: 0.003411
460500 -- (-1799.887) [-1789.203] (-1791.473) (-1793.660) * (-1793.364) (-1788.892) [-1787.094] (-1785.404) -- 0:04:08
461000 -- [-1797.556] (-1788.584) (-1786.620) (-1794.709) * (-1797.408) (-1788.903) (-1806.025) [-1787.826] -- 0:04:07
461500 -- (-1797.302) (-1790.228) [-1790.336] (-1788.848) * (-1795.634) [-1793.687] (-1797.588) (-1789.477) -- 0:04:07
462000 -- (-1795.948) [-1788.338] (-1792.853) (-1796.299) * (-1794.718) (-1794.539) (-1792.750) [-1786.601] -- 0:04:08
462500 -- (-1786.462) (-1785.797) (-1794.094) [-1792.443] * (-1796.169) (-1798.100) [-1786.636] (-1795.052) -- 0:04:07
463000 -- [-1790.044] (-1785.520) (-1791.214) (-1800.815) * (-1800.142) [-1798.232] (-1794.627) (-1797.947) -- 0:04:07
463500 -- [-1785.997] (-1800.123) (-1790.253) (-1793.523) * [-1788.958] (-1794.969) (-1794.572) (-1789.461) -- 0:04:06
464000 -- (-1790.560) [-1793.517] (-1794.790) (-1789.916) * (-1791.162) [-1787.590] (-1789.872) (-1787.564) -- 0:04:06
464500 -- (-1800.542) (-1792.240) (-1801.250) [-1785.157] * (-1796.209) (-1790.548) (-1794.438) [-1786.403] -- 0:04:06
465000 -- [-1792.937] (-1796.910) (-1794.097) (-1791.780) * (-1798.699) (-1791.328) [-1793.667] (-1795.090) -- 0:04:06
Average standard deviation of split frequencies: 0.002866
465500 -- (-1796.573) [-1790.411] (-1792.397) (-1801.039) * [-1783.610] (-1793.894) (-1798.411) (-1795.495) -- 0:04:05
466000 -- [-1789.678] (-1794.570) (-1791.850) (-1790.670) * (-1789.357) (-1792.979) (-1792.946) [-1797.146] -- 0:04:05
466500 -- (-1796.937) [-1792.103] (-1790.040) (-1800.487) * (-1795.079) [-1786.099] (-1786.122) (-1793.559) -- 0:04:05
467000 -- [-1788.288] (-1792.617) (-1786.114) (-1799.974) * (-1785.684) [-1783.124] (-1798.434) (-1786.197) -- 0:04:05
467500 -- (-1785.784) [-1789.667] (-1793.223) (-1797.053) * (-1795.256) (-1800.556) [-1797.454] (-1788.908) -- 0:04:04
468000 -- (-1786.249) [-1785.603] (-1793.177) (-1795.895) * (-1793.998) (-1792.642) [-1792.851] (-1788.906) -- 0:04:04
468500 -- (-1791.385) [-1789.981] (-1793.765) (-1794.919) * (-1792.838) (-1793.137) (-1795.696) [-1786.767] -- 0:04:05
469000 -- (-1791.331) (-1789.317) [-1792.520] (-1799.882) * (-1785.328) (-1801.684) (-1797.959) [-1790.577] -- 0:04:04
469500 -- (-1797.241) (-1786.604) [-1789.827] (-1785.433) * (-1788.115) (-1797.516) [-1789.637] (-1793.522) -- 0:04:04
470000 -- (-1797.441) (-1793.986) [-1796.583] (-1793.225) * (-1791.374) [-1788.740] (-1799.938) (-1800.800) -- 0:04:03
Average standard deviation of split frequencies: 0.002838
470500 -- (-1794.688) (-1785.026) (-1791.371) [-1790.274] * [-1789.539] (-1791.704) (-1800.048) (-1791.838) -- 0:04:03
471000 -- (-1803.808) [-1793.347] (-1794.825) (-1793.183) * (-1786.106) (-1789.083) [-1784.656] (-1800.596) -- 0:04:03
471500 -- (-1799.092) (-1787.025) (-1788.325) [-1791.640] * (-1790.728) (-1790.187) (-1787.057) [-1787.190] -- 0:04:03
472000 -- (-1794.789) (-1793.561) (-1792.291) [-1797.301] * [-1787.413] (-1793.220) (-1791.705) (-1796.301) -- 0:04:02
472500 -- [-1788.896] (-1792.209) (-1787.430) (-1792.504) * (-1792.795) (-1792.651) [-1792.964] (-1796.413) -- 0:04:02
473000 -- (-1789.814) [-1785.005] (-1792.756) (-1793.170) * (-1790.990) (-1791.067) [-1789.847] (-1795.399) -- 0:04:02
473500 -- (-1788.039) (-1795.559) (-1787.213) [-1790.449] * (-1790.694) (-1794.513) (-1788.162) [-1793.979] -- 0:04:02
474000 -- (-1786.405) (-1806.313) (-1789.040) [-1785.968] * (-1799.685) (-1792.549) (-1789.639) [-1801.551] -- 0:04:01
474500 -- (-1796.055) (-1793.096) [-1792.172] (-1799.588) * (-1789.452) (-1800.058) [-1790.589] (-1790.951) -- 0:04:01
475000 -- (-1789.475) (-1786.280) [-1786.881] (-1794.662) * (-1796.258) (-1801.125) (-1788.104) [-1796.656] -- 0:04:02
Average standard deviation of split frequencies: 0.003054
475500 -- (-1795.591) (-1794.549) [-1788.195] (-1788.188) * [-1800.820] (-1797.814) (-1783.503) (-1797.214) -- 0:04:01
476000 -- (-1790.573) (-1786.329) (-1794.586) [-1793.006] * (-1794.270) (-1792.893) [-1784.365] (-1794.261) -- 0:04:01
476500 -- (-1791.760) (-1800.487) (-1781.637) [-1787.792] * (-1789.468) [-1791.350] (-1789.347) (-1794.505) -- 0:04:00
477000 -- [-1788.956] (-1793.098) (-1790.611) (-1789.907) * (-1783.596) [-1786.845] (-1784.324) (-1808.033) -- 0:04:00
477500 -- (-1795.004) [-1786.146] (-1793.701) (-1798.018) * (-1787.703) (-1798.777) [-1795.017] (-1796.444) -- 0:04:00
478000 -- (-1789.426) [-1790.723] (-1792.832) (-1793.125) * [-1787.876] (-1790.368) (-1791.660) (-1795.589) -- 0:04:00
478500 -- (-1796.405) (-1789.771) [-1788.776] (-1798.388) * (-1795.302) [-1788.118] (-1792.829) (-1808.264) -- 0:03:59
479000 -- (-1793.449) (-1790.756) [-1787.453] (-1797.187) * (-1787.647) (-1790.141) [-1788.599] (-1804.599) -- 0:03:59
479500 -- [-1788.419] (-1797.787) (-1784.252) (-1797.054) * (-1794.046) (-1786.722) (-1790.327) [-1794.015] -- 0:03:59
480000 -- (-1787.974) (-1787.106) (-1798.461) [-1793.424] * (-1784.859) (-1796.974) (-1800.046) [-1789.613] -- 0:03:59
Average standard deviation of split frequencies: 0.003351
480500 -- (-1799.653) [-1790.872] (-1786.265) (-1793.850) * (-1795.031) (-1796.889) [-1788.500] (-1789.323) -- 0:03:58
481000 -- (-1791.337) (-1791.813) (-1796.681) [-1792.940] * (-1785.627) (-1802.398) [-1789.927] (-1788.976) -- 0:03:58
481500 -- (-1788.792) (-1789.716) [-1791.834] (-1788.225) * (-1795.481) (-1784.298) (-1791.615) [-1789.234] -- 0:03:59
482000 -- (-1788.046) (-1791.134) (-1798.819) [-1785.876] * (-1788.054) [-1791.025] (-1801.287) (-1802.034) -- 0:03:58
482500 -- [-1792.382] (-1797.713) (-1792.725) (-1792.499) * (-1797.518) [-1785.919] (-1792.431) (-1791.733) -- 0:03:58
483000 -- (-1796.262) [-1793.851] (-1790.984) (-1791.157) * [-1789.904] (-1794.564) (-1790.885) (-1795.851) -- 0:03:57
483500 -- (-1793.052) (-1790.703) (-1797.416) [-1796.247] * [-1785.845] (-1796.267) (-1789.370) (-1792.332) -- 0:03:57
484000 -- (-1797.684) (-1784.672) (-1794.404) [-1784.688] * [-1787.901] (-1795.136) (-1798.417) (-1796.795) -- 0:03:57
484500 -- (-1800.659) [-1786.897] (-1792.276) (-1785.363) * (-1792.504) [-1784.097] (-1800.037) (-1793.666) -- 0:03:57
485000 -- (-1790.199) (-1788.880) [-1786.244] (-1791.880) * (-1791.035) (-1792.339) [-1792.834] (-1789.995) -- 0:03:56
Average standard deviation of split frequencies: 0.003961
485500 -- (-1786.480) (-1793.270) [-1792.140] (-1794.634) * (-1789.557) (-1795.377) (-1794.933) [-1792.791] -- 0:03:56
486000 -- (-1793.599) (-1797.756) [-1791.680] (-1785.474) * (-1795.830) (-1799.217) (-1787.765) [-1803.438] -- 0:03:56
486500 -- (-1792.083) (-1795.531) [-1788.586] (-1800.518) * (-1789.619) [-1796.167] (-1799.406) (-1797.604) -- 0:03:56
487000 -- (-1786.901) (-1793.924) [-1783.012] (-1795.721) * (-1798.992) (-1787.050) (-1786.524) [-1793.416] -- 0:03:55
487500 -- (-1789.959) (-1790.926) [-1784.221] (-1791.571) * (-1792.282) (-1794.826) [-1786.162] (-1786.860) -- 0:03:55
488000 -- (-1793.304) [-1788.541] (-1796.113) (-1791.607) * (-1787.622) (-1796.408) [-1787.723] (-1789.727) -- 0:03:56
488500 -- (-1790.254) [-1788.209] (-1789.136) (-1791.022) * (-1787.915) (-1797.556) [-1784.205] (-1791.890) -- 0:03:55
489000 -- [-1787.667] (-1797.110) (-1791.854) (-1800.684) * (-1789.629) [-1790.193] (-1789.029) (-1790.436) -- 0:03:55
489500 -- (-1789.115) [-1782.472] (-1791.436) (-1792.177) * (-1791.791) (-1799.797) [-1796.113] (-1784.916) -- 0:03:54
490000 -- (-1785.262) (-1790.294) [-1787.395] (-1794.360) * (-1802.707) [-1790.148] (-1788.582) (-1792.162) -- 0:03:54
Average standard deviation of split frequencies: 0.004083
490500 -- (-1793.926) (-1803.519) [-1790.669] (-1799.330) * [-1790.037] (-1786.215) (-1804.216) (-1787.782) -- 0:03:54
491000 -- [-1790.202] (-1787.101) (-1791.255) (-1813.081) * (-1791.355) [-1790.014] (-1801.107) (-1795.172) -- 0:03:54
491500 -- (-1804.957) [-1791.402] (-1797.759) (-1792.451) * [-1785.397] (-1796.800) (-1788.726) (-1789.739) -- 0:03:53
492000 -- (-1797.390) (-1795.506) (-1791.690) [-1790.436] * [-1785.448] (-1798.001) (-1790.499) (-1796.870) -- 0:03:53
492500 -- (-1794.593) (-1801.048) [-1782.780] (-1799.307) * [-1786.745] (-1790.965) (-1787.290) (-1787.395) -- 0:03:53
493000 -- [-1784.079] (-1784.884) (-1793.349) (-1789.256) * (-1787.874) (-1794.515) (-1792.966) [-1789.369] -- 0:03:53
493500 -- (-1804.708) (-1795.147) (-1789.489) [-1788.186] * [-1783.526] (-1794.472) (-1792.528) (-1790.400) -- 0:03:52
494000 -- (-1795.855) [-1786.474] (-1788.920) (-1794.556) * [-1790.170] (-1792.743) (-1800.982) (-1788.925) -- 0:03:52
494500 -- [-1790.019] (-1794.030) (-1788.119) (-1798.722) * [-1790.228] (-1787.618) (-1788.918) (-1791.233) -- 0:03:53
495000 -- (-1792.803) [-1790.367] (-1788.025) (-1793.878) * (-1802.231) [-1790.007] (-1783.462) (-1789.367) -- 0:03:52
Average standard deviation of split frequencies: 0.004039
495500 -- [-1788.288] (-1792.442) (-1796.123) (-1809.417) * [-1800.498] (-1789.615) (-1804.351) (-1796.816) -- 0:03:52
496000 -- (-1806.145) (-1801.941) [-1787.477] (-1801.795) * (-1791.811) (-1802.097) [-1793.244] (-1791.508) -- 0:03:51
496500 -- (-1797.769) [-1785.920] (-1795.023) (-1795.246) * (-1807.099) [-1788.016] (-1791.660) (-1791.187) -- 0:03:51
497000 -- (-1788.041) (-1794.626) [-1788.777] (-1785.917) * [-1793.041] (-1795.037) (-1798.606) (-1798.650) -- 0:03:51
497500 -- (-1791.972) (-1791.643) (-1791.887) [-1786.893] * (-1789.128) (-1794.248) (-1789.641) [-1791.683] -- 0:03:51
498000 -- (-1793.680) (-1804.382) [-1792.233] (-1789.732) * [-1791.408] (-1801.555) (-1790.632) (-1793.417) -- 0:03:50
498500 -- (-1788.337) [-1794.803] (-1787.346) (-1794.543) * (-1791.940) [-1800.651] (-1783.364) (-1793.747) -- 0:03:50
499000 -- [-1789.054] (-1793.958) (-1798.755) (-1797.780) * (-1794.218) (-1802.669) [-1786.785] (-1797.720) -- 0:03:50
499500 -- [-1790.486] (-1789.363) (-1798.000) (-1790.413) * (-1785.207) (-1791.854) (-1796.808) [-1793.330] -- 0:03:50
500000 -- (-1804.691) (-1796.557) [-1788.228] (-1791.797) * (-1794.792) (-1797.258) [-1789.570] (-1790.627) -- 0:03:50
Average standard deviation of split frequencies: 0.004080
500500 -- (-1797.596) (-1791.190) [-1787.026] (-1789.984) * [-1789.089] (-1789.797) (-1799.244) (-1797.310) -- 0:03:49
501000 -- (-1787.323) [-1790.953] (-1780.970) (-1792.894) * (-1789.324) (-1794.748) (-1788.690) [-1790.891] -- 0:03:50
501500 -- [-1792.541] (-1789.924) (-1783.566) (-1792.546) * (-1794.291) (-1792.661) [-1793.907] (-1799.959) -- 0:03:49
502000 -- (-1788.255) [-1796.730] (-1794.946) (-1800.353) * (-1784.580) (-1799.234) (-1788.487) [-1793.917] -- 0:03:49
502500 -- (-1795.646) [-1791.754] (-1789.677) (-1797.089) * [-1790.723] (-1790.869) (-1790.079) (-1791.827) -- 0:03:48
503000 -- (-1796.509) [-1785.711] (-1797.963) (-1798.912) * (-1794.762) (-1803.954) [-1796.937] (-1796.433) -- 0:03:49
503500 -- (-1793.945) (-1793.240) (-1790.847) [-1795.255] * (-1795.684) [-1791.937] (-1787.079) (-1784.700) -- 0:03:48
504000 -- (-1793.091) (-1787.710) [-1794.667] (-1809.090) * (-1799.881) [-1785.952] (-1789.091) (-1793.444) -- 0:03:48
504500 -- (-1785.352) [-1787.493] (-1785.102) (-1807.534) * (-1796.942) [-1784.553] (-1783.760) (-1787.767) -- 0:03:47
505000 -- [-1788.516] (-1786.419) (-1793.137) (-1796.149) * (-1793.489) (-1794.056) [-1785.400] (-1795.709) -- 0:03:47
Average standard deviation of split frequencies: 0.003494
505500 -- (-1793.817) (-1791.763) (-1791.881) [-1788.035] * (-1788.163) (-1801.116) (-1791.497) [-1791.246] -- 0:03:47
506000 -- (-1794.475) [-1790.428] (-1785.706) (-1791.795) * (-1787.428) [-1787.814] (-1792.093) (-1799.557) -- 0:03:47
506500 -- (-1796.377) (-1795.400) (-1788.026) [-1791.326] * [-1796.338] (-1789.088) (-1805.878) (-1783.859) -- 0:03:47
507000 -- (-1790.842) (-1795.455) (-1787.716) [-1791.062] * (-1790.252) (-1791.534) (-1797.152) [-1794.688] -- 0:03:46
507500 -- [-1791.919] (-1804.382) (-1786.705) (-1808.021) * (-1794.033) [-1797.709] (-1807.001) (-1796.123) -- 0:03:47
508000 -- (-1788.121) (-1794.320) (-1790.953) [-1794.057] * [-1788.182] (-1799.349) (-1795.731) (-1796.728) -- 0:03:46
508500 -- (-1793.737) (-1800.769) (-1787.779) [-1792.915] * (-1787.668) (-1803.526) [-1784.142] (-1802.746) -- 0:03:46
509000 -- [-1796.801] (-1797.429) (-1788.249) (-1796.179) * (-1790.023) [-1788.515] (-1794.593) (-1800.602) -- 0:03:45
509500 -- [-1798.600] (-1794.317) (-1799.665) (-1795.223) * (-1796.945) [-1793.009] (-1800.919) (-1796.421) -- 0:03:46
510000 -- (-1797.060) (-1792.067) [-1782.659] (-1792.943) * [-1788.088] (-1796.554) (-1805.516) (-1793.220) -- 0:03:45
Average standard deviation of split frequencies: 0.003769
510500 -- (-1797.463) (-1798.358) [-1792.131] (-1802.205) * [-1786.366] (-1799.104) (-1790.854) (-1795.661) -- 0:03:45
511000 -- (-1790.614) (-1794.962) (-1788.534) [-1787.863] * (-1784.523) (-1788.111) [-1794.471] (-1794.993) -- 0:03:44
511500 -- (-1795.411) (-1788.033) [-1798.933] (-1796.677) * [-1790.939] (-1792.520) (-1793.694) (-1792.913) -- 0:03:44
512000 -- (-1795.319) (-1794.307) (-1798.043) [-1787.652] * [-1783.538] (-1789.221) (-1802.673) (-1796.607) -- 0:03:44
512500 -- (-1792.452) (-1798.679) (-1794.312) [-1791.098] * [-1795.535] (-1790.880) (-1790.844) (-1798.599) -- 0:03:44
513000 -- (-1797.095) [-1787.087] (-1791.107) (-1802.280) * (-1801.686) (-1793.428) (-1790.553) [-1796.963] -- 0:03:44
513500 -- [-1797.824] (-1783.469) (-1797.951) (-1792.679) * (-1793.545) (-1798.342) [-1787.616] (-1794.310) -- 0:03:43
514000 -- [-1784.445] (-1795.801) (-1790.072) (-1787.787) * (-1788.274) [-1797.318] (-1791.489) (-1786.741) -- 0:03:44
514500 -- (-1797.832) (-1792.024) (-1798.153) [-1788.247] * (-1807.859) [-1789.663] (-1804.108) (-1799.337) -- 0:03:43
515000 -- (-1798.271) (-1789.914) [-1790.946] (-1796.141) * (-1807.317) (-1800.539) [-1791.689] (-1792.438) -- 0:03:43
Average standard deviation of split frequencies: 0.004416
515500 -- (-1796.383) (-1811.288) (-1793.225) [-1788.945] * (-1800.040) (-1789.594) [-1790.335] (-1796.474) -- 0:03:42
516000 -- (-1791.365) [-1795.888] (-1788.421) (-1791.403) * (-1797.449) [-1787.171] (-1795.089) (-1799.442) -- 0:03:43
516500 -- (-1798.553) (-1803.940) [-1793.279] (-1782.999) * [-1789.596] (-1796.277) (-1805.119) (-1799.047) -- 0:03:42
517000 -- (-1799.116) [-1795.328] (-1790.826) (-1796.464) * (-1791.981) (-1793.579) (-1800.082) [-1791.601] -- 0:03:42
517500 -- (-1798.414) (-1796.456) [-1789.321] (-1794.958) * [-1788.199] (-1794.135) (-1796.403) (-1795.478) -- 0:03:41
518000 -- (-1792.659) [-1792.436] (-1790.248) (-1793.385) * (-1798.422) [-1799.769] (-1793.419) (-1795.940) -- 0:03:41
518500 -- (-1793.915) (-1790.106) (-1789.172) [-1795.758] * [-1790.119] (-1793.394) (-1790.274) (-1790.703) -- 0:03:41
519000 -- (-1788.350) [-1790.594] (-1790.515) (-1795.410) * (-1790.537) (-1798.077) [-1786.286] (-1793.521) -- 0:03:41
519500 -- [-1787.641] (-1798.213) (-1795.437) (-1788.703) * [-1784.663] (-1789.335) (-1790.458) (-1798.324) -- 0:03:41
520000 -- (-1792.674) [-1790.973] (-1804.321) (-1798.481) * (-1793.555) [-1789.748] (-1795.431) (-1794.230) -- 0:03:40
Average standard deviation of split frequencies: 0.004602
520500 -- (-1788.529) [-1794.877] (-1787.535) (-1812.987) * [-1790.906] (-1799.862) (-1794.945) (-1797.130) -- 0:03:41
521000 -- [-1790.435] (-1795.272) (-1794.494) (-1797.056) * (-1804.229) (-1790.720) (-1791.816) [-1791.348] -- 0:03:40
521500 -- [-1792.066] (-1798.039) (-1788.025) (-1799.393) * (-1803.223) (-1790.281) (-1794.621) [-1796.503] -- 0:03:40
522000 -- (-1792.705) (-1790.275) (-1789.384) [-1787.581] * [-1795.830] (-1792.912) (-1790.775) (-1795.878) -- 0:03:39
522500 -- [-1799.033] (-1793.285) (-1789.248) (-1784.308) * (-1791.178) [-1787.120] (-1795.138) (-1793.813) -- 0:03:40
523000 -- [-1795.143] (-1795.924) (-1799.360) (-1791.534) * (-1788.346) (-1791.080) [-1790.133] (-1794.078) -- 0:03:39
523500 -- (-1793.600) (-1797.313) [-1790.330] (-1794.050) * (-1788.069) (-1788.013) [-1783.113] (-1796.673) -- 0:03:39
524000 -- [-1791.679] (-1799.205) (-1791.682) (-1788.313) * (-1794.740) (-1792.959) (-1793.428) [-1787.813] -- 0:03:38
524500 -- (-1796.059) (-1795.811) [-1791.256] (-1793.673) * [-1786.544] (-1791.696) (-1804.435) (-1788.058) -- 0:03:38
525000 -- [-1783.840] (-1802.088) (-1788.664) (-1790.605) * (-1800.584) (-1792.483) (-1791.903) [-1791.262] -- 0:03:38
Average standard deviation of split frequencies: 0.004780
525500 -- [-1785.491] (-1803.002) (-1792.857) (-1798.779) * (-1802.126) (-1796.674) [-1785.490] (-1791.896) -- 0:03:38
526000 -- (-1790.068) (-1796.986) [-1795.010] (-1802.194) * (-1795.939) [-1785.878] (-1792.403) (-1793.211) -- 0:03:38
526500 -- [-1788.861] (-1809.009) (-1788.150) (-1790.849) * (-1796.523) (-1788.358) (-1794.315) [-1789.073] -- 0:03:37
527000 -- (-1795.442) (-1799.972) [-1787.830] (-1792.677) * (-1802.007) (-1789.369) (-1785.193) [-1787.757] -- 0:03:38
527500 -- (-1797.147) (-1796.763) [-1793.738] (-1788.333) * (-1798.699) (-1806.418) [-1785.570] (-1789.823) -- 0:03:37
528000 -- (-1792.559) [-1789.044] (-1798.586) (-1797.873) * (-1791.131) (-1796.836) [-1788.315] (-1792.311) -- 0:03:37
528500 -- (-1790.485) (-1787.398) (-1798.995) [-1787.661] * (-1798.409) (-1796.099) (-1789.564) [-1801.648] -- 0:03:36
529000 -- (-1792.821) (-1788.037) [-1785.279] (-1792.201) * (-1793.623) (-1801.611) [-1787.112] (-1801.763) -- 0:03:37
529500 -- (-1812.836) [-1793.924] (-1792.604) (-1794.179) * (-1788.634) (-1804.172) (-1790.079) [-1788.375] -- 0:03:36
530000 -- (-1798.811) (-1790.686) (-1792.431) [-1791.067] * [-1792.929] (-1794.907) (-1789.534) (-1793.649) -- 0:03:36
Average standard deviation of split frequencies: 0.005182
530500 -- (-1793.876) [-1788.631] (-1795.807) (-1788.384) * [-1785.715] (-1792.185) (-1790.668) (-1795.651) -- 0:03:35
531000 -- (-1792.413) (-1793.972) [-1789.463] (-1796.866) * (-1791.142) (-1816.063) (-1788.511) [-1795.986] -- 0:03:35
531500 -- (-1794.520) [-1789.184] (-1793.764) (-1792.446) * (-1789.946) (-1793.815) (-1787.707) [-1789.860] -- 0:03:35
532000 -- (-1790.528) (-1794.640) [-1787.273] (-1790.793) * (-1796.640) [-1791.431] (-1794.099) (-1792.079) -- 0:03:35
532500 -- (-1791.139) [-1786.036] (-1792.197) (-1793.276) * (-1801.702) [-1793.261] (-1793.100) (-1811.508) -- 0:03:35
533000 -- [-1791.029] (-1793.961) (-1791.091) (-1797.878) * (-1797.502) (-1803.634) [-1790.631] (-1787.871) -- 0:03:34
533500 -- (-1789.590) [-1787.086] (-1799.522) (-1794.172) * (-1793.988) [-1800.251] (-1794.494) (-1796.383) -- 0:03:35
534000 -- (-1788.733) [-1785.765] (-1788.740) (-1803.015) * (-1789.192) [-1797.445] (-1795.199) (-1789.992) -- 0:03:34
534500 -- [-1795.497] (-1790.791) (-1790.201) (-1795.380) * [-1788.625] (-1793.951) (-1795.079) (-1788.265) -- 0:03:34
535000 -- (-1801.317) (-1791.693) [-1789.587] (-1804.057) * (-1793.843) (-1795.860) (-1801.346) [-1795.297] -- 0:03:33
Average standard deviation of split frequencies: 0.004544
535500 -- (-1792.336) (-1792.672) (-1790.160) [-1786.515] * (-1796.968) [-1789.071] (-1797.579) (-1796.849) -- 0:03:34
536000 -- (-1787.783) (-1789.088) (-1789.993) [-1791.916] * (-1794.958) (-1793.544) [-1792.041] (-1796.041) -- 0:03:33
536500 -- [-1794.642] (-1785.519) (-1790.808) (-1800.709) * [-1793.120] (-1792.972) (-1790.771) (-1791.104) -- 0:03:33
537000 -- (-1794.214) (-1795.175) [-1793.488] (-1801.728) * [-1789.070] (-1790.332) (-1790.577) (-1799.970) -- 0:03:32
537500 -- (-1794.245) [-1788.483] (-1796.107) (-1783.849) * (-1793.955) [-1792.358] (-1800.545) (-1795.595) -- 0:03:32
538000 -- [-1782.210] (-1795.133) (-1791.768) (-1792.852) * (-1797.330) [-1787.620] (-1788.121) (-1797.216) -- 0:03:32
538500 -- (-1803.740) (-1792.390) (-1784.995) [-1787.026] * [-1781.719] (-1792.468) (-1789.548) (-1788.337) -- 0:03:32
539000 -- (-1802.528) [-1788.188] (-1785.669) (-1786.829) * (-1798.362) (-1795.861) (-1785.914) [-1786.744] -- 0:03:32
539500 -- (-1799.910) (-1799.683) [-1798.332] (-1790.656) * (-1792.109) (-1795.004) (-1784.337) [-1794.605] -- 0:03:31
540000 -- (-1789.730) (-1793.031) [-1795.002] (-1788.412) * (-1798.412) [-1790.495] (-1786.781) (-1783.979) -- 0:03:32
Average standard deviation of split frequencies: 0.003996
540500 -- [-1790.924] (-1790.728) (-1800.894) (-1791.577) * (-1797.858) (-1792.692) [-1787.474] (-1797.396) -- 0:03:31
541000 -- (-1801.801) [-1794.342] (-1793.940) (-1801.310) * [-1787.722] (-1799.900) (-1801.511) (-1791.790) -- 0:03:31
541500 -- (-1792.103) (-1789.987) (-1798.625) [-1800.695] * (-1791.765) [-1786.000] (-1798.500) (-1790.750) -- 0:03:30
542000 -- [-1784.844] (-1785.929) (-1796.798) (-1787.837) * (-1794.868) (-1786.448) (-1793.579) [-1793.248] -- 0:03:31
542500 -- [-1804.367] (-1793.283) (-1801.592) (-1791.465) * (-1791.724) [-1791.979] (-1790.775) (-1805.705) -- 0:03:30
543000 -- (-1791.926) (-1788.334) (-1798.390) [-1790.654] * [-1786.076] (-1797.376) (-1797.536) (-1784.798) -- 0:03:30
543500 -- [-1788.743] (-1790.944) (-1786.813) (-1812.750) * (-1790.268) [-1790.417] (-1799.512) (-1793.229) -- 0:03:29
544000 -- (-1797.566) (-1793.324) (-1784.931) [-1789.070] * (-1787.350) (-1791.927) (-1794.900) [-1786.984] -- 0:03:29
544500 -- (-1797.744) (-1788.496) (-1789.239) [-1802.341] * (-1794.505) [-1786.428] (-1798.316) (-1793.887) -- 0:03:29
545000 -- (-1793.074) [-1787.149] (-1788.233) (-1797.472) * (-1789.762) (-1806.489) (-1789.422) [-1792.824] -- 0:03:29
Average standard deviation of split frequencies: 0.004029
545500 -- (-1791.847) [-1788.869] (-1793.510) (-1792.715) * [-1784.821] (-1796.954) (-1798.444) (-1785.879) -- 0:03:29
546000 -- [-1785.284] (-1791.354) (-1789.608) (-1787.544) * (-1784.277) (-1793.865) [-1792.250] (-1804.233) -- 0:03:28
546500 -- (-1788.855) (-1794.385) (-1785.734) [-1784.220] * (-1789.945) (-1796.089) [-1790.757] (-1792.006) -- 0:03:29
547000 -- (-1791.458) (-1799.147) [-1792.402] (-1792.345) * [-1791.819] (-1800.032) (-1791.406) (-1806.098) -- 0:03:28
547500 -- (-1788.712) [-1787.855] (-1801.424) (-1790.809) * (-1790.380) (-1791.654) (-1791.004) [-1790.471] -- 0:03:28
548000 -- (-1799.127) (-1787.429) [-1785.944] (-1795.635) * [-1801.641] (-1792.971) (-1792.336) (-1796.853) -- 0:03:27
548500 -- (-1792.090) (-1789.764) (-1795.986) [-1794.638] * (-1808.613) (-1797.772) (-1789.781) [-1797.620] -- 0:03:28
549000 -- [-1794.725] (-1793.134) (-1790.294) (-1782.691) * (-1792.881) (-1793.068) [-1786.083] (-1790.289) -- 0:03:27
549500 -- [-1786.340] (-1797.341) (-1789.456) (-1791.285) * [-1787.780] (-1788.996) (-1789.162) (-1800.679) -- 0:03:27
550000 -- (-1788.422) (-1787.187) [-1791.473] (-1800.548) * [-1789.132] (-1802.090) (-1786.567) (-1792.458) -- 0:03:27
Average standard deviation of split frequencies: 0.004280
550500 -- (-1790.373) [-1793.910] (-1797.419) (-1793.986) * [-1788.746] (-1791.309) (-1805.071) (-1795.911) -- 0:03:27
551000 -- (-1792.758) (-1790.615) (-1800.888) [-1797.728] * (-1796.199) (-1786.255) [-1782.435] (-1799.842) -- 0:03:26
551500 -- (-1788.085) (-1795.893) (-1802.611) [-1792.451] * [-1791.023] (-1787.052) (-1789.404) (-1819.036) -- 0:03:26
552000 -- (-1797.091) [-1787.442] (-1803.407) (-1789.858) * [-1788.175] (-1795.875) (-1801.150) (-1799.074) -- 0:03:26
552500 -- [-1792.465] (-1788.479) (-1792.442) (-1787.600) * (-1788.502) (-1797.078) [-1792.374] (-1799.397) -- 0:03:25
553000 -- (-1780.881) [-1800.024] (-1793.762) (-1791.137) * (-1799.238) [-1790.521] (-1789.717) (-1787.496) -- 0:03:26
553500 -- (-1783.491) (-1803.009) [-1790.220] (-1790.882) * (-1793.484) [-1790.495] (-1800.079) (-1799.891) -- 0:03:25
554000 -- [-1795.682] (-1801.527) (-1784.908) (-1798.751) * (-1787.024) (-1798.325) (-1792.258) [-1791.809] -- 0:03:25
554500 -- (-1800.626) (-1805.037) [-1794.522] (-1797.868) * [-1784.777] (-1794.515) (-1793.466) (-1790.633) -- 0:03:24
555000 -- [-1795.510] (-1797.777) (-1801.894) (-1790.652) * (-1799.115) (-1799.894) (-1790.650) [-1783.527] -- 0:03:25
Average standard deviation of split frequencies: 0.003603
555500 -- [-1790.319] (-1792.735) (-1792.165) (-1796.100) * [-1785.982] (-1796.536) (-1794.886) (-1792.587) -- 0:03:24
556000 -- (-1809.555) (-1796.611) [-1789.119] (-1800.624) * (-1790.897) (-1791.315) (-1794.098) [-1798.292] -- 0:03:24
556500 -- [-1794.192] (-1796.023) (-1793.575) (-1793.259) * (-1793.848) [-1791.978] (-1801.194) (-1789.556) -- 0:03:24
557000 -- (-1793.816) [-1791.562] (-1796.105) (-1790.330) * [-1794.217] (-1790.066) (-1788.880) (-1797.138) -- 0:03:24
557500 -- (-1793.318) (-1790.772) [-1796.163] (-1790.043) * (-1795.804) (-1791.502) [-1790.197] (-1795.355) -- 0:03:23
558000 -- (-1795.109) (-1788.241) [-1789.540] (-1788.933) * (-1795.533) (-1794.228) [-1789.233] (-1795.501) -- 0:03:23
558500 -- (-1792.699) [-1790.952] (-1792.540) (-1789.027) * (-1790.533) (-1789.076) [-1793.734] (-1795.352) -- 0:03:23
559000 -- (-1785.496) (-1789.298) [-1784.644] (-1788.864) * [-1787.579] (-1797.685) (-1791.318) (-1798.281) -- 0:03:22
559500 -- (-1795.908) (-1792.571) [-1791.802] (-1791.737) * (-1789.194) (-1792.408) [-1785.644] (-1793.373) -- 0:03:23
560000 -- (-1797.962) (-1790.657) [-1781.600] (-1797.185) * [-1787.751] (-1798.224) (-1798.167) (-1792.626) -- 0:03:22
Average standard deviation of split frequencies: 0.003573
560500 -- (-1789.552) [-1795.174] (-1791.082) (-1798.928) * [-1788.097] (-1796.492) (-1789.244) (-1790.084) -- 0:03:22
561000 -- [-1795.187] (-1803.533) (-1798.450) (-1794.580) * (-1786.308) (-1788.119) [-1787.420] (-1788.730) -- 0:03:21
561500 -- (-1796.001) [-1790.863] (-1795.447) (-1793.014) * (-1788.487) [-1787.635] (-1790.332) (-1786.630) -- 0:03:22
562000 -- (-1802.090) (-1795.080) [-1791.838] (-1792.477) * (-1787.039) (-1792.207) [-1801.950] (-1791.895) -- 0:03:21
562500 -- (-1790.966) [-1786.227] (-1792.631) (-1796.237) * (-1793.917) (-1793.533) [-1785.553] (-1797.210) -- 0:03:21
563000 -- (-1789.341) [-1790.074] (-1789.015) (-1798.824) * (-1788.861) (-1789.935) [-1789.972] (-1796.359) -- 0:03:21
563500 -- [-1789.568] (-1800.875) (-1788.246) (-1792.117) * (-1804.394) (-1790.436) [-1795.057] (-1793.475) -- 0:03:21
564000 -- (-1792.418) [-1794.225] (-1797.935) (-1793.657) * (-1796.088) [-1792.442] (-1793.241) (-1792.564) -- 0:03:20
564500 -- (-1797.672) [-1794.077] (-1793.186) (-1796.025) * (-1795.977) (-1787.971) (-1801.044) [-1793.042] -- 0:03:20
565000 -- (-1790.164) (-1795.942) (-1788.895) [-1791.606] * (-1795.983) [-1795.341] (-1791.141) (-1797.893) -- 0:03:20
Average standard deviation of split frequencies: 0.003748
565500 -- (-1797.742) (-1789.593) (-1794.434) [-1787.550] * (-1791.719) (-1799.303) [-1789.235] (-1788.258) -- 0:03:19
566000 -- (-1794.488) (-1793.337) [-1791.852] (-1793.039) * (-1796.322) (-1786.079) (-1801.980) [-1787.202] -- 0:03:20
566500 -- [-1787.892] (-1790.952) (-1799.597) (-1794.417) * [-1793.925] (-1791.440) (-1797.074) (-1783.868) -- 0:03:19
567000 -- (-1795.671) (-1802.806) [-1788.335] (-1794.333) * (-1791.174) (-1788.271) (-1797.466) [-1786.548] -- 0:03:19
567500 -- (-1798.855) (-1797.577) [-1789.035] (-1787.652) * (-1795.299) [-1795.273] (-1796.880) (-1792.400) -- 0:03:18
568000 -- (-1790.639) (-1791.153) [-1794.844] (-1791.345) * (-1799.112) [-1784.333] (-1797.626) (-1789.245) -- 0:03:19
568500 -- (-1790.538) (-1786.026) [-1793.727] (-1792.933) * (-1792.887) [-1789.230] (-1794.253) (-1790.533) -- 0:03:18
569000 -- [-1789.138] (-1802.107) (-1788.962) (-1797.185) * (-1789.314) [-1788.351] (-1793.967) (-1785.145) -- 0:03:18
569500 -- [-1790.564] (-1807.091) (-1805.614) (-1798.679) * (-1795.848) (-1798.946) (-1795.139) [-1789.268] -- 0:03:18
570000 -- (-1789.899) (-1794.294) [-1792.162] (-1798.265) * (-1795.423) (-1799.382) (-1791.127) [-1790.022] -- 0:03:18
Average standard deviation of split frequencies: 0.003924
570500 -- [-1794.557] (-1787.275) (-1806.584) (-1803.328) * (-1792.291) (-1795.765) (-1792.100) [-1788.574] -- 0:03:17
571000 -- (-1789.657) [-1785.239] (-1800.216) (-1795.828) * (-1797.774) (-1793.842) (-1792.156) [-1793.710] -- 0:03:17
571500 -- [-1799.425] (-1791.853) (-1797.710) (-1806.716) * [-1792.195] (-1793.166) (-1795.064) (-1789.743) -- 0:03:17
572000 -- (-1799.125) [-1786.999] (-1800.396) (-1801.256) * (-1794.186) (-1795.634) [-1791.620] (-1787.737) -- 0:03:16
572500 -- [-1790.552] (-1789.080) (-1795.536) (-1790.933) * (-1799.447) [-1783.385] (-1790.782) (-1790.282) -- 0:03:17
573000 -- [-1787.990] (-1790.947) (-1797.430) (-1790.906) * [-1798.103] (-1793.994) (-1791.576) (-1786.082) -- 0:03:16
573500 -- (-1787.337) [-1792.741] (-1791.745) (-1794.818) * (-1790.810) (-1792.797) [-1789.881] (-1785.882) -- 0:03:16
574000 -- (-1793.987) (-1788.644) (-1794.817) [-1792.109] * (-1797.795) (-1797.848) (-1791.981) [-1788.545] -- 0:03:15
574500 -- [-1785.007] (-1792.579) (-1794.113) (-1790.935) * (-1793.966) [-1791.466] (-1788.498) (-1793.083) -- 0:03:16
575000 -- (-1796.073) [-1787.256] (-1787.258) (-1790.313) * (-1785.017) (-1793.098) [-1791.888] (-1788.764) -- 0:03:15
Average standard deviation of split frequencies: 0.002933
575500 -- (-1794.432) [-1788.859] (-1797.763) (-1789.073) * (-1797.152) (-1799.678) [-1789.866] (-1792.969) -- 0:03:15
576000 -- (-1788.557) (-1793.761) (-1803.662) [-1789.210] * (-1793.783) (-1797.410) [-1784.101] (-1788.138) -- 0:03:15
576500 -- (-1784.943) (-1794.579) [-1793.382] (-1810.462) * (-1797.646) (-1796.768) [-1785.545] (-1799.906) -- 0:03:15
577000 -- (-1794.610) (-1791.058) (-1795.465) [-1796.377] * (-1796.459) [-1787.940] (-1798.260) (-1795.128) -- 0:03:15
577500 -- (-1796.286) (-1783.655) [-1787.443] (-1789.951) * [-1799.615] (-1786.368) (-1785.915) (-1795.285) -- 0:03:14
578000 -- [-1794.990] (-1786.150) (-1795.401) (-1792.422) * (-1801.154) (-1796.828) [-1793.146] (-1787.003) -- 0:03:14
578500 -- (-1791.070) (-1786.764) (-1790.163) [-1790.074] * (-1803.543) [-1787.444] (-1790.330) (-1791.347) -- 0:03:13
579000 -- (-1792.014) (-1803.503) [-1786.865] (-1796.895) * (-1796.098) (-1791.151) [-1792.524] (-1791.796) -- 0:03:14
579500 -- (-1793.051) (-1791.930) (-1794.284) [-1794.709] * (-1794.830) (-1801.241) [-1789.581] (-1795.008) -- 0:03:13
580000 -- [-1787.420] (-1803.890) (-1800.453) (-1798.853) * (-1792.355) [-1792.833] (-1786.968) (-1799.955) -- 0:03:13
Average standard deviation of split frequencies: 0.002435
580500 -- (-1783.917) (-1801.461) (-1804.908) [-1788.159] * (-1792.196) (-1788.930) [-1785.515] (-1793.449) -- 0:03:12
581000 -- [-1790.024] (-1799.254) (-1788.623) (-1802.356) * (-1788.687) (-1796.370) (-1793.104) [-1792.133] -- 0:03:13
581500 -- [-1784.537] (-1798.300) (-1792.203) (-1795.618) * [-1790.328] (-1791.913) (-1789.836) (-1794.206) -- 0:03:12
582000 -- [-1783.923] (-1796.953) (-1795.179) (-1800.544) * (-1792.438) (-1801.204) (-1788.127) [-1786.672] -- 0:03:12
582500 -- (-1791.248) (-1803.842) [-1786.766] (-1791.316) * (-1800.409) (-1789.673) [-1792.750] (-1789.495) -- 0:03:12
583000 -- [-1792.559] (-1795.582) (-1796.371) (-1798.136) * [-1787.875] (-1805.080) (-1797.514) (-1791.759) -- 0:03:12
583500 -- [-1790.155] (-1788.315) (-1795.514) (-1791.300) * (-1789.357) [-1785.972] (-1791.271) (-1790.271) -- 0:03:12
584000 -- [-1783.029] (-1796.833) (-1797.612) (-1785.334) * [-1787.087] (-1795.912) (-1790.932) (-1784.328) -- 0:03:11
584500 -- (-1804.143) (-1791.374) [-1794.906] (-1793.208) * (-1784.318) (-1794.924) (-1795.230) [-1791.435] -- 0:03:11
585000 -- [-1785.504] (-1789.869) (-1792.297) (-1789.379) * (-1791.105) (-1798.240) [-1788.311] (-1794.582) -- 0:03:10
Average standard deviation of split frequencies: 0.002950
585500 -- (-1802.123) (-1789.644) [-1793.726] (-1794.258) * (-1791.546) (-1787.746) (-1792.050) [-1791.143] -- 0:03:11
586000 -- (-1796.685) (-1792.022) (-1798.735) [-1787.680] * [-1799.542] (-1804.633) (-1791.900) (-1793.635) -- 0:03:10
586500 -- (-1794.478) [-1790.919] (-1799.818) (-1794.000) * (-1791.055) (-1801.932) (-1796.067) [-1793.491] -- 0:03:10
587000 -- (-1790.077) [-1791.816] (-1795.122) (-1789.981) * [-1792.908] (-1796.053) (-1793.922) (-1796.221) -- 0:03:09
587500 -- (-1794.808) [-1785.515] (-1790.047) (-1788.954) * [-1792.929] (-1789.521) (-1796.715) (-1795.320) -- 0:03:10
588000 -- [-1796.894] (-1798.672) (-1785.526) (-1795.800) * (-1788.922) [-1793.296] (-1789.496) (-1792.198) -- 0:03:09
588500 -- (-1794.053) (-1794.771) [-1789.346] (-1805.317) * (-1790.720) [-1789.985] (-1792.915) (-1789.818) -- 0:03:09
589000 -- (-1798.327) (-1795.570) (-1791.002) [-1789.298] * [-1791.882] (-1798.248) (-1793.074) (-1784.952) -- 0:03:09
589500 -- [-1788.976] (-1787.729) (-1793.316) (-1792.980) * [-1797.412] (-1796.523) (-1796.326) (-1794.310) -- 0:03:08
590000 -- (-1798.405) [-1798.654] (-1795.452) (-1790.851) * [-1793.474] (-1798.596) (-1794.884) (-1793.075) -- 0:03:09
Average standard deviation of split frequencies: 0.002993
590500 -- [-1788.814] (-1795.486) (-1801.360) (-1791.984) * (-1792.846) (-1795.276) [-1793.189] (-1796.734) -- 0:03:08
591000 -- (-1796.090) [-1789.417] (-1800.112) (-1789.503) * (-1798.826) (-1793.775) [-1790.821] (-1792.720) -- 0:03:08
591500 -- [-1789.498] (-1784.463) (-1796.216) (-1792.085) * [-1797.305] (-1796.387) (-1791.124) (-1793.399) -- 0:03:07
592000 -- (-1800.486) (-1791.385) [-1797.462] (-1792.739) * [-1788.236] (-1791.245) (-1787.778) (-1785.572) -- 0:03:08
592500 -- [-1793.275] (-1794.298) (-1787.851) (-1792.186) * (-1789.400) (-1787.617) (-1788.665) [-1788.395] -- 0:03:07
593000 -- (-1801.072) (-1784.826) [-1792.122] (-1792.853) * (-1787.048) [-1790.427] (-1794.038) (-1798.646) -- 0:03:07
593500 -- (-1797.006) [-1787.243] (-1794.414) (-1794.154) * [-1792.151] (-1791.026) (-1787.424) (-1784.796) -- 0:03:06
594000 -- (-1794.156) (-1794.422) [-1786.712] (-1790.714) * (-1792.597) (-1794.972) [-1789.473] (-1793.829) -- 0:03:07
594500 -- (-1799.820) (-1786.306) (-1785.005) [-1789.283] * (-1795.896) (-1797.836) [-1786.501] (-1799.084) -- 0:03:06
595000 -- (-1792.669) [-1790.637] (-1795.506) (-1791.254) * (-1791.639) (-1788.725) (-1808.045) [-1784.111] -- 0:03:06
Average standard deviation of split frequencies: 0.003098
595500 -- (-1787.148) (-1800.042) (-1796.366) [-1788.550] * (-1790.136) [-1786.216] (-1789.973) (-1792.373) -- 0:03:06
596000 -- (-1797.932) (-1801.847) (-1795.425) [-1794.851] * (-1783.548) (-1793.529) [-1795.792] (-1791.170) -- 0:03:05
596500 -- (-1788.173) [-1787.006] (-1788.060) (-1799.968) * (-1793.343) (-1800.630) [-1788.281] (-1791.012) -- 0:03:06
597000 -- [-1790.874] (-1802.300) (-1790.995) (-1793.358) * (-1794.340) (-1792.221) (-1791.026) [-1789.125] -- 0:03:05
597500 -- [-1795.744] (-1786.330) (-1785.823) (-1791.539) * [-1794.783] (-1792.721) (-1796.335) (-1792.322) -- 0:03:05
598000 -- (-1795.156) (-1789.189) [-1787.467] (-1784.561) * [-1790.394] (-1798.212) (-1789.329) (-1789.593) -- 0:03:04
598500 -- (-1786.495) [-1786.891] (-1796.324) (-1789.791) * (-1803.574) (-1799.772) (-1789.501) [-1789.684] -- 0:03:05
599000 -- [-1785.738] (-1786.564) (-1794.744) (-1813.529) * (-1798.444) (-1795.106) [-1782.949] (-1790.551) -- 0:03:04
599500 -- (-1798.098) (-1790.831) [-1791.995] (-1795.785) * (-1791.235) (-1786.077) (-1787.770) [-1794.818] -- 0:03:04
600000 -- (-1800.970) (-1792.030) (-1797.518) [-1793.021] * [-1786.366] (-1806.072) (-1791.833) (-1791.561) -- 0:03:04
Average standard deviation of split frequencies: 0.002681
600500 -- (-1792.144) (-1786.474) (-1790.622) [-1789.516] * [-1784.837] (-1789.596) (-1788.340) (-1785.401) -- 0:03:04
601000 -- (-1796.936) [-1788.476] (-1792.577) (-1801.469) * (-1796.804) (-1793.123) [-1793.595] (-1791.034) -- 0:03:03
601500 -- (-1796.307) (-1798.790) (-1792.749) [-1793.646] * [-1792.445] (-1795.339) (-1795.158) (-1801.331) -- 0:03:03
602000 -- (-1789.802) (-1795.972) [-1786.945] (-1792.984) * [-1788.974] (-1785.601) (-1799.764) (-1797.418) -- 0:03:03
602500 -- [-1791.759] (-1796.333) (-1799.385) (-1792.493) * [-1793.349] (-1794.951) (-1788.836) (-1798.027) -- 0:03:02
603000 -- [-1792.274] (-1792.876) (-1790.778) (-1793.916) * (-1794.619) (-1783.018) (-1791.393) [-1786.420] -- 0:03:03
603500 -- (-1795.841) (-1786.213) (-1792.691) [-1793.875] * (-1787.214) [-1792.568] (-1794.332) (-1802.163) -- 0:03:02
604000 -- (-1800.197) [-1793.246] (-1794.057) (-1788.049) * (-1796.074) (-1790.547) [-1783.319] (-1797.569) -- 0:03:02
604500 -- [-1787.027] (-1788.213) (-1791.895) (-1791.186) * (-1794.554) [-1795.827] (-1791.731) (-1798.609) -- 0:03:01
605000 -- [-1785.267] (-1789.450) (-1797.784) (-1790.723) * (-1789.807) (-1790.756) (-1789.157) [-1804.881] -- 0:03:02
Average standard deviation of split frequencies: 0.003760
605500 -- (-1794.957) [-1790.096] (-1794.038) (-1791.137) * (-1793.225) [-1794.586] (-1784.743) (-1797.055) -- 0:03:01
606000 -- (-1789.670) (-1791.356) [-1793.987] (-1796.434) * (-1787.480) (-1802.100) [-1792.739] (-1795.739) -- 0:03:01
606500 -- [-1789.891] (-1796.883) (-1796.849) (-1797.666) * (-1803.568) [-1787.678] (-1794.420) (-1793.998) -- 0:03:01
607000 -- [-1788.658] (-1797.593) (-1797.088) (-1796.604) * (-1793.947) (-1793.649) (-1787.598) [-1790.782] -- 0:03:01
607500 -- [-1789.443] (-1788.213) (-1792.371) (-1788.296) * (-1784.443) [-1790.177] (-1787.648) (-1795.193) -- 0:03:00
608000 -- [-1788.642] (-1787.585) (-1800.451) (-1797.116) * (-1794.846) [-1791.263] (-1794.874) (-1801.573) -- 0:03:00
608500 -- (-1793.610) [-1794.248] (-1791.559) (-1792.382) * (-1794.072) [-1794.343] (-1799.361) (-1796.089) -- 0:03:00
609000 -- (-1793.058) (-1793.163) [-1789.891] (-1792.427) * (-1796.778) (-1803.628) [-1792.435] (-1790.786) -- 0:02:59
609500 -- (-1785.182) (-1796.481) [-1792.898] (-1794.152) * (-1790.328) (-1798.512) [-1785.481] (-1784.684) -- 0:03:00
610000 -- (-1794.998) (-1796.381) (-1785.890) [-1783.843] * (-1790.943) (-1798.060) [-1785.965] (-1788.265) -- 0:02:59
Average standard deviation of split frequencies: 0.003281
610500 -- [-1783.286] (-1796.399) (-1788.621) (-1792.094) * (-1795.320) (-1790.946) [-1784.597] (-1796.402) -- 0:02:59
611000 -- (-1786.330) (-1786.637) [-1790.615] (-1793.659) * (-1798.080) (-1803.448) [-1793.103] (-1787.465) -- 0:02:58
611500 -- (-1794.676) (-1791.550) (-1788.749) [-1788.905] * [-1789.287] (-1795.206) (-1794.013) (-1797.189) -- 0:02:59
612000 -- (-1792.589) [-1787.234] (-1796.487) (-1791.346) * (-1792.040) [-1788.241] (-1788.266) (-1794.790) -- 0:02:58
612500 -- [-1792.823] (-1788.829) (-1809.859) (-1790.827) * [-1787.005] (-1788.377) (-1787.244) (-1793.647) -- 0:02:58
613000 -- (-1798.609) (-1793.697) (-1799.407) [-1787.521] * (-1792.026) [-1789.360] (-1790.468) (-1797.461) -- 0:02:58
613500 -- (-1796.284) (-1799.136) [-1786.154] (-1791.127) * (-1788.039) (-1789.592) [-1782.651] (-1798.106) -- 0:02:58
614000 -- [-1796.821] (-1785.355) (-1787.463) (-1793.722) * (-1792.160) [-1794.032] (-1790.563) (-1800.250) -- 0:02:57
614500 -- (-1786.606) (-1787.626) [-1790.141] (-1794.510) * (-1784.103) (-1793.597) [-1791.519] (-1796.675) -- 0:02:57
615000 -- [-1802.353] (-1795.684) (-1794.718) (-1792.846) * (-1788.155) (-1803.301) (-1789.254) [-1794.246] -- 0:02:57
Average standard deviation of split frequencies: 0.003380
615500 -- [-1788.617] (-1794.475) (-1786.918) (-1787.640) * [-1785.983] (-1789.133) (-1793.120) (-1789.332) -- 0:02:56
616000 -- (-1792.741) (-1796.455) (-1801.746) [-1784.863] * (-1790.199) (-1791.827) [-1791.712] (-1789.671) -- 0:02:57
616500 -- (-1785.120) (-1792.875) (-1789.984) [-1794.489] * (-1793.297) [-1791.751] (-1801.045) (-1795.376) -- 0:02:56
617000 -- (-1807.000) (-1798.719) [-1789.874] (-1795.806) * (-1802.227) [-1785.783] (-1798.583) (-1802.971) -- 0:02:56
617500 -- [-1788.804] (-1788.867) (-1801.005) (-1790.535) * [-1794.791] (-1785.712) (-1805.844) (-1803.263) -- 0:02:55
618000 -- [-1784.771] (-1788.603) (-1798.294) (-1790.243) * [-1786.554] (-1801.179) (-1797.007) (-1800.719) -- 0:02:56
618500 -- (-1796.446) [-1790.434] (-1793.546) (-1792.539) * (-1793.954) (-1802.505) [-1789.194] (-1788.782) -- 0:02:55
619000 -- [-1788.745] (-1784.788) (-1802.687) (-1787.995) * [-1787.841] (-1801.937) (-1796.845) (-1797.417) -- 0:02:55
619500 -- (-1783.775) (-1795.508) (-1788.327) [-1798.015] * (-1788.508) (-1795.819) [-1789.609] (-1793.360) -- 0:02:55
620000 -- (-1794.529) [-1792.320] (-1789.046) (-1792.435) * (-1789.485) (-1795.075) [-1794.930] (-1788.583) -- 0:02:55
Average standard deviation of split frequencies: 0.003038
620500 -- (-1787.149) (-1791.446) (-1794.291) [-1787.078] * (-1788.822) (-1789.743) (-1795.518) [-1799.560] -- 0:02:54
621000 -- [-1783.047] (-1785.469) (-1790.630) (-1790.751) * (-1797.195) [-1783.868] (-1786.578) (-1789.994) -- 0:02:54
621500 -- (-1784.163) (-1793.974) [-1789.459] (-1798.228) * (-1794.977) [-1789.471] (-1790.333) (-1787.043) -- 0:02:54
622000 -- (-1784.238) (-1799.126) (-1794.591) [-1797.392] * (-1787.829) (-1798.135) (-1791.015) [-1792.835] -- 0:02:53
622500 -- (-1791.804) [-1784.512] (-1791.108) (-1791.772) * (-1795.088) (-1794.882) (-1787.347) [-1797.561] -- 0:02:54
623000 -- (-1794.186) (-1799.651) (-1795.292) [-1793.463] * (-1791.905) (-1787.330) (-1796.292) [-1790.798] -- 0:02:53
623500 -- [-1788.982] (-1799.867) (-1787.758) (-1793.293) * [-1793.630] (-1798.402) (-1794.696) (-1788.266) -- 0:02:53
624000 -- (-1792.966) (-1808.813) [-1793.338] (-1792.065) * [-1786.754] (-1790.103) (-1794.010) (-1800.131) -- 0:02:52
624500 -- [-1798.649] (-1792.193) (-1785.918) (-1788.894) * (-1798.812) [-1793.279] (-1790.366) (-1797.593) -- 0:02:53
625000 -- (-1786.736) (-1785.029) [-1787.787] (-1796.164) * (-1794.968) (-1801.328) (-1799.753) [-1788.551] -- 0:02:52
Average standard deviation of split frequencies: 0.003640
625500 -- [-1790.045] (-1791.739) (-1789.991) (-1793.210) * (-1791.552) (-1787.647) [-1786.716] (-1792.846) -- 0:02:52
626000 -- (-1793.588) [-1788.513] (-1792.480) (-1786.406) * (-1795.266) (-1788.392) (-1802.365) [-1787.284] -- 0:02:52
626500 -- (-1782.883) (-1804.161) [-1785.844] (-1786.687) * (-1791.961) [-1797.005] (-1792.737) (-1805.898) -- 0:02:52
627000 -- (-1794.265) (-1796.988) (-1796.457) [-1782.042] * (-1789.242) (-1800.994) [-1786.981] (-1796.674) -- 0:02:51
627500 -- (-1793.273) (-1793.809) (-1793.698) [-1789.558] * (-1794.343) (-1787.107) [-1797.951] (-1787.713) -- 0:02:51
628000 -- (-1787.270) (-1784.913) [-1783.773] (-1791.020) * (-1791.856) (-1789.193) (-1792.939) [-1792.542] -- 0:02:51
628500 -- (-1788.826) (-1801.115) (-1799.439) [-1797.722] * (-1790.011) [-1787.026] (-1783.393) (-1793.313) -- 0:02:50
629000 -- [-1791.580] (-1791.587) (-1798.349) (-1789.094) * (-1804.389) (-1792.315) (-1788.917) [-1787.695] -- 0:02:51
629500 -- (-1790.099) (-1808.029) (-1794.488) [-1787.646] * [-1797.025] (-1788.193) (-1791.923) (-1789.695) -- 0:02:50
630000 -- (-1788.528) [-1788.869] (-1788.217) (-1791.122) * [-1789.692] (-1801.750) (-1787.007) (-1792.936) -- 0:02:50
Average standard deviation of split frequencies: 0.003675
630500 -- (-1794.571) [-1792.547] (-1797.391) (-1788.894) * (-1796.118) [-1791.356] (-1791.219) (-1794.083) -- 0:02:49
631000 -- (-1794.242) (-1792.451) [-1792.615] (-1801.730) * (-1806.313) (-1793.237) [-1787.295] (-1806.152) -- 0:02:50
631500 -- (-1801.663) (-1787.952) [-1794.477] (-1790.674) * (-1796.133) (-1795.598) [-1788.322] (-1794.548) -- 0:02:49
632000 -- [-1785.172] (-1792.449) (-1793.504) (-1791.553) * (-1796.342) (-1799.811) (-1789.447) [-1787.569] -- 0:02:49
632500 -- (-1795.923) (-1789.830) (-1794.630) [-1791.578] * (-1791.753) [-1792.995] (-1792.588) (-1796.808) -- 0:02:49
633000 -- (-1791.789) (-1798.956) (-1793.067) [-1787.111] * (-1784.332) (-1792.048) (-1794.873) [-1793.847] -- 0:02:49
633500 -- (-1791.773) (-1789.937) (-1787.926) [-1791.146] * (-1793.457) (-1791.957) (-1786.810) [-1790.727] -- 0:02:48
634000 -- (-1790.825) (-1791.819) (-1799.844) [-1788.423] * (-1791.826) (-1786.492) (-1788.775) [-1792.256] -- 0:02:48
634500 -- (-1791.628) (-1790.703) (-1793.297) [-1790.720] * [-1788.629] (-1792.216) (-1791.619) (-1792.000) -- 0:02:48
635000 -- [-1790.336] (-1799.392) (-1792.765) (-1797.629) * [-1799.103] (-1788.463) (-1790.211) (-1795.366) -- 0:02:47
Average standard deviation of split frequencies: 0.003212
635500 -- [-1790.492] (-1789.019) (-1789.635) (-1789.903) * (-1794.974) (-1791.766) (-1795.503) [-1794.753] -- 0:02:48
636000 -- (-1790.434) (-1792.042) (-1790.787) [-1791.451] * [-1784.118] (-1786.095) (-1799.977) (-1797.933) -- 0:02:47
636500 -- (-1787.002) (-1796.244) [-1788.918] (-1791.345) * (-1790.804) (-1784.455) (-1797.116) [-1795.576] -- 0:02:47
637000 -- (-1799.445) (-1802.791) [-1787.299] (-1794.560) * [-1787.741] (-1789.790) (-1793.098) (-1797.139) -- 0:02:46
637500 -- (-1788.373) (-1795.264) [-1785.322] (-1797.443) * (-1785.990) [-1786.007] (-1794.261) (-1794.391) -- 0:02:47
638000 -- (-1788.823) (-1797.851) [-1786.495] (-1793.114) * (-1799.042) (-1787.142) (-1794.692) [-1788.974] -- 0:02:46
638500 -- (-1790.288) (-1795.493) (-1793.487) [-1787.504] * [-1800.899] (-1807.108) (-1790.913) (-1798.456) -- 0:02:46
639000 -- [-1787.978] (-1803.303) (-1792.695) (-1798.777) * [-1800.840] (-1787.104) (-1793.881) (-1797.606) -- 0:02:46
639500 -- (-1796.566) (-1801.273) (-1792.700) [-1791.829] * [-1796.887] (-1794.282) (-1787.311) (-1791.013) -- 0:02:46
640000 -- [-1795.337] (-1793.459) (-1797.756) (-1795.885) * (-1795.009) (-1800.726) [-1787.421] (-1791.927) -- 0:02:45
Average standard deviation of split frequencies: 0.003066
640500 -- (-1796.502) (-1791.770) (-1788.054) [-1789.925] * (-1797.073) (-1795.649) [-1792.336] (-1791.157) -- 0:02:45
641000 -- [-1791.096] (-1813.892) (-1788.632) (-1791.545) * [-1792.982] (-1800.113) (-1804.576) (-1788.703) -- 0:02:45
641500 -- [-1784.341] (-1796.784) (-1794.859) (-1787.280) * (-1791.684) (-1788.336) (-1790.133) [-1789.539] -- 0:02:45
642000 -- (-1791.041) [-1786.842] (-1791.894) (-1792.428) * (-1795.332) (-1792.858) [-1786.721] (-1791.578) -- 0:02:45
642500 -- (-1787.322) (-1786.147) [-1790.645] (-1793.588) * (-1799.090) [-1790.649] (-1797.155) (-1794.235) -- 0:02:44
643000 -- [-1791.906] (-1800.903) (-1784.529) (-1793.629) * (-1791.467) (-1791.170) [-1789.884] (-1798.881) -- 0:02:44
643500 -- (-1784.200) (-1784.959) (-1792.978) [-1788.890] * (-1789.705) [-1795.797] (-1790.046) (-1796.619) -- 0:02:43
644000 -- [-1788.788] (-1796.140) (-1796.975) (-1796.360) * [-1798.711] (-1796.712) (-1784.773) (-1798.523) -- 0:02:44
644500 -- (-1791.946) [-1790.847] (-1800.290) (-1794.731) * (-1797.164) [-1790.873] (-1799.944) (-1787.374) -- 0:02:43
645000 -- (-1796.613) (-1796.928) (-1799.131) [-1783.966] * (-1790.687) (-1798.464) (-1787.108) [-1786.586] -- 0:02:43
Average standard deviation of split frequencies: 0.002858
645500 -- (-1790.468) (-1804.267) [-1789.867] (-1807.736) * (-1793.053) [-1794.669] (-1793.812) (-1800.151) -- 0:02:43
646000 -- (-1795.971) [-1791.460] (-1799.598) (-1788.303) * [-1786.711] (-1794.669) (-1799.523) (-1791.027) -- 0:02:43
646500 -- (-1788.920) (-1797.968) [-1790.283] (-1799.718) * [-1791.296] (-1798.078) (-1795.050) (-1787.195) -- 0:02:42
647000 -- [-1793.281] (-1790.436) (-1794.358) (-1793.100) * (-1796.532) (-1785.552) (-1794.546) [-1797.387] -- 0:02:42
647500 -- [-1786.077] (-1785.578) (-1796.575) (-1793.148) * (-1795.991) [-1793.095] (-1790.240) (-1793.379) -- 0:02:42
648000 -- (-1786.483) [-1788.528] (-1793.215) (-1797.651) * [-1784.826] (-1791.369) (-1796.188) (-1801.906) -- 0:02:42
648500 -- (-1790.407) (-1803.632) (-1794.224) [-1789.956] * (-1786.227) (-1794.086) [-1790.868] (-1791.929) -- 0:02:42
649000 -- (-1786.759) (-1797.616) (-1788.484) [-1792.225] * (-1792.498) [-1791.140] (-1800.127) (-1791.964) -- 0:02:41
649500 -- [-1786.857] (-1795.589) (-1795.410) (-1797.571) * (-1791.658) (-1789.817) (-1802.275) [-1789.770] -- 0:02:41
650000 -- [-1786.994] (-1798.316) (-1793.336) (-1787.433) * (-1798.458) (-1789.475) [-1796.665] (-1796.867) -- 0:02:41
Average standard deviation of split frequencies: 0.002355
650500 -- [-1787.904] (-1808.121) (-1794.224) (-1794.895) * (-1795.548) [-1787.254] (-1796.584) (-1794.269) -- 0:02:41
651000 -- [-1789.873] (-1802.270) (-1794.581) (-1794.154) * [-1794.259] (-1788.993) (-1799.072) (-1792.234) -- 0:02:40
651500 -- (-1783.480) [-1787.530] (-1794.117) (-1804.678) * (-1793.301) (-1785.817) [-1792.857] (-1792.766) -- 0:02:40
652000 -- (-1793.087) (-1802.308) [-1786.037] (-1786.673) * [-1785.723] (-1797.485) (-1787.740) (-1788.963) -- 0:02:40
652500 -- [-1790.670] (-1797.062) (-1784.761) (-1788.923) * (-1790.602) (-1793.781) (-1789.181) [-1790.088] -- 0:02:40
653000 -- (-1790.540) (-1797.836) (-1794.541) [-1789.832] * (-1793.623) (-1790.575) (-1798.808) [-1785.205] -- 0:02:39
653500 -- (-1799.422) (-1799.302) [-1781.956] (-1790.764) * (-1792.074) (-1802.754) [-1792.273] (-1789.685) -- 0:02:39
654000 -- (-1800.802) (-1798.147) (-1792.624) [-1787.509] * (-1797.855) (-1796.170) [-1791.482] (-1795.290) -- 0:02:39
654500 -- (-1795.675) [-1788.152] (-1788.577) (-1790.772) * (-1791.348) (-1792.850) [-1784.708] (-1798.964) -- 0:02:39
655000 -- (-1794.947) (-1791.704) [-1792.612] (-1788.553) * (-1793.125) (-1799.428) [-1789.381] (-1794.102) -- 0:02:39
Average standard deviation of split frequencies: 0.002335
655500 -- (-1791.034) [-1791.050] (-1792.468) (-1795.797) * [-1795.910] (-1788.010) (-1789.233) (-1793.567) -- 0:02:38
656000 -- (-1797.816) (-1799.927) (-1791.684) [-1784.196] * (-1797.433) [-1793.790] (-1791.129) (-1794.927) -- 0:02:38
656500 -- (-1796.355) [-1795.186] (-1794.407) (-1798.257) * [-1796.306] (-1803.255) (-1786.590) (-1794.492) -- 0:02:38
657000 -- (-1804.409) (-1787.939) [-1787.973] (-1789.228) * [-1791.734] (-1793.362) (-1789.189) (-1807.588) -- 0:02:38
657500 -- [-1786.913] (-1785.917) (-1790.252) (-1784.537) * (-1795.019) [-1792.003] (-1792.069) (-1791.496) -- 0:02:37
658000 -- (-1788.887) (-1794.066) (-1792.693) [-1793.182] * (-1796.150) (-1795.382) (-1801.611) [-1796.352] -- 0:02:37
658500 -- (-1792.182) [-1789.029] (-1809.141) (-1805.523) * (-1790.149) (-1792.709) [-1790.335] (-1790.888) -- 0:02:37
659000 -- (-1791.425) (-1786.652) (-1789.704) [-1790.500] * (-1790.017) (-1794.479) (-1800.852) [-1792.796] -- 0:02:37
659500 -- [-1793.696] (-1794.459) (-1794.167) (-1799.262) * (-1788.669) [-1795.555] (-1789.963) (-1792.909) -- 0:02:36
660000 -- (-1791.381) (-1806.019) [-1791.003] (-1806.440) * (-1793.124) (-1793.085) (-1793.840) [-1790.387] -- 0:02:36
Average standard deviation of split frequencies: 0.002735
660500 -- [-1785.687] (-1793.429) (-1788.798) (-1798.314) * (-1801.085) (-1792.152) [-1786.853] (-1792.266) -- 0:02:36
661000 -- (-1789.163) [-1787.437] (-1787.217) (-1796.686) * (-1808.821) (-1785.906) (-1790.485) [-1787.657] -- 0:02:36
661500 -- (-1793.459) (-1785.589) [-1793.168] (-1796.645) * [-1800.969] (-1790.070) (-1797.331) (-1795.237) -- 0:02:36
662000 -- (-1799.376) (-1794.162) [-1800.196] (-1794.399) * (-1795.082) [-1788.125] (-1791.980) (-1806.086) -- 0:02:35
662500 -- (-1804.148) (-1795.531) (-1792.043) [-1796.201] * (-1793.096) (-1788.293) [-1792.913] (-1797.844) -- 0:02:35
663000 -- [-1796.831] (-1793.569) (-1783.155) (-1795.401) * (-1784.690) [-1793.408] (-1799.789) (-1793.548) -- 0:02:35
663500 -- (-1791.071) (-1793.587) (-1788.753) [-1788.498] * (-1794.778) (-1797.092) (-1791.884) [-1792.814] -- 0:02:35
664000 -- (-1795.961) [-1787.515] (-1790.371) (-1789.032) * (-1790.729) [-1794.469] (-1791.248) (-1797.768) -- 0:02:34
664500 -- (-1788.620) (-1789.211) (-1784.982) [-1784.944] * (-1794.364) (-1799.548) (-1796.008) [-1792.302] -- 0:02:34
665000 -- (-1789.422) [-1786.083] (-1787.761) (-1795.820) * [-1784.155] (-1794.958) (-1791.113) (-1794.820) -- 0:02:34
Average standard deviation of split frequencies: 0.002241
665500 -- (-1800.471) [-1790.238] (-1790.310) (-1787.841) * (-1790.636) (-1790.852) [-1788.756] (-1791.230) -- 0:02:34
666000 -- (-1803.338) (-1785.991) [-1790.540] (-1792.497) * [-1783.863] (-1797.114) (-1794.992) (-1795.646) -- 0:02:33
666500 -- (-1792.502) (-1795.657) (-1805.068) [-1790.135] * (-1790.423) (-1794.559) [-1787.687] (-1788.405) -- 0:02:33
667000 -- [-1789.484] (-1797.116) (-1798.770) (-1797.452) * (-1796.365) (-1796.901) (-1797.428) [-1786.211] -- 0:02:33
667500 -- (-1790.159) (-1791.326) [-1786.396] (-1786.683) * (-1794.972) (-1787.941) [-1786.850] (-1788.578) -- 0:02:33
668000 -- [-1785.712] (-1792.002) (-1793.340) (-1794.261) * (-1790.182) (-1789.492) (-1793.068) [-1790.741] -- 0:02:33
668500 -- [-1791.370] (-1787.793) (-1799.816) (-1785.770) * (-1795.243) [-1797.305] (-1794.478) (-1782.539) -- 0:02:32
669000 -- [-1784.976] (-1788.308) (-1795.989) (-1789.691) * (-1794.045) (-1787.665) (-1790.088) [-1790.558] -- 0:02:32
669500 -- (-1792.718) (-1793.691) [-1794.448] (-1790.598) * (-1790.073) (-1805.099) [-1791.734] (-1796.510) -- 0:02:32
670000 -- (-1799.218) (-1796.509) (-1793.304) [-1788.968] * [-1799.585] (-1795.469) (-1787.250) (-1794.613) -- 0:02:32
Average standard deviation of split frequencies: 0.002167
670500 -- (-1808.565) (-1789.241) (-1803.375) [-1790.424] * [-1797.039] (-1798.290) (-1790.125) (-1787.870) -- 0:02:31
671000 -- (-1790.792) (-1798.151) (-1793.742) [-1783.225] * (-1800.237) (-1802.143) (-1788.438) [-1790.224] -- 0:02:31
671500 -- (-1798.515) [-1794.422] (-1786.385) (-1802.493) * (-1789.548) (-1801.441) [-1796.439] (-1787.816) -- 0:02:31
672000 -- [-1787.182] (-1793.444) (-1791.368) (-1790.106) * (-1797.402) (-1789.493) (-1787.941) [-1789.269] -- 0:02:31
672500 -- (-1793.206) (-1794.295) [-1795.102] (-1789.062) * [-1788.169] (-1797.010) (-1787.348) (-1797.486) -- 0:02:30
673000 -- [-1792.359] (-1789.643) (-1792.128) (-1789.975) * (-1791.574) [-1795.168] (-1791.174) (-1798.704) -- 0:02:30
673500 -- [-1790.852] (-1790.043) (-1792.729) (-1784.744) * [-1790.120] (-1789.770) (-1793.723) (-1786.360) -- 0:02:30
674000 -- (-1794.301) [-1785.295] (-1794.243) (-1788.054) * (-1795.649) (-1784.905) (-1793.296) [-1785.202] -- 0:02:30
674500 -- (-1793.070) (-1792.993) (-1791.643) [-1789.689] * (-1799.400) (-1791.179) [-1794.940] (-1789.833) -- 0:02:30
675000 -- [-1791.841] (-1787.070) (-1795.413) (-1804.334) * (-1800.406) (-1793.508) (-1789.588) [-1791.518] -- 0:02:29
Average standard deviation of split frequencies: 0.002441
675500 -- (-1789.354) (-1796.341) [-1793.696] (-1792.453) * (-1788.394) (-1790.208) (-1792.121) [-1791.538] -- 0:02:29
676000 -- (-1793.385) (-1787.999) [-1796.555] (-1792.483) * (-1798.657) (-1796.292) (-1788.842) [-1781.652] -- 0:02:29
676500 -- (-1795.748) (-1792.015) (-1795.705) [-1793.244] * (-1788.792) (-1797.862) (-1790.659) [-1786.435] -- 0:02:29
677000 -- (-1788.671) [-1788.814] (-1799.961) (-1792.162) * (-1792.470) (-1793.275) (-1782.469) [-1786.741] -- 0:02:28
677500 -- (-1793.696) (-1792.642) [-1794.387] (-1790.483) * (-1789.803) [-1795.173] (-1799.160) (-1789.470) -- 0:02:28
678000 -- (-1791.430) (-1791.940) (-1792.757) [-1794.478] * (-1791.705) [-1787.805] (-1793.067) (-1798.417) -- 0:02:28
678500 -- [-1787.582] (-1795.335) (-1794.507) (-1795.888) * (-1788.930) (-1784.949) (-1806.919) [-1788.811] -- 0:02:28
679000 -- (-1801.827) (-1797.317) (-1798.842) [-1789.972] * (-1791.331) (-1796.260) [-1789.751] (-1793.437) -- 0:02:27
679500 -- (-1795.643) [-1793.746] (-1786.619) (-1788.771) * (-1790.247) (-1795.329) [-1786.066] (-1798.078) -- 0:02:27
680000 -- (-1793.129) (-1794.545) (-1800.605) [-1796.884] * (-1794.926) (-1799.829) (-1796.738) [-1789.996] -- 0:02:27
Average standard deviation of split frequencies: 0.002309
680500 -- (-1788.459) (-1789.910) (-1801.271) [-1783.392] * [-1794.657] (-1802.522) (-1789.283) (-1791.487) -- 0:02:27
681000 -- (-1791.558) (-1791.581) (-1793.427) [-1785.937] * (-1791.902) (-1794.019) [-1789.975] (-1798.235) -- 0:02:27
681500 -- [-1785.811] (-1810.034) (-1787.279) (-1800.171) * (-1801.961) (-1795.728) [-1789.336] (-1795.256) -- 0:02:26
682000 -- [-1788.195] (-1795.121) (-1787.610) (-1786.940) * (-1801.229) [-1796.723] (-1791.957) (-1797.097) -- 0:02:26
682500 -- (-1786.577) [-1796.414] (-1789.137) (-1792.962) * (-1787.587) [-1791.714] (-1792.474) (-1792.425) -- 0:02:26
683000 -- (-1785.957) (-1792.393) [-1788.811] (-1797.635) * (-1803.051) (-1804.517) (-1787.968) [-1788.486] -- 0:02:26
683500 -- [-1786.263] (-1796.854) (-1798.997) (-1787.476) * [-1792.134] (-1788.333) (-1798.769) (-1787.023) -- 0:02:25
684000 -- (-1790.715) [-1789.592] (-1798.065) (-1790.966) * (-1791.887) [-1799.394] (-1792.479) (-1793.909) -- 0:02:25
684500 -- (-1791.077) [-1782.273] (-1799.699) (-1787.881) * (-1794.761) [-1789.678] (-1791.012) (-1794.066) -- 0:02:25
685000 -- (-1791.093) (-1788.673) [-1789.971] (-1790.231) * [-1792.859] (-1793.181) (-1788.430) (-1797.742) -- 0:02:25
Average standard deviation of split frequencies: 0.002119
685500 -- (-1794.853) (-1792.930) (-1808.306) [-1785.053] * (-1784.896) (-1789.857) [-1787.090] (-1793.303) -- 0:02:24
686000 -- (-1789.153) (-1791.010) (-1796.404) [-1787.902] * (-1799.016) (-1792.675) [-1788.412] (-1789.535) -- 0:02:24
686500 -- (-1794.523) [-1790.958] (-1795.575) (-1791.080) * (-1790.439) [-1790.633] (-1787.439) (-1799.001) -- 0:02:24
687000 -- (-1797.967) (-1791.028) [-1787.165] (-1785.039) * (-1786.931) [-1787.528] (-1792.893) (-1797.089) -- 0:02:24
687500 -- (-1793.828) (-1796.693) (-1785.314) [-1785.590] * (-1789.925) (-1787.870) [-1787.327] (-1791.455) -- 0:02:24
688000 -- (-1801.601) (-1791.541) (-1788.983) [-1793.561] * (-1805.536) (-1795.499) (-1786.944) [-1796.331] -- 0:02:23
688500 -- (-1794.616) [-1799.359] (-1788.836) (-1788.389) * (-1787.431) [-1791.958] (-1794.389) (-1791.711) -- 0:02:23
689000 -- (-1796.348) [-1793.184] (-1790.770) (-1801.408) * (-1794.741) [-1794.556] (-1799.047) (-1794.281) -- 0:02:23
689500 -- [-1787.204] (-1785.761) (-1786.993) (-1788.598) * (-1787.036) [-1788.487] (-1788.241) (-1800.088) -- 0:02:23
690000 -- (-1796.558) (-1794.301) [-1795.443] (-1791.991) * [-1788.932] (-1798.118) (-1793.661) (-1802.252) -- 0:02:22
Average standard deviation of split frequencies: 0.003128
690500 -- (-1792.553) (-1790.771) [-1783.736] (-1802.184) * (-1791.615) (-1790.682) [-1788.950] (-1799.329) -- 0:02:22
691000 -- [-1792.285] (-1787.238) (-1800.084) (-1780.719) * (-1790.318) [-1796.856] (-1790.524) (-1799.427) -- 0:02:22
691500 -- (-1795.025) (-1796.176) [-1797.827] (-1789.803) * (-1802.277) (-1790.020) [-1788.252] (-1786.613) -- 0:02:22
692000 -- (-1795.272) (-1786.890) [-1790.067] (-1787.661) * (-1786.011) (-1791.737) (-1788.394) [-1794.590] -- 0:02:21
692500 -- [-1788.069] (-1786.908) (-1787.812) (-1792.428) * (-1792.309) [-1787.916] (-1796.079) (-1785.789) -- 0:02:21
693000 -- (-1791.007) (-1792.431) (-1802.776) [-1787.078] * (-1803.652) [-1788.022] (-1799.802) (-1788.881) -- 0:02:21
693500 -- [-1790.818] (-1799.528) (-1788.857) (-1793.693) * (-1796.558) [-1792.543] (-1796.092) (-1783.256) -- 0:02:21
694000 -- (-1789.264) (-1790.157) (-1795.013) [-1791.959] * (-1793.647) (-1795.814) (-1794.922) [-1791.814] -- 0:02:21
694500 -- [-1793.403] (-1794.283) (-1798.580) (-1799.561) * (-1795.357) [-1790.170] (-1797.794) (-1793.393) -- 0:02:20
695000 -- [-1790.780] (-1779.279) (-1794.739) (-1797.868) * (-1793.936) (-1802.656) [-1788.726] (-1789.882) -- 0:02:20
Average standard deviation of split frequencies: 0.002540
695500 -- (-1791.163) (-1796.694) [-1790.359] (-1806.218) * (-1793.958) (-1794.945) [-1788.683] (-1789.594) -- 0:02:20
696000 -- (-1791.485) (-1794.584) [-1791.582] (-1791.770) * (-1790.878) [-1790.950] (-1794.770) (-1796.930) -- 0:02:20
696500 -- (-1796.414) [-1788.936] (-1791.687) (-1785.184) * [-1790.923] (-1794.547) (-1788.810) (-1796.417) -- 0:02:19
697000 -- (-1790.455) (-1794.020) [-1787.413] (-1785.710) * (-1787.927) (-1796.296) [-1793.190] (-1794.602) -- 0:02:19
697500 -- [-1787.336] (-1790.326) (-1797.804) (-1790.123) * (-1787.002) [-1788.560] (-1797.809) (-1790.142) -- 0:02:19
698000 -- [-1792.552] (-1797.056) (-1795.787) (-1794.415) * (-1797.976) [-1787.151] (-1787.528) (-1797.915) -- 0:02:19
698500 -- (-1792.102) (-1795.370) (-1792.630) [-1791.250] * [-1790.604] (-1793.009) (-1796.068) (-1790.894) -- 0:02:18
699000 -- (-1789.098) (-1790.026) (-1791.627) [-1787.290] * [-1787.578] (-1784.803) (-1795.535) (-1787.042) -- 0:02:19
699500 -- (-1796.527) (-1793.313) [-1796.394] (-1794.956) * (-1803.027) (-1791.144) [-1790.943] (-1795.420) -- 0:02:18
700000 -- (-1793.042) (-1785.441) (-1800.306) [-1802.903] * (-1787.105) [-1786.970] (-1792.904) (-1795.293) -- 0:02:18
Average standard deviation of split frequencies: 0.003364
700500 -- (-1785.387) (-1794.764) [-1791.529] (-1791.604) * (-1795.652) [-1789.482] (-1789.865) (-1795.645) -- 0:02:18
701000 -- [-1795.629] (-1789.555) (-1799.043) (-1795.304) * (-1792.564) [-1786.367] (-1786.300) (-1789.812) -- 0:02:18
701500 -- (-1794.397) (-1799.181) (-1791.679) [-1786.392] * (-1793.492) [-1788.195] (-1785.845) (-1795.641) -- 0:02:17
702000 -- (-1793.907) [-1794.283] (-1799.110) (-1787.724) * (-1790.868) [-1792.322] (-1798.160) (-1791.889) -- 0:02:17
702500 -- (-1791.157) (-1796.060) [-1788.814] (-1792.269) * (-1794.158) [-1791.744] (-1802.984) (-1790.619) -- 0:02:17
703000 -- [-1790.556] (-1796.297) (-1792.003) (-1800.539) * (-1809.198) (-1789.215) [-1793.459] (-1787.493) -- 0:02:16
703500 -- (-1789.518) [-1786.677] (-1788.118) (-1792.540) * [-1785.037] (-1789.224) (-1797.999) (-1799.073) -- 0:02:16
704000 -- (-1790.419) (-1788.415) [-1789.872] (-1796.730) * [-1789.207] (-1790.857) (-1788.065) (-1793.756) -- 0:02:16
704500 -- (-1789.519) (-1785.998) [-1793.144] (-1784.524) * (-1784.240) (-1793.873) [-1790.573] (-1794.066) -- 0:02:16
705000 -- (-1790.671) (-1808.246) (-1796.490) [-1791.316] * (-1789.086) [-1794.075] (-1794.310) (-1802.232) -- 0:02:15
Average standard deviation of split frequencies: 0.003561
705500 -- (-1794.012) [-1788.707] (-1789.637) (-1800.372) * (-1788.461) (-1792.213) [-1795.839] (-1786.777) -- 0:02:16
706000 -- [-1787.559] (-1790.607) (-1797.475) (-1789.905) * (-1788.205) (-1790.810) (-1794.909) [-1793.047] -- 0:02:15
706500 -- (-1786.355) (-1792.561) [-1785.175] (-1785.711) * (-1799.358) [-1786.497] (-1801.421) (-1800.781) -- 0:02:15
707000 -- [-1787.647] (-1795.685) (-1790.764) (-1798.081) * (-1795.594) (-1793.104) [-1794.251] (-1795.560) -- 0:02:15
707500 -- (-1793.276) [-1794.411] (-1793.051) (-1797.100) * (-1791.346) [-1787.885] (-1797.160) (-1799.218) -- 0:02:15
708000 -- [-1789.990] (-1789.918) (-1788.093) (-1789.031) * (-1790.972) (-1788.704) (-1807.376) [-1791.637] -- 0:02:14
708500 -- [-1787.645] (-1799.637) (-1803.351) (-1791.157) * [-1788.547] (-1783.715) (-1800.560) (-1785.495) -- 0:02:14
709000 -- (-1793.449) (-1783.107) [-1800.483] (-1799.654) * (-1789.731) [-1786.917] (-1796.479) (-1794.735) -- 0:02:14
709500 -- (-1794.643) [-1785.555] (-1791.330) (-1799.263) * (-1796.918) [-1784.925] (-1802.457) (-1791.905) -- 0:02:13
710000 -- (-1804.589) [-1789.451] (-1804.397) (-1799.500) * [-1790.553] (-1792.235) (-1798.163) (-1796.915) -- 0:02:13
Average standard deviation of split frequencies: 0.002874
710500 -- (-1791.325) (-1792.923) [-1793.713] (-1787.925) * (-1790.392) (-1792.803) (-1788.770) [-1793.158] -- 0:02:13
711000 -- (-1802.956) [-1788.395] (-1798.018) (-1801.974) * (-1790.564) (-1793.801) [-1798.752] (-1797.080) -- 0:02:13
711500 -- (-1793.553) [-1789.848] (-1782.574) (-1794.770) * (-1781.807) (-1796.765) (-1797.587) [-1793.732] -- 0:02:12
712000 -- (-1796.302) (-1790.954) [-1791.693] (-1801.409) * [-1789.780] (-1790.997) (-1795.086) (-1786.869) -- 0:02:13
712500 -- (-1805.711) [-1799.641] (-1788.766) (-1799.257) * [-1789.444] (-1798.263) (-1797.294) (-1784.922) -- 0:02:12
713000 -- [-1797.810] (-1798.992) (-1793.552) (-1788.327) * (-1789.123) [-1784.383] (-1790.483) (-1803.589) -- 0:02:12
713500 -- (-1796.273) (-1791.385) [-1786.656] (-1798.916) * (-1790.983) (-1790.032) [-1787.273] (-1800.958) -- 0:02:12
714000 -- (-1796.316) (-1796.374) (-1789.348) [-1790.823] * (-1791.981) (-1805.961) [-1791.673] (-1800.268) -- 0:02:12
714500 -- [-1790.527] (-1786.800) (-1792.979) (-1796.724) * [-1790.025] (-1795.532) (-1785.662) (-1797.385) -- 0:02:11
715000 -- (-1802.390) (-1802.093) [-1789.099] (-1798.349) * (-1794.057) (-1792.526) [-1782.169] (-1797.851) -- 0:02:11
Average standard deviation of split frequencies: 0.003127
715500 -- (-1790.620) (-1794.454) (-1792.740) [-1792.989] * [-1793.190] (-1788.497) (-1797.300) (-1791.963) -- 0:02:11
716000 -- (-1791.168) (-1783.258) [-1790.727] (-1793.583) * (-1805.734) (-1794.347) (-1785.923) [-1793.284] -- 0:02:11
716500 -- [-1785.757] (-1785.390) (-1788.867) (-1797.329) * (-1798.920) (-1797.805) [-1786.814] (-1796.607) -- 0:02:10
717000 -- (-1796.599) (-1787.163) [-1796.510] (-1803.416) * (-1786.944) [-1791.920] (-1793.779) (-1796.146) -- 0:02:10
717500 -- (-1794.439) (-1791.017) (-1788.343) [-1793.730] * (-1786.300) (-1797.906) (-1794.207) [-1786.613] -- 0:02:10
718000 -- (-1795.132) [-1792.261] (-1789.363) (-1786.234) * (-1788.782) (-1787.249) [-1794.598] (-1795.741) -- 0:02:10
718500 -- (-1788.380) (-1796.032) [-1790.716] (-1793.503) * (-1790.373) (-1795.943) (-1794.559) [-1786.155] -- 0:02:10
719000 -- (-1791.224) [-1790.125] (-1787.462) (-1796.262) * [-1783.085] (-1796.982) (-1795.768) (-1810.716) -- 0:02:09
719500 -- (-1792.218) (-1797.214) (-1793.768) [-1788.859] * (-1792.021) (-1796.228) (-1790.939) [-1793.663] -- 0:02:09
720000 -- (-1790.221) (-1790.276) [-1793.491] (-1799.761) * (-1789.721) (-1791.825) (-1802.156) [-1793.947] -- 0:02:09
Average standard deviation of split frequencies: 0.002944
720500 -- (-1796.749) [-1788.935] (-1795.408) (-1795.068) * [-1790.426] (-1794.468) (-1792.011) (-1792.619) -- 0:02:09
721000 -- (-1790.162) [-1789.666] (-1796.217) (-1792.283) * [-1795.787] (-1786.213) (-1792.025) (-1783.675) -- 0:02:08
721500 -- [-1789.465] (-1790.363) (-1799.019) (-1797.802) * (-1787.933) (-1789.615) (-1797.563) [-1785.049] -- 0:02:08
722000 -- (-1811.758) [-1793.434] (-1797.535) (-1793.771) * (-1800.563) (-1787.090) [-1794.179] (-1782.507) -- 0:02:08
722500 -- (-1795.869) (-1792.143) [-1789.475] (-1791.762) * (-1797.597) (-1788.445) (-1791.540) [-1793.064] -- 0:02:08
723000 -- (-1792.675) (-1797.706) [-1785.664] (-1788.423) * (-1796.329) (-1789.132) [-1783.700] (-1787.794) -- 0:02:07
723500 -- (-1806.481) (-1798.479) (-1792.669) [-1796.544] * (-1792.335) (-1793.747) (-1795.220) [-1789.210] -- 0:02:07
724000 -- (-1794.499) (-1792.739) [-1788.536] (-1789.289) * (-1794.228) [-1785.839] (-1796.126) (-1791.253) -- 0:02:07
724500 -- (-1796.032) (-1796.295) [-1783.531] (-1789.812) * (-1786.606) (-1783.316) (-1790.345) [-1789.297] -- 0:02:07
725000 -- (-1794.332) [-1797.483] (-1791.392) (-1787.343) * (-1793.821) [-1793.429] (-1787.923) (-1786.290) -- 0:02:07
Average standard deviation of split frequencies: 0.002760
725500 -- (-1801.951) (-1793.847) [-1789.503] (-1787.053) * (-1789.566) (-1790.555) [-1794.870] (-1785.989) -- 0:02:06
726000 -- (-1796.086) (-1804.998) (-1792.658) [-1788.744] * (-1787.269) [-1787.265] (-1791.955) (-1795.127) -- 0:02:06
726500 -- [-1790.085] (-1797.013) (-1789.794) (-1790.550) * (-1797.176) (-1790.963) [-1790.987] (-1786.709) -- 0:02:06
727000 -- (-1786.865) (-1804.492) (-1792.042) [-1793.478] * (-1788.143) (-1788.562) [-1791.223] (-1787.514) -- 0:02:06
727500 -- (-1797.853) (-1786.280) [-1791.013] (-1790.880) * [-1787.933] (-1785.965) (-1789.392) (-1790.339) -- 0:02:05
728000 -- (-1794.297) (-1799.437) (-1791.347) [-1790.911] * (-1787.503) (-1788.179) (-1795.530) [-1790.858] -- 0:02:05
728500 -- (-1795.269) (-1796.965) [-1787.733] (-1798.440) * [-1789.564] (-1789.292) (-1792.260) (-1798.865) -- 0:02:05
729000 -- [-1786.299] (-1788.319) (-1792.671) (-1789.361) * (-1791.155) (-1789.674) (-1796.983) [-1787.474] -- 0:02:05
729500 -- (-1795.520) [-1788.064] (-1795.800) (-1795.998) * [-1788.504] (-1796.320) (-1803.949) (-1789.427) -- 0:02:04
730000 -- [-1789.292] (-1789.049) (-1812.287) (-1787.249) * [-1788.458] (-1790.445) (-1801.274) (-1801.536) -- 0:02:04
Average standard deviation of split frequencies: 0.002903
730500 -- (-1792.942) [-1791.767] (-1802.107) (-1788.311) * (-1795.754) (-1790.289) (-1798.960) [-1792.456] -- 0:02:04
731000 -- (-1781.272) (-1797.024) [-1789.518] (-1803.510) * [-1792.031] (-1789.942) (-1789.612) (-1800.139) -- 0:02:04
731500 -- [-1788.176] (-1786.481) (-1792.834) (-1788.520) * [-1800.797] (-1794.746) (-1790.639) (-1792.053) -- 0:02:04
732000 -- (-1793.511) (-1788.063) [-1790.908] (-1803.002) * (-1789.448) (-1800.009) (-1795.493) [-1787.292] -- 0:02:03
732500 -- (-1790.424) (-1789.955) (-1787.047) [-1787.393] * (-1790.869) (-1799.663) (-1789.341) [-1790.623] -- 0:02:03
733000 -- [-1791.651] (-1787.216) (-1791.727) (-1793.700) * [-1793.244] (-1798.631) (-1791.116) (-1803.382) -- 0:02:03
733500 -- (-1789.719) (-1784.891) [-1794.208] (-1788.306) * [-1784.412] (-1787.662) (-1799.030) (-1797.601) -- 0:02:03
734000 -- (-1803.021) (-1791.859) [-1791.028] (-1796.253) * (-1787.858) (-1786.079) (-1786.689) [-1791.308] -- 0:02:02
734500 -- (-1792.264) (-1800.898) [-1788.243] (-1789.626) * [-1787.947] (-1791.907) (-1794.776) (-1799.025) -- 0:02:02
735000 -- (-1795.190) (-1798.679) (-1792.464) [-1786.880] * (-1801.389) (-1794.010) [-1793.636] (-1790.424) -- 0:02:02
Average standard deviation of split frequencies: 0.002989
735500 -- (-1794.367) (-1798.233) (-1794.946) [-1788.130] * (-1786.818) (-1795.637) [-1786.885] (-1787.258) -- 0:02:02
736000 -- (-1790.670) (-1799.643) (-1789.416) [-1790.622] * [-1783.784] (-1796.703) (-1787.814) (-1787.614) -- 0:02:01
736500 -- [-1793.161] (-1793.929) (-1804.591) (-1788.416) * [-1788.679] (-1796.371) (-1791.286) (-1792.185) -- 0:02:01
737000 -- (-1795.706) (-1800.566) (-1794.719) [-1787.218] * [-1785.719] (-1789.018) (-1790.547) (-1787.248) -- 0:02:01
737500 -- [-1791.156] (-1804.969) (-1785.018) (-1806.958) * [-1797.667] (-1788.378) (-1789.151) (-1789.989) -- 0:02:01
738000 -- [-1793.624] (-1807.571) (-1794.096) (-1792.351) * (-1796.076) (-1791.363) (-1793.594) [-1784.210] -- 0:02:01
738500 -- [-1783.118] (-1794.725) (-1793.218) (-1789.663) * (-1794.939) (-1795.484) (-1787.134) [-1785.962] -- 0:02:00
739000 -- (-1790.016) [-1789.786] (-1798.212) (-1787.769) * (-1784.835) (-1783.873) (-1789.842) [-1798.047] -- 0:02:00
739500 -- (-1788.576) (-1792.259) [-1794.622] (-1795.642) * (-1785.519) (-1792.186) (-1796.842) [-1793.372] -- 0:02:00
740000 -- [-1791.206] (-1798.551) (-1795.719) (-1797.823) * (-1788.283) (-1799.779) (-1794.629) [-1793.143] -- 0:02:00
Average standard deviation of split frequencies: 0.002652
740500 -- (-1792.759) [-1793.546] (-1798.512) (-1787.563) * (-1792.704) (-1793.501) (-1787.346) [-1784.823] -- 0:01:59
741000 -- [-1791.089] (-1795.355) (-1790.234) (-1802.494) * [-1782.872] (-1795.737) (-1798.452) (-1789.584) -- 0:01:59
741500 -- (-1792.272) (-1788.724) (-1795.441) [-1797.415] * (-1796.925) (-1803.351) [-1792.548] (-1791.122) -- 0:01:59
742000 -- (-1792.107) (-1791.251) [-1792.256] (-1797.180) * (-1804.258) (-1799.398) [-1789.858] (-1793.421) -- 0:01:59
742500 -- (-1796.795) [-1792.904] (-1800.518) (-1801.300) * (-1800.342) (-1793.529) [-1805.706] (-1795.741) -- 0:01:58
743000 -- (-1801.611) (-1802.736) [-1792.877] (-1787.847) * [-1794.433] (-1791.118) (-1801.883) (-1791.969) -- 0:01:58
743500 -- (-1799.578) (-1792.224) [-1794.968] (-1792.168) * (-1788.705) (-1789.837) [-1793.479] (-1793.021) -- 0:01:58
744000 -- (-1807.776) (-1799.653) [-1787.929] (-1792.125) * (-1786.316) [-1785.131] (-1789.238) (-1791.727) -- 0:01:58
744500 -- [-1787.031] (-1801.875) (-1787.866) (-1793.231) * (-1789.939) [-1789.597] (-1790.076) (-1796.446) -- 0:01:58
745000 -- (-1792.023) [-1792.422] (-1800.829) (-1791.076) * (-1784.953) (-1790.159) [-1793.467] (-1789.731) -- 0:01:57
Average standard deviation of split frequencies: 0.002317
745500 -- (-1803.189) (-1792.674) (-1790.083) [-1788.115] * (-1788.855) (-1784.398) [-1793.375] (-1793.765) -- 0:01:57
746000 -- (-1792.899) (-1792.405) [-1785.111] (-1791.909) * [-1787.628] (-1786.648) (-1805.914) (-1802.417) -- 0:01:57
746500 -- (-1792.444) [-1784.144] (-1788.380) (-1793.878) * [-1783.980] (-1795.506) (-1797.332) (-1795.013) -- 0:01:57
747000 -- (-1795.360) (-1782.626) [-1786.029] (-1804.473) * [-1790.258] (-1800.824) (-1798.493) (-1801.302) -- 0:01:56
747500 -- (-1802.624) (-1790.240) (-1792.452) [-1795.952] * (-1793.831) (-1797.217) [-1787.057] (-1796.610) -- 0:01:56
748000 -- (-1785.430) (-1787.710) [-1789.551] (-1804.770) * [-1787.495] (-1789.158) (-1791.116) (-1788.355) -- 0:01:56
748500 -- (-1796.095) [-1788.891] (-1788.483) (-1803.242) * (-1792.347) (-1793.402) [-1787.218] (-1795.812) -- 0:01:56
749000 -- (-1799.859) [-1787.391] (-1782.155) (-1792.681) * (-1789.683) [-1785.643] (-1786.070) (-1793.100) -- 0:01:55
749500 -- (-1795.418) (-1795.448) [-1785.042] (-1790.545) * [-1790.930] (-1795.741) (-1797.921) (-1792.433) -- 0:01:55
750000 -- [-1788.899] (-1795.987) (-1792.691) (-1792.924) * (-1787.234) (-1802.867) (-1785.691) [-1794.133] -- 0:01:55
Average standard deviation of split frequencies: 0.002617
750500 -- (-1794.811) (-1798.867) (-1791.098) [-1794.197] * (-1789.176) (-1802.729) (-1789.244) [-1788.249] -- 0:01:55
751000 -- (-1785.515) (-1789.240) (-1787.911) [-1796.229] * [-1787.933] (-1802.592) (-1790.870) (-1793.773) -- 0:01:55
751500 -- (-1797.170) (-1787.482) [-1795.896] (-1791.451) * [-1785.702] (-1790.621) (-1787.815) (-1794.280) -- 0:01:54
752000 -- (-1797.551) (-1791.551) (-1798.329) [-1794.988] * [-1792.293] (-1791.380) (-1787.829) (-1798.973) -- 0:01:54
752500 -- (-1793.101) [-1790.841] (-1793.166) (-1798.878) * (-1788.800) (-1789.175) (-1792.795) [-1793.419] -- 0:01:54
753000 -- [-1793.187] (-1791.811) (-1788.428) (-1796.669) * (-1786.756) (-1802.071) [-1785.551] (-1794.174) -- 0:01:54
753500 -- (-1793.654) (-1795.154) (-1784.841) [-1792.896] * (-1794.278) (-1803.094) [-1791.720] (-1795.764) -- 0:01:53
754000 -- (-1794.729) (-1795.069) [-1788.423] (-1791.964) * (-1799.253) (-1792.277) [-1786.504] (-1794.251) -- 0:01:53
754500 -- (-1792.297) [-1786.947] (-1791.139) (-1795.499) * [-1786.095] (-1794.937) (-1798.033) (-1792.955) -- 0:01:53
755000 -- (-1798.536) (-1792.342) (-1792.322) [-1784.211] * [-1790.419] (-1794.623) (-1792.292) (-1800.183) -- 0:01:53
Average standard deviation of split frequencies: 0.002962
755500 -- (-1788.399) (-1789.313) [-1791.894] (-1793.406) * (-1786.472) (-1797.443) (-1790.532) [-1795.815] -- 0:01:52
756000 -- (-1792.647) [-1784.692] (-1791.202) (-1794.661) * [-1787.222] (-1790.302) (-1802.896) (-1791.221) -- 0:01:52
756500 -- (-1792.765) (-1791.280) [-1790.921] (-1788.725) * [-1787.245] (-1794.926) (-1795.913) (-1806.131) -- 0:01:52
757000 -- (-1800.221) (-1792.329) (-1807.305) [-1787.609] * (-1794.859) (-1792.561) [-1786.433] (-1804.518) -- 0:01:52
757500 -- (-1798.247) [-1787.616] (-1799.967) (-1795.223) * (-1789.180) [-1785.054] (-1795.813) (-1795.176) -- 0:01:52
758000 -- (-1790.455) [-1789.954] (-1786.421) (-1791.758) * (-1791.634) [-1794.937] (-1792.904) (-1796.366) -- 0:01:51
758500 -- [-1786.877] (-1789.777) (-1790.690) (-1793.383) * (-1803.263) [-1794.709] (-1793.838) (-1797.174) -- 0:01:51
759000 -- [-1787.249] (-1800.765) (-1796.143) (-1794.002) * (-1796.046) [-1793.836] (-1791.789) (-1789.325) -- 0:01:51
759500 -- (-1799.240) (-1789.148) (-1792.835) [-1793.087] * (-1788.517) [-1792.884] (-1798.308) (-1803.312) -- 0:01:51
760000 -- (-1798.745) (-1782.186) [-1789.678] (-1797.674) * (-1796.793) [-1792.096] (-1795.981) (-1795.981) -- 0:01:50
Average standard deviation of split frequencies: 0.003873
760500 -- (-1793.822) (-1790.829) (-1802.548) [-1787.076] * (-1802.344) (-1788.746) (-1794.710) [-1794.992] -- 0:01:50
761000 -- [-1786.766] (-1795.085) (-1798.692) (-1793.862) * (-1791.756) (-1796.643) (-1794.532) [-1787.184] -- 0:01:50
761500 -- (-1789.533) [-1791.995] (-1797.454) (-1793.894) * (-1804.555) (-1789.213) (-1797.937) [-1790.584] -- 0:01:50
762000 -- (-1792.111) (-1808.431) (-1785.688) [-1784.387] * (-1798.245) [-1783.520] (-1788.238) (-1791.982) -- 0:01:49
762500 -- (-1798.656) [-1787.352] (-1790.502) (-1793.819) * [-1786.271] (-1786.175) (-1810.264) (-1804.203) -- 0:01:49
763000 -- (-1793.101) (-1789.187) (-1791.927) [-1796.216] * (-1789.352) [-1786.853] (-1794.054) (-1795.014) -- 0:01:49
763500 -- [-1789.189] (-1788.761) (-1800.151) (-1797.400) * [-1787.033] (-1793.833) (-1803.927) (-1802.373) -- 0:01:49
764000 -- (-1793.460) (-1798.614) (-1795.619) [-1791.348] * [-1787.082] (-1790.080) (-1803.894) (-1794.534) -- 0:01:49
764500 -- (-1795.192) [-1786.673] (-1814.543) (-1793.025) * [-1791.575] (-1791.448) (-1808.590) (-1787.163) -- 0:01:48
765000 -- (-1793.211) [-1791.980] (-1794.742) (-1791.273) * (-1788.998) (-1786.456) (-1796.594) [-1786.910] -- 0:01:48
Average standard deviation of split frequencies: 0.004205
765500 -- [-1786.929] (-1804.523) (-1790.851) (-1788.833) * (-1797.761) (-1794.374) (-1796.314) [-1791.274] -- 0:01:48
766000 -- [-1786.987] (-1796.784) (-1793.529) (-1791.997) * [-1795.798] (-1799.076) (-1807.292) (-1792.800) -- 0:01:48
766500 -- [-1786.001] (-1794.656) (-1796.856) (-1794.571) * [-1787.073] (-1799.543) (-1788.271) (-1793.133) -- 0:01:47
767000 -- (-1790.008) [-1798.453] (-1796.289) (-1790.338) * (-1792.175) [-1795.633] (-1790.501) (-1787.719) -- 0:01:47
767500 -- [-1792.403] (-1794.941) (-1788.799) (-1797.543) * [-1791.779] (-1790.521) (-1793.196) (-1796.767) -- 0:01:47
768000 -- (-1786.073) (-1795.409) [-1784.542] (-1803.343) * (-1789.146) (-1796.362) [-1782.794] (-1794.192) -- 0:01:47
768500 -- [-1789.205] (-1807.991) (-1796.110) (-1801.886) * [-1789.542] (-1795.347) (-1790.365) (-1798.260) -- 0:01:46
769000 -- (-1803.686) [-1790.228] (-1793.706) (-1799.545) * [-1795.140] (-1787.110) (-1786.188) (-1792.239) -- 0:01:46
769500 -- [-1791.603] (-1799.230) (-1791.886) (-1800.959) * (-1786.692) (-1795.811) [-1786.680] (-1797.765) -- 0:01:46
770000 -- [-1788.729] (-1790.328) (-1793.100) (-1802.808) * (-1788.071) (-1793.819) [-1793.087] (-1800.690) -- 0:01:46
Average standard deviation of split frequencies: 0.004741
770500 -- (-1789.503) [-1793.843] (-1794.575) (-1794.411) * (-1793.713) (-1799.516) (-1801.039) [-1789.454] -- 0:01:46
771000 -- (-1792.369) [-1791.971] (-1793.591) (-1793.077) * [-1785.460] (-1794.129) (-1808.780) (-1795.710) -- 0:01:45
771500 -- (-1785.856) (-1791.663) (-1796.711) [-1793.132] * (-1787.024) (-1789.709) (-1801.413) [-1791.668] -- 0:01:45
772000 -- [-1788.065] (-1788.356) (-1786.064) (-1791.612) * (-1789.278) [-1787.689] (-1795.649) (-1797.065) -- 0:01:45
772500 -- (-1796.140) [-1788.552] (-1794.464) (-1790.509) * [-1786.660] (-1787.776) (-1791.531) (-1797.477) -- 0:01:45
773000 -- (-1789.281) (-1786.962) [-1791.156] (-1796.863) * (-1791.944) [-1791.578] (-1788.643) (-1795.036) -- 0:01:44
773500 -- [-1789.059] (-1791.294) (-1787.902) (-1801.597) * [-1786.554] (-1789.813) (-1802.082) (-1787.752) -- 0:01:44
774000 -- (-1790.093) [-1791.805] (-1791.975) (-1788.489) * (-1798.875) [-1779.958] (-1790.592) (-1785.768) -- 0:01:44
774500 -- (-1788.382) (-1803.330) (-1794.136) [-1785.510] * (-1810.633) [-1787.197] (-1794.946) (-1789.639) -- 0:01:43
775000 -- (-1798.151) (-1792.689) [-1795.824] (-1797.923) * (-1798.415) (-1793.773) (-1797.080) [-1793.022] -- 0:01:43
Average standard deviation of split frequencies: 0.004759
775500 -- (-1789.483) (-1790.013) (-1801.961) [-1794.985] * (-1794.594) (-1794.850) (-1790.440) [-1782.376] -- 0:01:43
776000 -- [-1785.373] (-1787.083) (-1793.863) (-1796.712) * [-1793.939] (-1794.568) (-1781.015) (-1805.309) -- 0:01:43
776500 -- [-1788.807] (-1802.025) (-1789.665) (-1794.440) * (-1803.049) [-1792.537] (-1790.742) (-1790.793) -- 0:01:43
777000 -- [-1789.356] (-1795.120) (-1791.278) (-1786.495) * [-1804.205] (-1792.308) (-1789.220) (-1792.780) -- 0:01:43
777500 -- (-1810.276) (-1792.984) (-1800.318) [-1789.986] * (-1795.296) [-1796.360] (-1791.719) (-1795.842) -- 0:01:42
778000 -- (-1794.043) (-1796.829) (-1789.732) [-1792.287] * (-1790.999) (-1798.264) [-1792.782] (-1790.601) -- 0:01:42
778500 -- [-1784.790] (-1790.934) (-1798.601) (-1788.343) * (-1794.828) (-1794.091) (-1790.465) [-1784.575] -- 0:01:42
779000 -- (-1795.424) (-1785.039) (-1795.808) [-1785.237] * (-1792.476) (-1797.471) [-1786.678] (-1789.495) -- 0:01:42
779500 -- (-1786.954) [-1790.433] (-1794.625) (-1796.839) * [-1784.604] (-1794.528) (-1795.852) (-1791.197) -- 0:01:41
780000 -- (-1798.105) (-1788.269) (-1787.115) [-1789.627] * (-1798.210) (-1791.877) (-1788.342) [-1794.283] -- 0:01:41
Average standard deviation of split frequencies: 0.004630
780500 -- (-1794.697) (-1789.481) [-1791.094] (-1788.580) * (-1796.931) [-1796.445] (-1790.151) (-1797.565) -- 0:01:41
781000 -- (-1793.701) (-1800.783) [-1784.969] (-1786.327) * [-1801.679] (-1786.255) (-1800.453) (-1796.211) -- 0:01:40
781500 -- [-1794.513] (-1793.977) (-1790.179) (-1789.190) * (-1790.456) (-1797.644) (-1786.253) [-1788.864] -- 0:01:40
782000 -- (-1787.016) [-1787.734] (-1794.727) (-1794.882) * [-1788.211] (-1800.497) (-1786.413) (-1800.764) -- 0:01:40
782500 -- (-1787.567) (-1789.944) [-1794.810] (-1799.147) * (-1790.419) [-1789.220] (-1793.264) (-1796.747) -- 0:01:40
783000 -- (-1798.015) (-1793.671) [-1785.013] (-1789.023) * (-1788.814) (-1797.956) [-1789.852] (-1800.276) -- 0:01:40
783500 -- [-1793.462] (-1792.409) (-1793.949) (-1789.641) * (-1795.437) [-1787.786] (-1796.043) (-1792.508) -- 0:01:40
784000 -- (-1791.642) [-1790.659] (-1791.693) (-1787.172) * (-1791.309) (-1789.880) [-1786.103] (-1786.702) -- 0:01:39
784500 -- (-1789.874) [-1787.129] (-1788.776) (-1794.161) * (-1792.254) (-1800.111) (-1794.287) [-1793.744] -- 0:01:39
785000 -- [-1802.220] (-1802.952) (-1789.028) (-1788.966) * (-1793.780) [-1786.502] (-1791.293) (-1795.428) -- 0:01:39
Average standard deviation of split frequencies: 0.005198
785500 -- [-1793.859] (-1796.200) (-1789.192) (-1788.723) * (-1792.026) (-1792.436) [-1797.668] (-1787.327) -- 0:01:38
786000 -- (-1794.534) (-1797.597) [-1793.637] (-1799.458) * (-1796.029) (-1785.904) (-1793.012) [-1788.503] -- 0:01:38
786500 -- (-1791.145) (-1790.668) (-1790.940) [-1789.039] * (-1794.730) [-1788.205] (-1793.885) (-1786.712) -- 0:01:38
787000 -- (-1790.451) [-1787.563] (-1787.715) (-1791.971) * (-1794.682) (-1794.999) (-1787.909) [-1786.077] -- 0:01:38
787500 -- [-1786.372] (-1799.762) (-1791.492) (-1793.743) * (-1797.825) (-1793.661) [-1790.849] (-1788.320) -- 0:01:37
788000 -- [-1789.453] (-1799.546) (-1809.504) (-1797.885) * (-1784.738) [-1787.909] (-1802.692) (-1787.702) -- 0:01:37
788500 -- [-1787.681] (-1793.208) (-1790.848) (-1787.030) * (-1792.973) (-1788.088) (-1788.382) [-1794.020] -- 0:01:37
789000 -- [-1794.343] (-1793.781) (-1793.617) (-1797.454) * (-1792.714) (-1786.790) [-1788.233] (-1798.417) -- 0:01:37
789500 -- (-1794.002) (-1784.682) (-1788.975) [-1794.263] * [-1793.203] (-1792.900) (-1788.188) (-1789.176) -- 0:01:37
790000 -- [-1788.954] (-1798.966) (-1802.812) (-1793.617) * [-1788.902] (-1797.271) (-1791.011) (-1790.918) -- 0:01:37
Average standard deviation of split frequencies: 0.005614
790500 -- (-1792.050) (-1793.033) [-1788.051] (-1806.901) * (-1794.561) [-1788.088] (-1790.032) (-1807.944) -- 0:01:36
791000 -- [-1783.374] (-1788.729) (-1790.857) (-1800.103) * [-1781.985] (-1790.368) (-1794.306) (-1796.559) -- 0:01:36
791500 -- (-1795.195) (-1802.014) [-1790.313] (-1792.793) * (-1787.416) (-1800.949) [-1795.906] (-1802.055) -- 0:01:36
792000 -- (-1793.194) (-1793.250) [-1795.920] (-1796.392) * [-1790.881] (-1796.237) (-1792.772) (-1790.546) -- 0:01:35
792500 -- (-1796.365) [-1796.877] (-1803.569) (-1792.437) * [-1788.725] (-1798.172) (-1796.701) (-1797.313) -- 0:01:35
793000 -- (-1788.033) [-1786.107] (-1802.985) (-1794.108) * (-1802.513) [-1794.793] (-1794.791) (-1784.866) -- 0:01:35
793500 -- (-1790.484) [-1791.795] (-1792.717) (-1790.110) * (-1789.736) (-1796.074) [-1794.448] (-1790.862) -- 0:01:35
794000 -- (-1794.511) [-1787.521] (-1794.768) (-1791.166) * (-1788.978) (-1799.213) [-1792.844] (-1787.902) -- 0:01:34
794500 -- (-1792.335) (-1803.452) (-1800.132) [-1792.806] * (-1786.590) (-1784.658) (-1784.479) [-1794.038] -- 0:01:34
795000 -- (-1792.829) (-1804.588) (-1784.205) [-1790.305] * (-1798.071) [-1787.591] (-1789.268) (-1789.747) -- 0:01:34
Average standard deviation of split frequencies: 0.005725
795500 -- (-1794.425) (-1806.804) (-1785.253) [-1789.944] * [-1783.710] (-1783.907) (-1796.946) (-1789.126) -- 0:01:34
796000 -- (-1789.737) [-1793.816] (-1790.318) (-1792.858) * (-1792.662) (-1794.271) (-1791.268) [-1790.493] -- 0:01:34
796500 -- (-1795.121) (-1797.997) (-1789.670) [-1786.891] * (-1788.603) (-1790.238) [-1784.481] (-1795.722) -- 0:01:33
797000 -- (-1791.900) (-1790.913) [-1788.441] (-1787.104) * (-1794.877) [-1791.515] (-1792.348) (-1797.803) -- 0:01:33
797500 -- (-1791.378) (-1791.961) (-1788.640) [-1789.327] * (-1792.550) (-1791.791) (-1795.591) [-1795.733] -- 0:01:33
798000 -- (-1788.181) [-1792.867] (-1791.860) (-1792.095) * (-1786.348) (-1786.517) [-1789.159] (-1791.086) -- 0:01:33
798500 -- [-1798.050] (-1786.357) (-1801.678) (-1795.958) * [-1786.484] (-1793.496) (-1798.820) (-1794.639) -- 0:01:32
799000 -- [-1785.168] (-1791.056) (-1798.904) (-1800.080) * (-1792.711) (-1791.123) [-1798.778] (-1793.592) -- 0:01:32
799500 -- [-1793.328] (-1798.938) (-1790.754) (-1786.794) * (-1788.342) (-1789.281) (-1795.840) [-1790.563] -- 0:01:32
800000 -- (-1787.908) (-1788.499) [-1790.943] (-1793.538) * (-1798.141) (-1796.807) [-1797.193] (-1800.783) -- 0:01:32
Average standard deviation of split frequencies: 0.005250
800500 -- (-1794.036) [-1794.101] (-1794.983) (-1792.273) * (-1789.455) (-1796.069) [-1792.746] (-1785.171) -- 0:01:31
801000 -- (-1792.594) (-1790.648) [-1784.513] (-1794.862) * (-1792.598) [-1788.694] (-1792.594) (-1786.385) -- 0:01:31
801500 -- (-1795.772) (-1788.725) [-1789.078] (-1799.955) * (-1794.283) [-1789.777] (-1788.003) (-1801.760) -- 0:01:31
802000 -- (-1790.069) (-1800.969) [-1786.756] (-1793.789) * (-1797.391) (-1798.121) (-1785.368) [-1786.418] -- 0:01:31
802500 -- (-1786.226) [-1789.738] (-1794.534) (-1793.892) * (-1787.697) (-1796.121) [-1797.137] (-1800.162) -- 0:01:31
803000 -- (-1785.977) [-1798.441] (-1796.767) (-1787.186) * (-1800.299) (-1796.127) [-1793.530] (-1804.103) -- 0:01:30
803500 -- (-1792.803) (-1793.882) (-1792.049) [-1796.339] * [-1791.141] (-1800.298) (-1800.640) (-1798.358) -- 0:01:30
804000 -- [-1789.190] (-1789.684) (-1790.433) (-1792.095) * (-1791.185) (-1803.140) (-1801.278) [-1798.609] -- 0:01:30
804500 -- [-1786.636] (-1796.078) (-1790.091) (-1798.061) * (-1792.553) [-1793.033] (-1787.540) (-1794.520) -- 0:01:30
805000 -- (-1786.742) (-1792.339) [-1792.338] (-1794.774) * (-1795.116) (-1797.354) [-1790.064] (-1793.751) -- 0:01:29
Average standard deviation of split frequencies: 0.005264
805500 -- (-1794.027) [-1788.205] (-1788.850) (-1808.600) * (-1789.290) (-1791.552) [-1791.147] (-1793.537) -- 0:01:29
806000 -- (-1791.625) [-1787.331] (-1793.713) (-1804.733) * (-1798.215) [-1793.265] (-1790.759) (-1794.310) -- 0:01:29
806500 -- (-1798.475) [-1789.712] (-1789.980) (-1788.287) * (-1798.009) (-1789.329) (-1793.265) [-1786.654] -- 0:01:29
807000 -- (-1794.555) [-1782.848] (-1788.917) (-1793.315) * [-1791.507] (-1797.869) (-1784.966) (-1791.575) -- 0:01:29
807500 -- [-1785.396] (-1795.047) (-1790.295) (-1780.908) * (-1787.910) (-1805.076) [-1799.883] (-1799.993) -- 0:01:28
808000 -- (-1795.920) [-1787.600] (-1788.930) (-1791.091) * (-1794.217) (-1802.890) [-1792.074] (-1789.718) -- 0:01:28
808500 -- (-1791.167) [-1791.221] (-1790.493) (-1792.071) * (-1787.744) (-1794.838) [-1789.399] (-1793.209) -- 0:01:28
809000 -- (-1788.474) (-1795.044) (-1803.626) [-1790.534] * [-1806.041] (-1800.492) (-1792.840) (-1788.661) -- 0:01:28
809500 -- (-1794.109) [-1787.895] (-1792.018) (-1795.903) * [-1788.975] (-1790.521) (-1790.270) (-1787.548) -- 0:01:28
810000 -- (-1795.081) [-1791.941] (-1791.989) (-1804.164) * (-1799.422) (-1791.111) (-1788.281) [-1792.519] -- 0:01:27
Average standard deviation of split frequencies: 0.004894
810500 -- (-1794.714) (-1784.767) (-1786.302) [-1790.104] * (-1793.921) (-1798.198) [-1789.790] (-1789.351) -- 0:01:27
811000 -- [-1788.133] (-1786.558) (-1787.152) (-1793.444) * (-1791.468) [-1789.268] (-1790.362) (-1790.385) -- 0:01:27
811500 -- (-1789.194) [-1788.934] (-1793.854) (-1789.535) * (-1797.219) [-1786.573] (-1790.001) (-1795.680) -- 0:01:27
812000 -- (-1800.560) (-1789.488) [-1786.806] (-1794.233) * [-1787.106] (-1793.206) (-1787.578) (-1792.247) -- 0:01:26
812500 -- (-1790.293) (-1801.550) [-1789.279] (-1791.401) * [-1785.893] (-1785.920) (-1799.994) (-1798.025) -- 0:01:26
813000 -- (-1792.652) (-1797.779) [-1785.998] (-1799.418) * (-1790.877) (-1788.206) [-1803.098] (-1797.349) -- 0:01:26
813500 -- (-1786.639) [-1786.523] (-1794.417) (-1797.002) * (-1805.334) (-1783.817) (-1798.328) [-1789.953] -- 0:01:26
814000 -- (-1790.672) (-1797.476) (-1785.590) [-1790.486] * (-1797.975) (-1781.848) (-1790.171) [-1786.852] -- 0:01:25
814500 -- (-1791.164) [-1793.158] (-1793.692) (-1788.490) * [-1788.355] (-1786.644) (-1789.779) (-1794.882) -- 0:01:25
815000 -- (-1790.514) (-1804.619) [-1785.360] (-1797.659) * (-1804.192) (-1787.793) (-1789.155) [-1792.214] -- 0:01:25
Average standard deviation of split frequencies: 0.004766
815500 -- (-1790.019) [-1791.722] (-1785.510) (-1792.759) * (-1796.026) (-1796.137) [-1791.420] (-1789.302) -- 0:01:25
816000 -- (-1789.751) (-1792.904) (-1796.439) [-1795.624] * (-1796.606) [-1789.572] (-1799.570) (-1807.099) -- 0:01:25
816500 -- (-1792.891) (-1795.015) [-1790.840] (-1792.815) * (-1793.864) [-1794.819] (-1788.739) (-1794.570) -- 0:01:24
817000 -- [-1787.120] (-1796.465) (-1785.658) (-1790.467) * (-1788.853) (-1787.329) [-1788.139] (-1791.861) -- 0:01:24
817500 -- (-1802.097) (-1792.405) (-1791.130) [-1785.247] * (-1786.242) [-1790.542] (-1786.991) (-1799.878) -- 0:01:24
818000 -- (-1795.848) (-1794.871) (-1792.915) [-1791.557] * (-1794.216) (-1785.791) [-1783.250] (-1789.917) -- 0:01:24
818500 -- (-1792.794) (-1803.798) (-1788.299) [-1784.330] * (-1796.199) [-1787.202] (-1788.320) (-1796.509) -- 0:01:23
819000 -- [-1791.927] (-1802.099) (-1787.840) (-1787.763) * (-1786.091) [-1787.161] (-1789.260) (-1792.351) -- 0:01:23
819500 -- (-1795.082) (-1800.128) [-1793.790] (-1798.063) * (-1795.382) [-1783.245] (-1789.420) (-1791.541) -- 0:01:23
820000 -- (-1787.793) (-1800.829) [-1789.206] (-1800.994) * (-1808.422) (-1789.848) [-1788.187] (-1796.588) -- 0:01:23
Average standard deviation of split frequencies: 0.004404
820500 -- (-1796.852) (-1799.035) [-1790.853] (-1796.498) * (-1796.809) (-1795.297) (-1789.679) [-1794.692] -- 0:01:22
821000 -- (-1792.718) (-1803.042) (-1792.276) [-1790.392] * [-1789.455] (-1783.965) (-1791.065) (-1789.745) -- 0:01:22
821500 -- (-1793.668) (-1787.729) [-1784.584] (-1793.864) * [-1793.774] (-1796.646) (-1784.656) (-1788.301) -- 0:01:22
822000 -- (-1801.725) [-1790.458] (-1796.650) (-1795.303) * (-1794.425) (-1788.166) (-1791.565) [-1789.503] -- 0:01:22
822500 -- [-1790.661] (-1790.997) (-1800.579) (-1789.738) * (-1797.791) (-1798.194) [-1792.174] (-1794.810) -- 0:01:22
823000 -- (-1793.011) (-1800.774) (-1795.017) [-1790.883] * [-1810.721] (-1802.758) (-1800.666) (-1784.753) -- 0:01:21
823500 -- (-1794.876) (-1807.976) (-1789.193) [-1790.535] * (-1794.664) (-1790.570) (-1799.046) [-1790.959] -- 0:01:21
824000 -- (-1790.291) (-1804.894) (-1794.624) [-1785.227] * (-1799.115) (-1799.786) [-1794.185] (-1789.100) -- 0:01:21
824500 -- [-1785.943] (-1792.392) (-1793.020) (-1785.477) * (-1790.600) (-1788.321) (-1792.699) [-1790.096] -- 0:01:21
825000 -- (-1791.874) (-1801.309) (-1798.006) [-1788.435] * (-1801.864) (-1792.532) [-1790.073] (-1791.337) -- 0:01:20
Average standard deviation of split frequencies: 0.004423
825500 -- (-1790.185) [-1788.590] (-1800.948) (-1797.387) * (-1793.890) (-1794.385) [-1792.345] (-1790.958) -- 0:01:20
826000 -- (-1796.392) [-1794.746] (-1789.313) (-1792.006) * (-1798.375) [-1797.160] (-1793.218) (-1797.746) -- 0:01:20
826500 -- (-1786.520) (-1791.571) [-1785.796] (-1788.044) * (-1793.493) (-1790.922) (-1789.276) [-1788.795] -- 0:01:20
827000 -- (-1791.877) (-1789.601) (-1790.925) [-1785.106] * [-1799.841] (-1792.634) (-1796.438) (-1794.552) -- 0:01:19
827500 -- (-1794.542) (-1793.237) [-1797.110] (-1797.169) * (-1792.124) (-1794.974) (-1798.670) [-1786.650] -- 0:01:19
828000 -- (-1800.213) [-1789.981] (-1790.510) (-1785.560) * (-1805.447) (-1796.673) [-1787.682] (-1791.537) -- 0:01:19
828500 -- (-1788.298) (-1788.866) (-1794.967) [-1791.196] * (-1795.157) (-1791.684) [-1791.056] (-1787.530) -- 0:01:19
829000 -- (-1797.425) (-1793.684) (-1789.664) [-1784.118] * (-1792.062) [-1790.577] (-1784.011) (-1799.558) -- 0:01:19
829500 -- (-1802.220) (-1793.648) [-1789.330] (-1797.313) * (-1797.109) [-1793.977] (-1792.243) (-1797.003) -- 0:01:18
830000 -- [-1792.195] (-1798.755) (-1785.061) (-1791.929) * [-1784.484] (-1798.744) (-1799.713) (-1788.119) -- 0:01:18
Average standard deviation of split frequencies: 0.004351
830500 -- [-1793.184] (-1795.347) (-1794.495) (-1793.946) * (-1790.896) [-1793.325] (-1790.270) (-1803.109) -- 0:01:18
831000 -- (-1790.577) (-1795.914) (-1790.252) [-1787.063] * [-1797.769] (-1793.595) (-1800.902) (-1782.726) -- 0:01:18
831500 -- (-1790.511) (-1797.552) (-1802.248) [-1784.143] * (-1793.939) [-1788.824] (-1793.435) (-1800.805) -- 0:01:17
832000 -- (-1789.982) (-1785.019) (-1792.233) [-1792.833] * (-1800.103) [-1784.557] (-1800.510) (-1794.964) -- 0:01:17
832500 -- (-1791.921) [-1793.664] (-1788.418) (-1793.042) * (-1795.302) (-1794.690) (-1804.181) [-1786.950] -- 0:01:17
833000 -- [-1789.070] (-1792.478) (-1791.804) (-1795.523) * (-1794.651) (-1786.145) [-1796.470] (-1795.392) -- 0:01:17
833500 -- (-1784.476) (-1796.712) [-1795.345] (-1790.532) * (-1797.968) (-1792.606) (-1789.151) [-1797.952] -- 0:01:16
834000 -- [-1788.103] (-1801.007) (-1795.950) (-1788.836) * (-1799.497) [-1789.324] (-1798.929) (-1795.556) -- 0:01:16
834500 -- (-1800.431) (-1800.246) [-1790.357] (-1788.677) * (-1806.571) [-1796.241] (-1793.563) (-1797.242) -- 0:01:16
835000 -- (-1788.593) (-1803.983) (-1790.802) [-1783.962] * (-1797.937) (-1799.476) (-1792.939) [-1793.908] -- 0:01:16
Average standard deviation of split frequencies: 0.004370
835500 -- (-1795.711) (-1790.958) [-1793.816] (-1790.907) * (-1799.698) [-1785.049] (-1795.729) (-1799.774) -- 0:01:15
836000 -- [-1786.419] (-1792.064) (-1798.276) (-1789.385) * (-1790.435) (-1798.357) (-1792.562) [-1786.132] -- 0:01:15
836500 -- [-1790.750] (-1801.527) (-1794.684) (-1791.782) * (-1794.791) (-1788.724) [-1791.187] (-1791.109) -- 0:01:15
837000 -- (-1783.892) [-1792.056] (-1794.553) (-1798.014) * [-1788.205] (-1792.879) (-1801.352) (-1796.241) -- 0:01:15
837500 -- [-1794.516] (-1798.711) (-1785.765) (-1791.603) * (-1787.053) [-1794.066] (-1786.009) (-1791.211) -- 0:01:15
838000 -- [-1789.289] (-1786.022) (-1796.676) (-1792.408) * (-1786.813) (-1790.300) [-1790.192] (-1793.848) -- 0:01:14
838500 -- (-1803.222) [-1788.082] (-1789.290) (-1792.455) * (-1792.552) (-1789.119) (-1786.612) [-1787.765] -- 0:01:14
839000 -- [-1795.145] (-1791.895) (-1790.392) (-1796.018) * [-1797.200] (-1793.314) (-1808.706) (-1788.545) -- 0:01:14
839500 -- (-1801.769) (-1794.065) [-1801.506] (-1792.346) * (-1788.303) (-1802.020) (-1792.292) [-1792.013] -- 0:01:14
840000 -- (-1803.202) (-1789.449) (-1788.776) [-1792.661] * [-1790.127] (-1794.157) (-1795.316) (-1790.871) -- 0:01:13
Average standard deviation of split frequencies: 0.004112
840500 -- (-1816.672) (-1792.259) [-1790.494] (-1794.086) * [-1792.408] (-1787.148) (-1798.966) (-1794.361) -- 0:01:13
841000 -- (-1797.214) (-1792.872) (-1795.347) [-1785.718] * (-1784.867) (-1798.584) [-1788.658] (-1790.046) -- 0:01:13
841500 -- (-1785.740) (-1794.049) (-1787.240) [-1786.348] * [-1792.948] (-1786.142) (-1793.034) (-1790.502) -- 0:01:13
842000 -- (-1795.909) (-1796.067) [-1795.342] (-1790.338) * (-1793.685) (-1797.087) [-1791.054] (-1793.323) -- 0:01:12
842500 -- (-1790.690) (-1799.624) (-1797.340) [-1796.734] * (-1789.003) (-1794.623) [-1793.515] (-1793.761) -- 0:01:12
843000 -- (-1799.661) [-1787.190] (-1801.724) (-1795.777) * (-1791.707) [-1787.162] (-1794.734) (-1788.937) -- 0:01:12
843500 -- (-1794.898) (-1795.902) [-1790.164] (-1800.606) * (-1797.354) (-1788.795) [-1786.860] (-1793.872) -- 0:01:12
844000 -- (-1784.045) (-1791.551) [-1786.964] (-1792.522) * (-1793.698) (-1784.558) (-1792.548) [-1793.966] -- 0:01:12
844500 -- (-1790.395) (-1785.143) (-1795.728) [-1790.128] * [-1798.205] (-1787.605) (-1790.469) (-1795.697) -- 0:01:11
845000 -- (-1794.621) [-1789.104] (-1792.491) (-1796.368) * [-1787.043] (-1797.577) (-1800.182) (-1797.534) -- 0:01:11
Average standard deviation of split frequencies: 0.003947
845500 -- (-1793.281) (-1802.185) [-1787.512] (-1789.428) * [-1797.104] (-1790.390) (-1798.669) (-1790.007) -- 0:01:11
846000 -- (-1807.864) (-1794.075) (-1794.239) [-1797.579] * (-1787.721) (-1798.685) [-1784.129] (-1793.511) -- 0:01:10
846500 -- [-1789.489] (-1788.146) (-1794.629) (-1798.010) * (-1791.517) [-1786.507] (-1795.085) (-1802.075) -- 0:01:10
847000 -- (-1796.473) [-1779.645] (-1800.580) (-1805.497) * [-1788.427] (-1797.396) (-1792.737) (-1802.739) -- 0:01:10
847500 -- (-1798.911) (-1795.088) [-1789.031] (-1792.838) * [-1794.140] (-1804.206) (-1790.718) (-1792.773) -- 0:01:10
848000 -- (-1794.064) (-1797.373) (-1787.036) [-1797.394] * (-1787.279) (-1804.181) (-1789.626) [-1783.036] -- 0:01:10
848500 -- (-1795.196) [-1787.152] (-1797.533) (-1797.541) * (-1795.407) (-1792.306) (-1792.312) [-1786.898] -- 0:01:09
849000 -- [-1790.032] (-1793.906) (-1799.076) (-1798.303) * (-1797.132) (-1804.266) (-1789.314) [-1785.170] -- 0:01:09
849500 -- (-1789.061) [-1792.516] (-1788.464) (-1798.866) * [-1796.314] (-1801.072) (-1800.404) (-1786.636) -- 0:01:09
850000 -- (-1798.249) (-1791.683) (-1796.188) [-1791.105] * (-1796.863) (-1792.814) (-1786.633) [-1789.716] -- 0:01:09
Average standard deviation of split frequencies: 0.004156
850500 -- (-1794.764) [-1789.800] (-1793.109) (-1789.667) * (-1792.327) (-1794.182) (-1796.588) [-1795.506] -- 0:01:09
851000 -- (-1794.968) (-1785.484) [-1796.202] (-1791.160) * (-1801.891) [-1787.669] (-1793.684) (-1788.187) -- 0:01:08
851500 -- (-1799.983) (-1793.443) (-1787.332) [-1786.136] * (-1798.134) (-1798.015) (-1792.895) [-1784.963] -- 0:01:08
852000 -- (-1792.383) (-1793.943) (-1786.357) [-1788.657] * (-1804.544) (-1790.669) [-1791.421] (-1795.328) -- 0:01:08
852500 -- [-1793.509] (-1792.629) (-1787.747) (-1792.853) * (-1803.334) [-1786.026] (-1796.112) (-1793.132) -- 0:01:07
853000 -- (-1795.837) [-1783.286] (-1792.717) (-1799.106) * [-1794.326] (-1801.070) (-1793.977) (-1805.681) -- 0:01:07
853500 -- (-1790.342) (-1790.477) [-1787.873] (-1794.926) * [-1787.614] (-1795.308) (-1786.320) (-1798.374) -- 0:01:07
854000 -- (-1798.664) (-1795.226) (-1791.001) [-1792.273] * (-1789.281) [-1790.896] (-1800.708) (-1795.631) -- 0:01:07
854500 -- (-1797.575) (-1794.207) [-1789.682] (-1793.073) * (-1799.084) (-1797.918) [-1794.200] (-1790.455) -- 0:01:07
855000 -- (-1790.558) (-1796.353) (-1795.799) [-1788.722] * (-1793.600) [-1789.572] (-1801.863) (-1791.576) -- 0:01:06
Average standard deviation of split frequencies: 0.003809
855500 -- [-1782.379] (-1791.493) (-1800.990) (-1790.152) * (-1790.393) (-1790.656) [-1785.717] (-1795.861) -- 0:01:06
856000 -- [-1794.201] (-1789.929) (-1797.741) (-1795.444) * (-1790.385) [-1788.145] (-1793.184) (-1801.037) -- 0:01:06
856500 -- [-1790.179] (-1797.132) (-1800.417) (-1793.705) * (-1785.731) [-1794.315] (-1799.714) (-1801.223) -- 0:01:06
857000 -- (-1791.841) [-1785.801] (-1789.155) (-1793.914) * (-1795.289) [-1792.643] (-1792.446) (-1785.181) -- 0:01:05
857500 -- (-1796.071) (-1796.749) (-1794.252) [-1784.631] * [-1790.260] (-1799.866) (-1800.913) (-1785.031) -- 0:01:05
858000 -- (-1790.292) (-1793.263) (-1796.140) [-1792.718] * (-1785.779) (-1792.974) [-1789.155] (-1789.889) -- 0:01:05
858500 -- (-1789.927) (-1799.074) [-1796.023] (-1788.390) * (-1791.175) (-1795.545) [-1796.938] (-1790.040) -- 0:01:05
859000 -- [-1790.014] (-1792.261) (-1793.043) (-1789.338) * (-1796.813) (-1789.126) [-1790.547] (-1787.903) -- 0:01:05
859500 -- (-1786.765) (-1795.348) (-1792.441) [-1794.775] * (-1793.679) (-1802.741) (-1793.829) [-1793.185] -- 0:01:04
860000 -- [-1788.827] (-1803.422) (-1801.017) (-1785.759) * [-1789.164] (-1794.165) (-1789.607) (-1799.224) -- 0:01:04
Average standard deviation of split frequencies: 0.004199
860500 -- (-1790.932) (-1790.185) (-1808.319) [-1791.483] * (-1793.678) (-1792.249) (-1790.031) [-1797.450] -- 0:01:04
861000 -- (-1787.478) (-1787.432) (-1789.036) [-1786.480] * (-1786.911) [-1797.127] (-1798.437) (-1798.276) -- 0:01:04
861500 -- (-1799.112) [-1790.293] (-1815.437) (-1785.893) * [-1794.694] (-1796.082) (-1794.924) (-1802.608) -- 0:01:03
862000 -- (-1797.236) [-1794.849] (-1802.043) (-1790.143) * [-1790.411] (-1790.583) (-1788.543) (-1787.345) -- 0:01:03
862500 -- (-1788.322) (-1793.810) (-1792.343) [-1791.087] * (-1790.737) [-1789.306] (-1803.363) (-1788.049) -- 0:01:03
863000 -- (-1800.417) [-1789.251] (-1790.887) (-1793.933) * (-1795.869) (-1797.303) [-1789.145] (-1795.220) -- 0:01:03
863500 -- (-1789.992) (-1798.121) [-1786.916] (-1795.671) * (-1797.913) [-1800.168] (-1787.220) (-1796.366) -- 0:01:02
864000 -- (-1790.348) (-1794.971) (-1788.148) [-1785.550] * (-1795.135) [-1792.139] (-1796.787) (-1797.822) -- 0:01:02
864500 -- (-1789.062) (-1802.460) [-1791.064] (-1792.526) * (-1805.950) (-1787.169) (-1800.508) [-1793.928] -- 0:01:02
865000 -- (-1786.161) (-1791.312) [-1793.411] (-1788.132) * (-1795.684) (-1796.765) [-1792.342] (-1791.361) -- 0:01:02
Average standard deviation of split frequencies: 0.004491
865500 -- [-1797.418] (-1790.764) (-1792.331) (-1795.122) * (-1796.338) [-1788.374] (-1795.570) (-1790.755) -- 0:01:02
866000 -- (-1791.843) [-1787.000] (-1787.985) (-1803.255) * (-1793.982) (-1796.357) (-1797.355) [-1787.995] -- 0:01:01
866500 -- [-1790.716] (-1798.292) (-1811.772) (-1794.948) * (-1798.889) (-1795.866) (-1795.981) [-1786.272] -- 0:01:01
867000 -- (-1786.651) [-1790.424] (-1799.108) (-1801.037) * (-1788.789) [-1796.551] (-1793.098) (-1795.723) -- 0:01:01
867500 -- [-1789.666] (-1791.661) (-1791.392) (-1795.877) * (-1792.467) (-1791.688) [-1791.337] (-1791.137) -- 0:01:01
868000 -- (-1787.506) [-1785.854] (-1788.934) (-1792.610) * (-1803.078) (-1788.270) (-1792.750) [-1792.805] -- 0:01:00
868500 -- (-1790.563) [-1801.884] (-1791.156) (-1800.510) * (-1796.234) (-1785.885) (-1789.445) [-1795.410] -- 0:01:00
869000 -- [-1795.525] (-1798.744) (-1794.469) (-1797.334) * (-1787.430) (-1795.942) (-1790.678) [-1784.643] -- 0:01:00
869500 -- [-1793.222] (-1802.362) (-1796.028) (-1805.270) * (-1795.026) (-1796.262) [-1787.293] (-1787.804) -- 0:01:00
870000 -- [-1791.899] (-1800.598) (-1796.789) (-1796.667) * (-1796.381) (-1792.368) (-1788.614) [-1785.311] -- 0:00:59
Average standard deviation of split frequencies: 0.003835
870500 -- (-1796.515) (-1797.169) (-1797.315) [-1790.886] * (-1794.053) [-1792.947] (-1790.297) (-1795.658) -- 0:00:59
871000 -- (-1790.115) [-1790.045] (-1792.607) (-1791.682) * (-1789.063) (-1795.956) (-1797.980) [-1792.409] -- 0:00:59
871500 -- (-1787.972) (-1790.138) [-1787.587] (-1793.670) * (-1789.144) (-1793.950) (-1800.963) [-1794.045] -- 0:00:59
872000 -- (-1791.029) (-1797.913) (-1796.794) [-1788.349] * (-1790.249) (-1798.563) [-1788.864] (-1799.484) -- 0:00:59
872500 -- [-1789.794] (-1789.111) (-1794.550) (-1794.964) * (-1793.151) (-1800.656) (-1791.630) [-1790.350] -- 0:00:58
873000 -- (-1795.969) (-1792.725) (-1792.451) [-1791.789] * (-1795.873) [-1788.310] (-1792.300) (-1791.019) -- 0:00:58
873500 -- (-1795.030) (-1797.043) (-1785.909) [-1792.862] * (-1791.442) (-1787.290) [-1794.937] (-1788.717) -- 0:00:58
874000 -- [-1789.482] (-1796.697) (-1788.962) (-1793.658) * [-1783.885] (-1793.426) (-1790.803) (-1791.029) -- 0:00:58
874500 -- [-1788.326] (-1804.472) (-1792.840) (-1793.270) * (-1787.207) (-1795.219) [-1790.835] (-1796.253) -- 0:00:57
875000 -- (-1787.260) (-1796.988) (-1799.122) [-1794.554] * [-1785.944] (-1791.258) (-1789.628) (-1791.649) -- 0:00:57
Average standard deviation of split frequencies: 0.004215
875500 -- (-1789.375) (-1790.617) [-1786.195] (-1790.883) * (-1788.015) (-1793.627) (-1800.932) [-1788.694] -- 0:00:57
876000 -- (-1790.817) [-1789.732] (-1788.955) (-1790.762) * (-1787.114) [-1790.485] (-1794.104) (-1794.752) -- 0:00:57
876500 -- [-1799.041] (-1790.619) (-1784.573) (-1788.464) * (-1798.712) (-1794.233) (-1795.008) [-1786.756] -- 0:00:56
877000 -- (-1791.772) (-1792.040) (-1793.481) [-1792.242] * [-1790.738] (-1796.293) (-1797.782) (-1790.338) -- 0:00:56
877500 -- (-1798.799) (-1790.538) (-1791.651) [-1784.945] * (-1792.766) (-1794.194) [-1789.413] (-1787.907) -- 0:00:56
878000 -- (-1799.488) [-1790.599] (-1799.625) (-1795.231) * (-1790.321) (-1791.665) [-1788.768] (-1794.714) -- 0:00:56
878500 -- (-1788.124) (-1786.734) [-1796.373] (-1792.993) * [-1788.001] (-1802.299) (-1787.254) (-1787.085) -- 0:00:56
879000 -- (-1794.570) (-1786.634) (-1789.375) [-1788.511] * (-1789.675) (-1791.477) (-1794.006) [-1790.494] -- 0:00:55
879500 -- (-1794.987) [-1790.925] (-1796.128) (-1788.622) * [-1791.290] (-1791.617) (-1798.013) (-1791.624) -- 0:00:55
880000 -- (-1802.992) [-1796.097] (-1797.678) (-1791.808) * (-1790.282) [-1792.438] (-1794.480) (-1792.770) -- 0:00:55
Average standard deviation of split frequencies: 0.004104
880500 -- (-1790.383) (-1799.370) [-1788.545] (-1792.806) * [-1786.653] (-1787.507) (-1796.366) (-1799.953) -- 0:00:55
881000 -- (-1787.382) (-1795.517) (-1794.991) [-1784.885] * (-1788.412) (-1787.235) (-1795.751) [-1787.571] -- 0:00:54
881500 -- (-1787.304) (-1789.164) (-1794.529) [-1791.008] * (-1794.970) (-1791.738) (-1792.801) [-1791.089] -- 0:00:54
882000 -- (-1793.286) (-1787.144) [-1789.708] (-1795.022) * (-1794.708) (-1790.642) [-1791.928] (-1802.216) -- 0:00:54
882500 -- [-1784.432] (-1785.755) (-1788.981) (-1799.416) * (-1792.650) [-1791.494] (-1797.587) (-1791.360) -- 0:00:54
883000 -- (-1801.242) (-1789.267) (-1794.238) [-1796.116] * (-1791.759) (-1793.730) (-1789.844) [-1787.177] -- 0:00:53
883500 -- (-1794.536) [-1785.979] (-1799.172) (-1797.753) * (-1787.453) (-1791.439) [-1787.417] (-1787.584) -- 0:00:53
884000 -- (-1803.379) [-1795.057] (-1802.744) (-1793.727) * (-1794.749) (-1786.977) (-1797.398) [-1788.395] -- 0:00:53
884500 -- [-1796.126] (-1797.864) (-1793.979) (-1796.627) * (-1789.107) (-1796.364) [-1789.777] (-1785.104) -- 0:00:53
885000 -- (-1800.741) [-1794.431] (-1801.719) (-1788.064) * (-1783.070) [-1794.793] (-1797.732) (-1797.473) -- 0:00:53
Average standard deviation of split frequencies: 0.004123
885500 -- (-1791.125) [-1789.639] (-1789.909) (-1791.866) * [-1792.213] (-1800.471) (-1788.883) (-1794.250) -- 0:00:52
886000 -- [-1784.733] (-1789.190) (-1790.021) (-1787.539) * (-1813.309) (-1786.986) [-1791.306] (-1787.643) -- 0:00:52
886500 -- (-1795.772) (-1791.666) [-1791.343] (-1793.763) * (-1788.205) (-1797.462) [-1793.695] (-1790.892) -- 0:00:52
887000 -- (-1793.479) (-1797.466) [-1796.228] (-1795.031) * (-1806.886) (-1789.587) [-1790.727] (-1788.674) -- 0:00:52
887500 -- (-1794.807) [-1793.359] (-1792.707) (-1787.419) * (-1796.465) [-1787.383] (-1788.776) (-1788.203) -- 0:00:51
888000 -- [-1783.871] (-1789.641) (-1797.822) (-1803.221) * (-1793.508) [-1793.289] (-1802.267) (-1786.732) -- 0:00:51
888500 -- [-1785.244] (-1799.443) (-1793.004) (-1792.806) * (-1786.490) (-1795.634) [-1789.077] (-1789.604) -- 0:00:51
889000 -- (-1793.486) (-1790.078) [-1794.320] (-1788.724) * (-1800.593) (-1789.534) (-1790.474) [-1787.677] -- 0:00:51
889500 -- (-1783.300) [-1787.433] (-1802.626) (-1793.825) * (-1792.761) (-1799.205) (-1793.707) [-1791.398] -- 0:00:50
890000 -- (-1790.138) (-1791.794) (-1790.821) [-1796.772] * [-1787.098] (-1793.653) (-1790.578) (-1788.524) -- 0:00:50
Average standard deviation of split frequencies: 0.004190
890500 -- [-1783.417] (-1792.282) (-1795.968) (-1798.205) * (-1784.538) [-1799.508] (-1803.355) (-1804.989) -- 0:00:50
891000 -- (-1795.663) (-1797.727) (-1792.045) [-1787.538] * (-1792.188) [-1784.848] (-1787.065) (-1788.516) -- 0:00:50
891500 -- [-1794.647] (-1794.500) (-1800.783) (-1791.552) * (-1784.299) [-1791.880] (-1785.587) (-1794.187) -- 0:00:50
892000 -- (-1795.033) (-1788.294) [-1792.814] (-1786.801) * (-1794.147) (-1793.392) (-1787.836) [-1804.642] -- 0:00:49
892500 -- (-1792.500) (-1788.599) [-1789.694] (-1798.187) * (-1794.404) (-1790.766) (-1795.807) [-1793.081] -- 0:00:49
893000 -- (-1798.008) [-1793.716] (-1799.321) (-1801.206) * (-1792.529) [-1786.826] (-1792.606) (-1793.341) -- 0:00:49
893500 -- (-1791.181) (-1793.938) (-1801.139) [-1789.512] * (-1796.520) (-1791.718) [-1789.610] (-1791.434) -- 0:00:49
894000 -- (-1804.130) (-1793.337) [-1792.422] (-1793.202) * [-1792.269] (-1796.889) (-1789.104) (-1799.532) -- 0:00:48
894500 -- (-1790.941) (-1801.070) (-1792.684) [-1791.006] * [-1790.858] (-1793.745) (-1790.141) (-1785.660) -- 0:00:48
895000 -- (-1795.045) (-1800.771) (-1791.560) [-1792.746] * (-1790.866) (-1801.247) [-1784.872] (-1798.502) -- 0:00:48
Average standard deviation of split frequencies: 0.004034
895500 -- (-1785.961) (-1788.193) (-1790.907) [-1790.283] * (-1800.237) [-1788.694] (-1793.304) (-1790.713) -- 0:00:48
896000 -- (-1783.749) (-1802.846) [-1789.421] (-1789.419) * (-1793.635) [-1793.920] (-1787.867) (-1797.322) -- 0:00:47
896500 -- [-1787.113] (-1792.976) (-1788.885) (-1800.000) * (-1790.078) (-1792.041) (-1785.592) [-1788.938] -- 0:00:47
897000 -- (-1791.522) (-1802.615) [-1793.611] (-1802.325) * (-1791.957) [-1790.562] (-1788.808) (-1789.145) -- 0:00:47
897500 -- [-1787.539] (-1786.681) (-1789.434) (-1800.079) * (-1792.237) (-1794.352) (-1788.372) [-1788.116] -- 0:00:47
898000 -- (-1789.866) (-1789.936) [-1789.136] (-1791.748) * (-1811.060) [-1792.797] (-1787.911) (-1792.545) -- 0:00:47
898500 -- (-1796.382) (-1790.921) (-1784.249) [-1792.560] * [-1789.205] (-1788.074) (-1789.714) (-1793.054) -- 0:00:46
899000 -- (-1792.808) (-1791.043) (-1793.375) [-1788.911] * (-1788.443) (-1790.510) (-1789.970) [-1792.143] -- 0:00:46
899500 -- (-1786.752) (-1789.844) [-1792.590] (-1791.993) * (-1792.195) [-1787.095] (-1790.258) (-1789.041) -- 0:00:46
900000 -- (-1788.507) (-1799.634) (-1795.254) [-1787.313] * (-1785.621) (-1788.590) [-1793.420] (-1793.498) -- 0:00:46
Average standard deviation of split frequencies: 0.003707
900500 -- (-1800.697) (-1790.752) [-1790.058] (-1786.399) * (-1797.687) (-1794.064) (-1792.618) [-1791.924] -- 0:00:45
901000 -- (-1795.475) [-1798.675] (-1791.260) (-1796.838) * (-1795.259) [-1787.919] (-1794.199) (-1788.644) -- 0:00:45
901500 -- (-1791.254) (-1793.554) (-1789.706) [-1789.036] * [-1789.069] (-1792.586) (-1797.679) (-1794.804) -- 0:00:45
902000 -- (-1789.039) (-1795.002) [-1789.077] (-1798.014) * (-1784.840) (-1800.073) (-1798.480) [-1790.969] -- 0:00:45
902500 -- (-1787.592) [-1797.222] (-1788.562) (-1793.841) * [-1787.696] (-1799.873) (-1792.961) (-1788.618) -- 0:00:44
903000 -- (-1797.182) [-1785.510] (-1784.371) (-1789.419) * (-1800.328) (-1805.931) [-1791.955] (-1792.966) -- 0:00:44
903500 -- [-1785.924] (-1793.925) (-1794.682) (-1806.192) * [-1791.825] (-1795.453) (-1789.215) (-1785.821) -- 0:00:44
904000 -- [-1790.845] (-1794.813) (-1789.201) (-1788.824) * (-1801.317) (-1791.766) [-1789.580] (-1785.936) -- 0:00:44
904500 -- (-1793.496) (-1789.267) (-1793.632) [-1799.793] * (-1787.330) (-1789.909) [-1781.203] (-1789.489) -- 0:00:44
905000 -- [-1792.726] (-1795.944) (-1805.739) (-1789.249) * (-1791.546) (-1786.291) (-1798.532) [-1791.718] -- 0:00:43
Average standard deviation of split frequencies: 0.003946
905500 -- (-1793.649) (-1790.842) (-1797.671) [-1786.529] * (-1788.928) (-1789.647) (-1800.977) [-1786.966] -- 0:00:43
906000 -- (-1795.116) (-1798.573) (-1788.798) [-1787.962] * (-1793.390) (-1791.049) [-1793.088] (-1800.189) -- 0:00:43
906500 -- (-1792.480) (-1799.048) (-1801.036) [-1788.893] * (-1793.404) (-1789.330) (-1789.924) [-1786.857] -- 0:00:43
907000 -- (-1786.770) (-1787.656) [-1793.601] (-1793.033) * (-1791.247) (-1792.497) (-1798.817) [-1783.672] -- 0:00:42
907500 -- (-1786.840) [-1784.566] (-1797.331) (-1787.786) * [-1796.024] (-1790.121) (-1799.493) (-1784.028) -- 0:00:42
908000 -- (-1793.413) (-1796.643) [-1786.135] (-1792.186) * (-1794.585) (-1786.720) [-1787.813] (-1796.572) -- 0:00:42
908500 -- (-1793.511) (-1787.562) (-1792.473) [-1791.226] * (-1789.246) [-1787.313] (-1790.948) (-1784.209) -- 0:00:42
909000 -- (-1789.694) (-1792.284) [-1788.224] (-1783.940) * [-1787.800] (-1790.153) (-1792.843) (-1801.601) -- 0:00:41
909500 -- (-1790.568) (-1787.366) (-1798.560) [-1785.696] * (-1792.817) [-1792.950] (-1795.393) (-1800.093) -- 0:00:41
910000 -- (-1793.437) [-1795.749] (-1792.958) (-1788.885) * (-1790.341) (-1790.730) [-1789.599] (-1787.675) -- 0:00:41
Average standard deviation of split frequencies: 0.004098
910500 -- (-1786.667) [-1785.101] (-1789.750) (-1795.339) * [-1795.251] (-1806.840) (-1788.615) (-1794.378) -- 0:00:41
911000 -- (-1789.394) [-1788.876] (-1792.146) (-1793.211) * [-1787.028] (-1787.650) (-1790.334) (-1791.397) -- 0:00:41
911500 -- (-1787.893) [-1788.666] (-1789.762) (-1793.569) * (-1793.104) (-1788.684) [-1788.206] (-1783.646) -- 0:00:40
912000 -- (-1794.362) [-1786.304] (-1798.517) (-1788.314) * (-1793.111) [-1788.306] (-1789.281) (-1792.517) -- 0:00:40
912500 -- (-1789.102) (-1788.044) [-1792.979] (-1800.391) * (-1792.891) (-1790.283) (-1789.367) [-1792.452] -- 0:00:40
913000 -- [-1787.265] (-1806.892) (-1792.495) (-1801.027) * (-1800.859) (-1792.665) [-1787.641] (-1791.932) -- 0:00:40
913500 -- (-1788.344) (-1785.793) (-1790.517) [-1792.913] * (-1808.130) (-1791.488) (-1799.329) [-1790.191] -- 0:00:39
914000 -- (-1792.493) [-1788.123] (-1792.148) (-1794.332) * [-1794.418] (-1794.306) (-1790.879) (-1792.276) -- 0:00:39
914500 -- [-1790.964] (-1792.512) (-1800.804) (-1798.253) * (-1791.332) (-1792.926) (-1790.227) [-1790.473] -- 0:00:39
915000 -- (-1794.521) [-1798.104] (-1790.223) (-1801.932) * (-1800.266) (-1795.779) [-1798.401] (-1792.295) -- 0:00:39
Average standard deviation of split frequencies: 0.004332
915500 -- (-1791.586) [-1796.040] (-1801.218) (-1814.217) * (-1800.348) (-1793.768) [-1789.042] (-1790.458) -- 0:00:38
916000 -- (-1797.737) (-1802.330) [-1796.243] (-1788.913) * (-1791.096) (-1790.986) (-1801.014) [-1786.344] -- 0:00:38
916500 -- (-1788.461) (-1813.122) [-1790.208] (-1792.252) * (-1789.784) (-1804.046) (-1793.460) [-1795.744] -- 0:00:38
917000 -- (-1792.047) [-1791.400] (-1783.002) (-1798.824) * (-1795.534) (-1799.698) (-1789.175) [-1792.404] -- 0:00:38
917500 -- (-1794.381) (-1790.564) [-1786.034] (-1797.140) * (-1797.744) (-1793.845) (-1785.295) [-1784.343] -- 0:00:38
918000 -- (-1785.991) (-1802.564) [-1786.035] (-1798.620) * (-1790.410) (-1795.310) [-1791.018] (-1794.849) -- 0:00:37
918500 -- (-1792.549) (-1789.946) [-1788.202] (-1794.862) * (-1795.820) [-1800.831] (-1785.209) (-1792.819) -- 0:00:37
919000 -- (-1795.682) (-1797.814) [-1783.743] (-1794.796) * (-1796.877) [-1788.058] (-1805.197) (-1792.424) -- 0:00:37
919500 -- [-1796.031] (-1789.644) (-1794.401) (-1790.392) * (-1797.355) [-1795.163] (-1788.142) (-1796.683) -- 0:00:37
920000 -- (-1786.261) (-1796.592) [-1786.345] (-1788.769) * [-1790.933] (-1795.983) (-1793.755) (-1793.592) -- 0:00:36
Average standard deviation of split frequencies: 0.004566
920500 -- (-1793.308) [-1795.127] (-1790.734) (-1789.325) * [-1791.679] (-1788.310) (-1792.317) (-1795.440) -- 0:00:36
921000 -- (-1805.716) (-1794.581) [-1789.646] (-1795.678) * (-1793.276) [-1788.537] (-1794.432) (-1791.488) -- 0:00:36
921500 -- (-1795.010) [-1785.741] (-1795.190) (-1802.462) * (-1795.780) (-1798.686) (-1791.879) [-1790.735] -- 0:00:36
922000 -- [-1799.866] (-1795.632) (-1788.526) (-1794.206) * (-1799.768) (-1791.667) (-1793.696) [-1799.224] -- 0:00:35
922500 -- (-1790.164) (-1785.315) (-1795.847) [-1795.528] * (-1792.899) [-1784.485] (-1789.198) (-1794.777) -- 0:00:35
923000 -- [-1794.759] (-1792.173) (-1802.348) (-1787.352) * [-1788.377] (-1790.990) (-1791.470) (-1793.929) -- 0:00:35
923500 -- (-1791.367) (-1802.124) [-1791.233] (-1794.653) * (-1798.915) (-1788.394) [-1790.711] (-1786.464) -- 0:00:35
924000 -- (-1792.236) [-1788.573] (-1787.977) (-1785.944) * (-1798.520) (-1789.878) [-1790.924] (-1785.678) -- 0:00:35
924500 -- (-1794.927) (-1793.698) (-1791.484) [-1787.137] * (-1789.694) [-1795.495] (-1792.771) (-1793.251) -- 0:00:34
925000 -- (-1794.789) (-1792.017) (-1792.850) [-1786.795] * (-1794.152) (-1795.587) [-1789.892] (-1791.396) -- 0:00:34
Average standard deviation of split frequencies: 0.004624
925500 -- (-1794.354) (-1787.139) (-1795.829) [-1786.356] * (-1788.042) [-1794.458] (-1791.900) (-1790.158) -- 0:00:34
926000 -- (-1792.387) (-1789.278) [-1793.462] (-1788.623) * (-1794.386) (-1795.211) [-1782.195] (-1797.847) -- 0:00:34
926500 -- [-1799.339] (-1788.872) (-1787.598) (-1801.412) * (-1798.273) (-1791.067) (-1787.799) [-1794.300] -- 0:00:33
927000 -- (-1801.739) (-1786.814) [-1790.844] (-1793.232) * (-1799.499) (-1793.482) [-1783.750] (-1801.531) -- 0:00:33
927500 -- (-1797.061) (-1795.937) (-1794.128) [-1795.847] * [-1784.131] (-1793.427) (-1796.433) (-1792.483) -- 0:00:33
928000 -- (-1794.066) [-1790.082] (-1788.982) (-1787.734) * (-1789.958) [-1790.879] (-1802.750) (-1797.401) -- 0:00:33
928500 -- (-1796.848) [-1792.472] (-1791.916) (-1791.593) * (-1794.497) [-1789.378] (-1793.157) (-1792.493) -- 0:00:32
929000 -- (-1794.178) (-1793.703) (-1792.058) [-1792.346] * (-1790.562) [-1789.396] (-1793.928) (-1796.489) -- 0:00:32
929500 -- (-1802.071) (-1794.643) (-1791.190) [-1792.546] * (-1802.369) (-1793.939) (-1794.855) [-1785.046] -- 0:00:32
930000 -- (-1798.894) (-1794.157) [-1793.286] (-1785.238) * (-1791.303) (-1790.289) [-1792.644] (-1795.990) -- 0:00:32
Average standard deviation of split frequencies: 0.004221
930500 -- [-1790.784] (-1798.041) (-1796.928) (-1795.573) * (-1789.602) [-1792.232] (-1802.560) (-1804.159) -- 0:00:32
931000 -- (-1799.318) (-1801.380) (-1797.179) [-1796.316] * (-1792.525) (-1793.503) [-1788.396] (-1787.923) -- 0:00:31
931500 -- [-1790.114] (-1794.972) (-1796.326) (-1801.887) * (-1789.913) (-1790.959) [-1798.783] (-1795.513) -- 0:00:31
932000 -- (-1789.871) (-1794.833) (-1795.168) [-1795.637] * (-1791.141) (-1787.581) (-1804.813) [-1791.487] -- 0:00:31
932500 -- (-1790.652) [-1798.951] (-1791.188) (-1800.923) * [-1792.160] (-1791.272) (-1796.129) (-1795.693) -- 0:00:31
933000 -- [-1791.292] (-1791.707) (-1791.304) (-1791.044) * [-1779.812] (-1791.154) (-1797.125) (-1792.435) -- 0:00:30
933500 -- (-1791.624) [-1790.941] (-1791.133) (-1791.105) * (-1797.161) [-1789.878] (-1796.812) (-1790.096) -- 0:00:30
934000 -- (-1794.754) [-1789.951] (-1799.695) (-1795.052) * [-1785.876] (-1794.518) (-1791.638) (-1795.057) -- 0:00:30
934500 -- (-1785.277) (-1789.410) [-1795.038] (-1791.169) * (-1793.059) (-1791.736) [-1788.366] (-1808.738) -- 0:00:30
935000 -- [-1788.470] (-1785.034) (-1787.373) (-1798.042) * (-1794.531) (-1790.642) [-1783.154] (-1805.858) -- 0:00:29
Average standard deviation of split frequencies: 0.004407
935500 -- (-1792.938) [-1788.467] (-1794.354) (-1787.205) * (-1800.666) (-1798.364) [-1787.264] (-1806.441) -- 0:00:29
936000 -- (-1791.549) (-1788.667) (-1789.758) [-1786.533] * [-1786.328] (-1791.907) (-1789.914) (-1797.496) -- 0:00:29
936500 -- (-1789.541) (-1790.720) (-1787.132) [-1797.811] * (-1795.541) (-1799.524) [-1794.129] (-1787.499) -- 0:00:29
937000 -- (-1789.768) (-1791.204) [-1792.065] (-1796.027) * (-1786.150) [-1790.482] (-1791.877) (-1794.559) -- 0:00:29
937500 -- [-1795.925] (-1796.692) (-1804.286) (-1797.120) * (-1791.770) [-1788.038] (-1798.795) (-1791.995) -- 0:00:28
938000 -- (-1797.816) (-1785.248) [-1790.108] (-1789.255) * [-1786.382] (-1791.574) (-1799.194) (-1795.245) -- 0:00:28
938500 -- [-1789.130] (-1799.666) (-1791.976) (-1789.283) * [-1786.328] (-1790.915) (-1793.941) (-1793.622) -- 0:00:28
939000 -- (-1801.435) (-1787.430) (-1794.903) [-1797.887] * (-1797.228) [-1792.407] (-1793.454) (-1796.460) -- 0:00:28
939500 -- (-1791.848) [-1788.476] (-1789.797) (-1792.860) * (-1792.070) [-1787.325] (-1791.130) (-1793.670) -- 0:00:27
940000 -- (-1792.789) [-1792.005] (-1793.756) (-1796.654) * (-1789.781) [-1798.541] (-1791.661) (-1789.790) -- 0:00:27
Average standard deviation of split frequencies: 0.004260
940500 -- (-1800.780) (-1792.349) [-1788.974] (-1801.001) * [-1789.739] (-1793.562) (-1791.614) (-1789.898) -- 0:00:27
941000 -- (-1792.723) (-1795.905) (-1788.704) [-1797.124] * [-1788.129] (-1793.134) (-1816.644) (-1794.498) -- 0:00:27
941500 -- [-1785.206] (-1792.866) (-1796.587) (-1794.494) * (-1790.837) (-1783.708) (-1790.300) [-1785.187] -- 0:00:26
942000 -- (-1791.590) (-1793.036) (-1795.820) [-1796.021] * (-1794.689) [-1786.989] (-1792.572) (-1789.295) -- 0:00:26
942500 -- (-1791.131) (-1794.699) (-1795.134) [-1787.822] * (-1789.378) [-1787.567] (-1789.990) (-1785.268) -- 0:00:26
943000 -- (-1787.714) (-1797.846) [-1790.032] (-1800.617) * [-1786.667] (-1782.735) (-1791.346) (-1797.647) -- 0:00:26
943500 -- (-1785.825) [-1790.180] (-1795.188) (-1801.480) * (-1801.132) (-1781.869) (-1793.688) [-1788.618] -- 0:00:26
944000 -- (-1790.310) (-1792.694) [-1793.775] (-1794.888) * (-1790.939) (-1794.657) (-1787.580) [-1782.830] -- 0:00:25
944500 -- [-1790.929] (-1788.684) (-1787.785) (-1790.394) * (-1791.530) [-1793.499] (-1789.840) (-1792.173) -- 0:00:25
945000 -- (-1790.536) [-1793.715] (-1788.478) (-1795.196) * (-1797.105) [-1795.696] (-1784.456) (-1787.165) -- 0:00:25
Average standard deviation of split frequencies: 0.004443
945500 -- (-1787.272) (-1789.513) (-1791.568) [-1791.177] * (-1798.325) (-1789.067) [-1789.996] (-1792.323) -- 0:00:25
946000 -- (-1787.514) (-1795.397) (-1786.651) [-1796.599] * (-1793.087) (-1791.965) [-1787.643] (-1795.664) -- 0:00:24
946500 -- (-1788.763) (-1791.271) (-1799.784) [-1793.305] * (-1798.103) (-1792.197) (-1794.442) [-1796.422] -- 0:00:24
947000 -- (-1808.435) (-1807.930) (-1787.940) [-1789.795] * [-1797.407] (-1794.477) (-1793.458) (-1795.324) -- 0:00:24
947500 -- [-1792.687] (-1789.536) (-1802.184) (-1795.860) * [-1792.606] (-1795.862) (-1788.307) (-1784.066) -- 0:00:24
948000 -- [-1794.434] (-1786.907) (-1789.946) (-1795.146) * (-1808.318) (-1785.518) [-1790.491] (-1800.823) -- 0:00:23
948500 -- (-1799.990) [-1787.006] (-1789.081) (-1794.558) * (-1798.567) (-1787.301) (-1787.574) [-1794.634] -- 0:00:23
949000 -- (-1789.989) [-1792.417] (-1786.627) (-1799.686) * (-1788.803) [-1788.844] (-1803.469) (-1786.920) -- 0:00:23
949500 -- (-1804.735) [-1798.408] (-1796.471) (-1791.967) * (-1795.007) [-1786.588] (-1787.652) (-1796.014) -- 0:00:23
950000 -- [-1799.778] (-1793.406) (-1787.885) (-1795.110) * [-1794.041] (-1780.741) (-1792.170) (-1796.222) -- 0:00:23
Average standard deviation of split frequencies: 0.004339
950500 -- (-1801.784) (-1791.899) [-1787.875] (-1798.955) * (-1790.575) (-1790.659) (-1788.790) [-1784.093] -- 0:00:22
951000 -- (-1803.960) (-1790.717) (-1791.795) [-1795.403] * (-1796.338) (-1787.963) [-1787.513] (-1795.577) -- 0:00:22
951500 -- [-1791.310] (-1789.078) (-1788.177) (-1808.539) * (-1797.626) [-1787.379] (-1795.095) (-1791.961) -- 0:00:22
952000 -- (-1790.592) [-1792.140] (-1802.497) (-1794.638) * [-1798.030] (-1796.050) (-1786.948) (-1793.482) -- 0:00:22
952500 -- [-1792.079] (-1793.714) (-1798.686) (-1793.357) * (-1801.139) [-1782.852] (-1793.739) (-1799.941) -- 0:00:21
953000 -- (-1789.081) [-1785.628] (-1802.645) (-1799.706) * (-1787.839) (-1799.716) (-1792.150) [-1798.735] -- 0:00:21
953500 -- [-1789.915] (-1796.195) (-1793.155) (-1804.350) * (-1781.084) (-1791.964) (-1790.636) [-1788.950] -- 0:00:21
954000 -- (-1785.944) (-1793.434) [-1790.651] (-1802.175) * (-1789.097) (-1791.178) [-1789.203] (-1786.958) -- 0:00:21
954500 -- (-1795.028) [-1791.774] (-1784.979) (-1805.782) * (-1795.226) (-1792.118) (-1799.768) [-1788.262] -- 0:00:20
955000 -- (-1790.206) [-1790.438] (-1786.210) (-1796.086) * (-1787.745) (-1791.461) (-1794.362) [-1787.412] -- 0:00:20
Average standard deviation of split frequencies: 0.004397
955500 -- (-1791.553) [-1790.772] (-1795.636) (-1797.247) * [-1790.556] (-1793.541) (-1803.061) (-1785.086) -- 0:00:20
956000 -- [-1792.122] (-1797.202) (-1791.355) (-1800.773) * [-1794.465] (-1791.279) (-1800.510) (-1794.110) -- 0:00:20
956500 -- (-1790.330) (-1798.135) [-1783.431] (-1803.531) * (-1790.171) [-1793.032] (-1790.384) (-1790.802) -- 0:00:20
957000 -- [-1786.755] (-1794.572) (-1792.416) (-1802.694) * [-1787.327] (-1792.344) (-1800.117) (-1783.737) -- 0:00:19
957500 -- (-1794.388) [-1789.521] (-1792.205) (-1794.061) * (-1789.323) [-1790.263] (-1796.150) (-1785.884) -- 0:00:19
958000 -- (-1790.728) (-1796.128) (-1788.527) [-1791.834] * (-1794.283) [-1788.279] (-1787.895) (-1800.989) -- 0:00:19
958500 -- (-1790.335) [-1784.756] (-1793.874) (-1788.427) * [-1787.358] (-1787.013) (-1785.842) (-1792.692) -- 0:00:19
959000 -- (-1802.651) [-1787.312] (-1790.381) (-1800.124) * [-1791.185] (-1788.134) (-1786.010) (-1800.202) -- 0:00:18
959500 -- (-1794.598) (-1786.009) [-1789.257] (-1791.938) * [-1787.874] (-1791.117) (-1787.553) (-1787.822) -- 0:00:18
960000 -- (-1783.253) [-1791.917] (-1791.991) (-1787.342) * (-1790.144) [-1792.937] (-1782.297) (-1792.698) -- 0:00:18
Average standard deviation of split frequencies: 0.004457
960500 -- (-1796.483) (-1799.775) (-1785.087) [-1784.315] * [-1791.403] (-1796.471) (-1797.561) (-1785.286) -- 0:00:18
961000 -- [-1790.697] (-1792.686) (-1787.547) (-1795.789) * [-1783.319] (-1789.230) (-1798.651) (-1787.264) -- 0:00:17
961500 -- (-1799.758) (-1799.127) [-1790.430] (-1799.692) * (-1792.961) [-1794.025] (-1790.322) (-1787.530) -- 0:00:17
962000 -- (-1806.212) (-1790.541) (-1800.746) [-1790.776] * (-1791.244) [-1789.601] (-1784.533) (-1791.611) -- 0:00:17
962500 -- (-1792.854) (-1792.032) [-1793.016] (-1799.520) * (-1797.137) (-1794.714) [-1785.269] (-1798.625) -- 0:00:17
963000 -- [-1796.064] (-1793.518) (-1788.957) (-1795.711) * (-1800.598) (-1792.619) (-1785.021) [-1784.880] -- 0:00:17
963500 -- (-1795.242) (-1789.962) [-1787.103] (-1791.362) * (-1792.606) (-1802.899) [-1785.519] (-1794.382) -- 0:00:16
964000 -- (-1802.289) [-1785.013] (-1796.290) (-1787.117) * (-1791.397) (-1789.460) [-1791.791] (-1793.606) -- 0:00:16
964500 -- (-1798.664) (-1799.502) (-1792.324) [-1789.631] * [-1791.019] (-1792.502) (-1790.874) (-1785.419) -- 0:00:16
965000 -- (-1788.698) (-1794.572) (-1788.763) [-1784.715] * (-1793.189) (-1797.367) [-1786.014] (-1796.950) -- 0:00:16
Average standard deviation of split frequencies: 0.004189
965500 -- (-1794.769) [-1793.954] (-1801.319) (-1790.626) * [-1791.240] (-1788.474) (-1788.836) (-1801.064) -- 0:00:15
966000 -- [-1790.515] (-1801.602) (-1798.252) (-1794.847) * (-1792.626) [-1792.093] (-1787.187) (-1792.238) -- 0:00:15
966500 -- (-1797.218) (-1791.792) [-1788.186] (-1790.325) * (-1794.652) [-1791.551] (-1794.406) (-1797.696) -- 0:00:15
967000 -- (-1801.794) [-1789.642] (-1810.983) (-1799.007) * [-1784.535] (-1792.808) (-1795.761) (-1789.133) -- 0:00:15
967500 -- (-1793.292) (-1793.076) [-1794.474] (-1794.588) * (-1793.744) (-1807.365) (-1791.801) [-1793.034] -- 0:00:15
968000 -- (-1793.682) [-1788.044] (-1794.425) (-1790.939) * [-1784.937] (-1794.274) (-1787.937) (-1799.617) -- 0:00:14
968500 -- [-1791.175] (-1791.144) (-1796.359) (-1790.769) * (-1793.741) (-1789.463) (-1797.594) [-1789.549] -- 0:00:14
969000 -- [-1788.542] (-1790.004) (-1785.327) (-1794.778) * [-1794.479] (-1795.083) (-1799.334) (-1790.388) -- 0:00:14
969500 -- (-1791.625) (-1790.371) (-1794.967) [-1790.959] * (-1792.768) [-1792.815] (-1790.846) (-1791.927) -- 0:00:14
970000 -- (-1787.066) (-1792.912) (-1791.474) [-1790.014] * (-1787.997) (-1787.194) [-1791.211] (-1797.692) -- 0:00:13
Average standard deviation of split frequencies: 0.003359
970500 -- (-1788.536) (-1793.578) (-1790.425) [-1784.985] * (-1799.117) [-1795.478] (-1790.632) (-1786.828) -- 0:00:13
971000 -- (-1787.395) (-1799.268) [-1781.687] (-1789.259) * (-1794.689) (-1803.700) (-1791.234) [-1789.886] -- 0:00:13
971500 -- (-1790.709) (-1785.813) (-1795.115) [-1793.082] * (-1794.570) (-1800.600) (-1787.457) [-1793.232] -- 0:00:13
972000 -- (-1784.461) (-1786.705) (-1793.361) [-1786.320] * (-1803.437) (-1796.446) [-1789.808] (-1792.088) -- 0:00:12
972500 -- (-1794.979) [-1795.408] (-1787.729) (-1793.784) * (-1794.546) [-1790.880] (-1785.610) (-1792.709) -- 0:00:12
973000 -- [-1790.968] (-1791.594) (-1795.299) (-1796.480) * (-1811.834) (-1794.216) (-1791.218) [-1786.231] -- 0:00:12
973500 -- (-1792.188) [-1790.020] (-1789.038) (-1792.537) * (-1791.629) (-1790.743) (-1788.956) [-1787.628] -- 0:00:12
974000 -- (-1790.128) [-1794.217] (-1799.320) (-1794.824) * (-1786.316) (-1791.185) [-1783.846] (-1792.681) -- 0:00:12
974500 -- [-1796.943] (-1792.558) (-1789.290) (-1792.535) * (-1795.311) [-1791.141] (-1795.414) (-1791.732) -- 0:00:11
975000 -- (-1798.297) (-1794.077) (-1786.189) [-1784.831] * [-1788.933] (-1794.661) (-1793.028) (-1796.083) -- 0:00:11
Average standard deviation of split frequencies: 0.003743
975500 -- (-1796.098) [-1782.021] (-1788.356) (-1789.732) * (-1794.392) (-1790.633) [-1783.689] (-1792.869) -- 0:00:11
976000 -- (-1794.346) (-1787.372) [-1798.133] (-1787.121) * (-1791.338) (-1786.329) [-1787.177] (-1800.954) -- 0:00:11
976500 -- (-1790.673) [-1791.708] (-1791.409) (-1794.244) * [-1792.661] (-1795.292) (-1787.989) (-1796.556) -- 0:00:10
977000 -- [-1791.066] (-1792.039) (-1794.554) (-1787.505) * [-1784.485] (-1795.603) (-1782.498) (-1793.161) -- 0:00:10
977500 -- [-1786.740] (-1798.091) (-1798.905) (-1796.421) * (-1791.633) [-1788.570] (-1788.831) (-1790.730) -- 0:00:10
978000 -- (-1789.478) (-1799.108) (-1790.149) [-1792.926] * [-1787.829] (-1795.906) (-1793.688) (-1804.384) -- 0:00:10
978500 -- (-1792.764) (-1797.697) [-1792.116] (-1791.146) * [-1787.467] (-1795.831) (-1788.925) (-1805.205) -- 0:00:09
979000 -- (-1788.273) (-1791.625) (-1787.413) [-1794.993] * [-1786.731] (-1790.291) (-1798.593) (-1796.490) -- 0:00:09
979500 -- (-1787.122) (-1791.664) (-1800.650) [-1790.439] * [-1788.605] (-1799.064) (-1786.743) (-1793.890) -- 0:00:09
980000 -- (-1795.708) (-1794.707) (-1796.558) [-1796.974] * (-1796.143) [-1787.965] (-1793.084) (-1812.136) -- 0:00:09
Average standard deviation of split frequencies: 0.003285
980500 -- [-1808.541] (-1792.341) (-1788.795) (-1792.383) * [-1793.359] (-1790.697) (-1791.586) (-1801.680) -- 0:00:09
981000 -- (-1801.277) (-1788.800) (-1796.543) [-1790.474] * (-1797.355) (-1786.800) [-1787.201] (-1798.339) -- 0:00:08
981500 -- (-1799.725) (-1793.131) (-1809.799) [-1782.813] * (-1795.262) [-1792.169] (-1799.268) (-1791.353) -- 0:00:08
982000 -- (-1792.208) [-1789.296] (-1804.698) (-1788.669) * (-1785.368) (-1787.947) (-1801.330) [-1791.181] -- 0:00:08
982500 -- (-1797.123) (-1795.268) (-1791.419) [-1796.861] * (-1797.433) (-1799.467) [-1797.341] (-1788.012) -- 0:00:08
983000 -- (-1790.567) [-1788.771] (-1798.087) (-1795.896) * [-1794.463] (-1797.198) (-1794.272) (-1798.507) -- 0:00:07
983500 -- (-1795.209) (-1792.929) (-1795.956) [-1796.587] * [-1795.329] (-1787.506) (-1793.290) (-1785.899) -- 0:00:07
984000 -- (-1794.241) [-1791.808] (-1796.001) (-1806.019) * (-1803.262) (-1794.695) [-1790.045] (-1796.392) -- 0:00:07
984500 -- (-1784.971) (-1795.002) [-1791.070] (-1803.365) * (-1789.606) (-1793.613) [-1783.302] (-1801.139) -- 0:00:07
985000 -- [-1792.337] (-1800.178) (-1792.705) (-1800.234) * [-1791.944] (-1785.723) (-1799.590) (-1797.440) -- 0:00:06
Average standard deviation of split frequencies: 0.003028
985500 -- [-1793.016] (-1792.850) (-1794.013) (-1806.433) * (-1789.103) (-1798.076) (-1800.294) [-1791.293] -- 0:00:06
986000 -- (-1788.462) (-1802.256) [-1792.999] (-1798.797) * [-1791.585] (-1795.551) (-1799.488) (-1794.440) -- 0:00:06
986500 -- (-1792.597) [-1793.344] (-1790.708) (-1797.745) * (-1794.178) (-1794.868) (-1795.503) [-1785.092] -- 0:00:06
987000 -- [-1788.336] (-1793.609) (-1788.005) (-1801.741) * (-1797.573) [-1788.382] (-1798.619) (-1794.528) -- 0:00:06
987500 -- (-1790.444) (-1793.950) (-1787.309) [-1791.942] * [-1785.659] (-1792.248) (-1797.038) (-1802.101) -- 0:00:05
988000 -- (-1801.220) (-1789.669) [-1786.540] (-1794.019) * [-1786.712] (-1786.974) (-1794.585) (-1790.602) -- 0:00:05
988500 -- (-1791.065) (-1802.497) [-1793.785] (-1788.576) * (-1792.966) [-1794.960] (-1790.340) (-1789.666) -- 0:00:05
989000 -- (-1797.146) [-1794.902] (-1797.072) (-1791.264) * (-1791.592) (-1794.167) (-1787.036) [-1786.971] -- 0:00:05
989500 -- (-1797.961) (-1789.947) (-1789.806) [-1791.713] * [-1787.703] (-1790.571) (-1794.501) (-1783.205) -- 0:00:04
990000 -- (-1795.504) (-1792.246) (-1791.770) [-1788.352] * (-1794.436) (-1791.158) (-1786.522) [-1794.112] -- 0:00:04
Average standard deviation of split frequencies: 0.002974
990500 -- (-1802.875) [-1789.849] (-1790.558) (-1792.727) * (-1793.013) (-1789.342) (-1795.002) [-1794.441] -- 0:00:04
991000 -- (-1805.161) (-1795.828) [-1786.440] (-1793.230) * (-1800.858) [-1790.623] (-1803.596) (-1796.294) -- 0:00:04
991500 -- [-1797.684] (-1790.006) (-1797.258) (-1790.476) * (-1788.904) [-1790.488] (-1813.917) (-1783.520) -- 0:00:03
992000 -- (-1792.840) [-1790.318] (-1792.081) (-1796.447) * [-1790.632] (-1790.881) (-1798.380) (-1793.174) -- 0:00:03
992500 -- (-1792.174) (-1784.665) (-1804.634) [-1787.083] * (-1800.329) (-1793.276) [-1798.627] (-1792.771) -- 0:00:03
993000 -- (-1797.981) [-1786.217] (-1798.810) (-1783.866) * (-1799.799) [-1786.999] (-1787.972) (-1793.591) -- 0:00:03
993500 -- (-1803.833) (-1796.350) (-1792.885) [-1787.907] * (-1793.049) [-1795.172] (-1791.178) (-1789.201) -- 0:00:03
994000 -- (-1794.301) (-1795.674) (-1785.276) [-1793.081] * [-1785.995] (-1789.333) (-1790.477) (-1801.991) -- 0:00:02
994500 -- (-1791.867) (-1793.664) [-1789.494] (-1799.173) * (-1798.619) (-1789.326) [-1803.306] (-1801.767) -- 0:00:02
995000 -- (-1790.634) (-1789.755) [-1788.785] (-1798.424) * (-1786.906) [-1788.832] (-1788.557) (-1795.428) -- 0:00:02
Average standard deviation of split frequencies: 0.002643
995500 -- (-1792.192) (-1795.459) [-1787.811] (-1789.059) * (-1791.721) [-1791.428] (-1788.460) (-1808.991) -- 0:00:02
996000 -- [-1787.691] (-1788.759) (-1790.328) (-1798.248) * [-1791.381] (-1788.657) (-1786.180) (-1812.528) -- 0:00:01
996500 -- (-1793.018) (-1801.975) (-1796.140) [-1787.514] * (-1787.367) [-1785.546] (-1794.506) (-1799.995) -- 0:00:01
997000 -- (-1796.845) (-1795.271) (-1792.965) [-1792.935] * (-1798.139) (-1794.232) (-1792.810) [-1786.521] -- 0:00:01
997500 -- (-1799.787) (-1798.787) (-1787.942) [-1800.329] * (-1789.037) [-1800.355] (-1789.128) (-1801.060) -- 0:00:01
998000 -- (-1794.454) (-1792.825) (-1790.180) [-1790.561] * (-1789.433) (-1788.415) (-1785.945) [-1791.804] -- 0:00:00
998500 -- (-1792.682) (-1796.267) (-1791.245) [-1795.468] * (-1789.138) (-1796.782) [-1785.379] (-1806.478) -- 0:00:00
999000 -- (-1787.486) (-1789.946) (-1791.709) [-1794.389] * (-1799.510) [-1786.164] (-1786.187) (-1797.004) -- 0:00:00
999500 -- (-1785.376) [-1791.010] (-1791.925) (-1796.677) * (-1790.281) (-1789.856) [-1788.906] (-1789.892) -- 0:00:00
1000000 -- [-1789.872] (-1790.055) (-1788.986) (-1791.429) * (-1788.355) (-1801.541) [-1788.356] (-1800.581) -- 0:00:00
Average standard deviation of split frequencies: 0.002591
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1789.871782 -- 22.236866
Chain 1 -- -1789.871782 -- 22.236866
Chain 2 -- -1790.054967 -- 25.360117
Chain 2 -- -1790.054968 -- 25.360117
Chain 3 -- -1788.985589 -- 17.842801
Chain 3 -- -1788.985596 -- 17.842801
Chain 4 -- -1791.428549 -- 21.475998
Chain 4 -- -1791.428550 -- 21.475998
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1788.354888 -- 18.776900
Chain 1 -- -1788.354893 -- 18.776900
Chain 2 -- -1801.541136 -- 20.612798
Chain 2 -- -1801.541113 -- 20.612798
Chain 3 -- -1788.355686 -- 21.868407
Chain 3 -- -1788.355658 -- 21.868407
Chain 4 -- -1800.580911 -- 19.758130
Chain 4 -- -1800.580913 -- 19.758130
Analysis completed in 7 mins 42 seconds
Analysis used 462.26 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1777.41
Likelihood of best state for "cold" chain of run 2 was -1777.96
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
49.1 % ( 42 %) Dirichlet(Revmat{all})
61.0 % ( 50 %) Slider(Revmat{all})
27.2 % ( 32 %) Dirichlet(Pi{all})
29.2 % ( 31 %) Slider(Pi{all})
38.0 % ( 32 %) Multiplier(Alpha{1,2})
47.5 % ( 26 %) Multiplier(Alpha{3})
59.7 % ( 30 %) Slider(Pinvar{all})
12.7 % ( 15 %) ExtSPR(Tau{all},V{all})
4.9 % ( 4 %) ExtTBR(Tau{all},V{all})
16.3 % ( 16 %) NNI(Tau{all},V{all})
18.7 % ( 18 %) ParsSPR(Tau{all},V{all})
26.5 % ( 17 %) Multiplier(V{all})
33.6 % ( 44 %) Nodeslider(V{all})
25.7 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
49.4 % ( 39 %) Dirichlet(Revmat{all})
61.4 % ( 46 %) Slider(Revmat{all})
27.7 % ( 12 %) Dirichlet(Pi{all})
28.5 % ( 30 %) Slider(Pi{all})
38.5 % ( 27 %) Multiplier(Alpha{1,2})
47.2 % ( 26 %) Multiplier(Alpha{3})
59.1 % ( 32 %) Slider(Pinvar{all})
12.9 % ( 11 %) ExtSPR(Tau{all},V{all})
4.9 % ( 3 %) ExtTBR(Tau{all},V{all})
16.3 % ( 15 %) NNI(Tau{all},V{all})
18.8 % ( 13 %) ParsSPR(Tau{all},V{all})
26.4 % ( 24 %) Multiplier(V{all})
33.5 % ( 32 %) Nodeslider(V{all})
25.4 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.77 0.57 0.41
2 | 167589 0.79 0.60
3 | 166533 166190 0.80
4 | 166313 166825 166550
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.77 0.57 0.41
2 | 166870 0.79 0.60
3 | 167089 166768 0.80
4 | 166370 166106 166797
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1788.28
| 1 |
| 12 2 2 |
| 1 2 |
| 1 2 1 1 11 2 11 2 |
| 2 2 1 2 1 11 * 2 |
|22 1 1 * 2 1 1 * *1 1 1 2 2* |
|11 11 22 * 22 2 2 * 1 1 |
| 12 2 2 2 2 * 122 22 1* 2 2 2|
| 1 1 2 21 2 12 111 2 1 * 1|
| 21 1 2 22 2 1 1 |
| 2 1 2 2 |
| 1 2 |
| 1 2 1 1 |
| 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1792.83
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1785.13 -1801.27
2 -1784.96 -1803.44
--------------------------------------
TOTAL -1785.04 -1802.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.581602 0.006099 0.440886 0.737678 0.574211 1326.95 1413.98 1.000
r(A<->C){all} 0.116460 0.000830 0.065372 0.176433 0.114980 917.72 935.04 1.000
r(A<->G){all} 0.283141 0.002160 0.194390 0.371155 0.281966 691.78 793.11 1.000
r(A<->T){all} 0.179412 0.001817 0.098364 0.264455 0.176990 624.37 803.54 1.000
r(C<->G){all} 0.030736 0.000144 0.008551 0.053751 0.029551 1181.06 1186.23 1.000
r(C<->T){all} 0.314199 0.002745 0.220042 0.421601 0.311335 722.05 787.86 1.000
r(G<->T){all} 0.076052 0.000629 0.030283 0.123347 0.073424 679.62 841.29 1.000
pi(A){all} 0.213352 0.000233 0.184588 0.243273 0.212914 1100.47 1216.89 1.000
pi(C){all} 0.291931 0.000308 0.257384 0.324839 0.291609 1350.77 1371.94 1.000
pi(G){all} 0.344712 0.000354 0.309174 0.381064 0.344756 1232.42 1252.98 1.000
pi(T){all} 0.150006 0.000193 0.121740 0.175841 0.149616 829.14 914.82 1.001
alpha{1,2} 0.238626 0.008369 0.098109 0.440404 0.224758 909.93 974.09 1.000
alpha{3} 1.790466 0.702420 0.380481 3.434864 1.646187 1058.30 1088.41 1.000
pinvar{all} 0.321774 0.014547 0.067510 0.525933 0.335492 912.53 928.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ........**
12 -- .**.......
13 -- .....*****
14 -- ...*******
15 -- ...*.*****
16 -- .....***..
17 -- .....*.*..
18 -- .....**...
19 -- ....******
20 -- ......*.**
21 -- ......**..
22 -- ......****
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 3001 0.999667 0.000471 0.999334 1.000000 2
15 2220 0.739507 0.000942 0.738841 0.740173 2
16 2081 0.693205 0.004240 0.690207 0.696203 2
17 1085 0.361426 0.000471 0.361093 0.361759 2
18 1081 0.360093 0.004240 0.357095 0.363091 2
19 709 0.236176 0.000471 0.235843 0.236509 2
20 591 0.196869 0.000471 0.196536 0.197202 2
21 424 0.141239 0.011306 0.133245 0.149234 2
22 358 0.119254 0.008480 0.113258 0.125250 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.017304 0.000051 0.004625 0.031324 0.016425 1.000 2
length{all}[2] 0.002141 0.000005 0.000000 0.006471 0.001458 1.001 2
length{all}[3] 0.002144 0.000005 0.000000 0.006807 0.001420 1.001 2
length{all}[4] 0.026399 0.000105 0.008905 0.046120 0.025187 1.000 2
length{all}[5] 0.037817 0.000149 0.016321 0.061986 0.036309 1.000 2
length{all}[6] 0.038281 0.000163 0.014858 0.063148 0.036684 1.000 2
length{all}[7] 0.093536 0.000546 0.049465 0.138524 0.091355 1.001 2
length{all}[8] 0.074940 0.000370 0.041031 0.114233 0.072816 1.000 2
length{all}[9] 0.028851 0.000138 0.008504 0.052344 0.027474 1.000 2
length{all}[10] 0.029864 0.000135 0.010008 0.053895 0.028424 1.000 2
length{all}[11] 0.089699 0.000597 0.045071 0.137896 0.086874 1.000 2
length{all}[12] 0.021648 0.000067 0.007089 0.038154 0.020639 1.000 2
length{all}[13] 0.048465 0.000310 0.015943 0.083292 0.046297 1.001 2
length{all}[14] 0.029217 0.000111 0.009318 0.048882 0.027973 1.000 2
length{all}[15] 0.015619 0.000089 0.000144 0.033794 0.013954 1.000 2
length{all}[16] 0.021747 0.000167 0.000015 0.044998 0.019994 1.000 2
length{all}[17] 0.010237 0.000069 0.000011 0.025733 0.008036 0.999 2
length{all}[18] 0.009260 0.000053 0.000018 0.022624 0.008005 0.999 2
length{all}[19] 0.008537 0.000035 0.000056 0.019726 0.007483 0.999 2
length{all}[20] 0.013834 0.000100 0.000078 0.033252 0.012006 0.998 2
length{all}[21] 0.005918 0.000029 0.000039 0.017560 0.004453 0.998 2
length{all}[22] 0.008666 0.000042 0.000156 0.020315 0.007258 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.002591
Maximum standard deviation of split frequencies = 0.011306
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /-------------- C2 (2)
|--------------------------100--------------------------+
| \-------------- C3 (3)
|
| /------------------------------------------ C4 (4)
+ |
| | /-------------- C6 (6)
| | |
| /------74-----+ /------69-----+-------------- C7 (7)
| | | | |
| | | | \-------------- C8 (8)
| | \-----100-----+
\-----100-----+ | /-------------- C9 (9)
| \-----100-----+
| \-------------- C10 (10)
|
\-------------------------------------------------------- C5 (5)
Phylogram (based on average branch lengths):
/------ C1 (1)
|
| /- C2 (2)
|------+
| \- C3 (3)
|
| /--------- C4 (4)
+ |
| | /------------- C6 (6)
| | |
| /---+ /------+-------------------------------- C7 (7)
| | | | |
| | | | \------------------------- C8 (8)
| | \---------------+
\---------+ | /---------- C9 (9)
| \-----------------------------+
| \---------- C10 (10)
|
\------------ C5 (5)
|----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (42 trees sampled):
50 % credible set contains 3 trees
90 % credible set contains 13 trees
95 % credible set contains 19 trees
99 % credible set contains 29 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 645
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sites with gaps or missing data are removed.
78 ambiguity characters in seq. 1
63 ambiguity characters in seq. 2
63 ambiguity characters in seq. 3
63 ambiguity characters in seq. 4
81 ambiguity characters in seq. 5
72 ambiguity characters in seq. 6
69 ambiguity characters in seq. 7
84 ambiguity characters in seq. 8
102 ambiguity characters in seq. 9
93 ambiguity characters in seq. 10
44 sites are removed. 105 109 110 111 112 113 122 123 124 129 130 131 132 133 134 135 168 175 176 177 178 179 180 181 182 183 184 185 186 187 188 203 204 205 206 207 208 209 210 211 212 213 214 215
Sequences read..
Counting site patterns.. 0:00
107 patterns at 171 / 171 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
104432 bytes for conP
14552 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
365512 bytes for conP, adjusted
0.039572 0.047140 0.000001 0.000000 0.046164 0.006179 0.044972 0.047714 0.008499 0.068759 0.133407 0.117517 0.120272 0.043979 0.035418 0.054347 0.300000 1.300000
ntime & nrate & np: 16 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 18
lnL0 = -1563.437809
Iterating by ming2
Initial: fx= 1563.437809
x= 0.03957 0.04714 0.00000 0.00000 0.04616 0.00618 0.04497 0.04771 0.00850 0.06876 0.13341 0.11752 0.12027 0.04398 0.03542 0.05435 0.30000 1.30000
1 h-m-p 0.0000 0.0000 359.3655 ++ 1563.437186 m 0.0000 23 | 2/18
2 h-m-p 0.0000 0.0001 237.4551 +YCYCCC 1562.373894 5 0.0000 53 | 2/18
3 h-m-p 0.0001 0.0005 54.6011 YCYCC 1561.993291 4 0.0003 80 | 2/18
4 h-m-p 0.0001 0.0010 139.7355 CCC 1561.609251 2 0.0001 105 | 2/18
5 h-m-p 0.0003 0.0208 68.7230 +YYCCC 1560.052417 4 0.0016 133 | 2/18
6 h-m-p 0.0005 0.0036 227.3311 +YCYCYCC 1550.143488 6 0.0025 164 | 2/18
7 h-m-p 0.0000 0.0002 2795.0633 +YYCYCCC 1537.962227 6 0.0002 195 | 2/18
8 h-m-p 0.0000 0.0000 8173.4111 YCCCCC 1537.140200 5 0.0000 225 | 2/18
9 h-m-p 0.0002 0.0011 43.1682 CC 1537.106268 1 0.0001 248 | 2/18
10 h-m-p 0.0001 0.0100 21.5600 YC 1537.053779 1 0.0003 270 | 2/18
11 h-m-p 0.0006 0.0075 12.1040 YC 1537.033416 1 0.0003 292 | 2/18
12 h-m-p 0.0011 0.0468 2.9691 +CCC 1536.805186 2 0.0049 318 | 2/18
13 h-m-p 0.0004 0.0040 35.5403 YCCC 1536.177031 3 0.0008 344 | 2/18
14 h-m-p 0.0006 0.0031 47.3297 YCCCC 1534.459828 4 0.0011 372 | 2/18
15 h-m-p 0.0004 0.0020 92.3695 CCCC 1532.995736 3 0.0004 399 | 2/18
16 h-m-p 0.0017 0.0123 23.1632 +YYCCC 1524.309970 4 0.0057 427 | 2/18
17 h-m-p 0.0048 0.0242 14.9027 CYCCC 1521.690424 4 0.0074 455 | 2/18
18 h-m-p 0.0088 0.0440 4.6627 ++ 1499.861325 m 0.0440 476 | 2/18
19 h-m-p 0.1071 0.5355 0.7150 +YCCCCC 1474.767618 5 0.2837 507 | 2/18
20 h-m-p 0.1479 0.7393 0.3843 CCCC 1468.540920 3 0.2277 550 | 2/18
21 h-m-p 0.4407 5.7914 0.1985 +YCCCCC 1451.954940 5 1.2531 597 | 2/18
22 h-m-p 0.9323 4.6617 0.1560 YCCCC 1437.457729 4 1.6609 641 | 2/18
23 h-m-p 0.1352 0.6758 0.2435 +YYCCCC 1431.041791 5 0.4204 687 | 2/18
24 h-m-p 0.4578 2.3571 0.2236 YCYCCC 1418.062509 5 1.0480 732 | 2/18
25 h-m-p 0.8711 4.3556 0.1312 CCCCC 1411.936476 4 1.5754 777 | 2/18
26 h-m-p 1.3141 8.0000 0.1572 YYCCC 1407.377221 4 2.0039 820 | 2/18
27 h-m-p 1.6000 8.0000 0.1966 CCCCC 1404.107510 4 1.7602 865 | 2/18
28 h-m-p 1.6000 8.0000 0.0794 YCCC 1402.902074 3 2.8347 907 | 2/18
29 h-m-p 1.6000 8.0000 0.0574 +YCCC 1401.177410 3 4.5375 950 | 2/18
30 h-m-p 1.6000 8.0000 0.0177 YCCC 1398.750225 3 3.6380 992 | 2/18
31 h-m-p 0.9995 4.9977 0.0627 CCCCC 1397.221857 4 1.3591 1037 | 2/18
32 h-m-p 0.5912 7.1546 0.1441 YC 1396.466561 1 1.4267 1075 | 2/18
33 h-m-p 1.4050 8.0000 0.1463 CCC 1395.992642 2 1.9519 1116 | 2/18
34 h-m-p 1.6000 8.0000 0.0583 CCC 1395.910297 2 1.2764 1157 | 2/18
35 h-m-p 1.6000 8.0000 0.0273 CC 1395.881467 1 1.9692 1196 | 2/18
36 h-m-p 1.6000 8.0000 0.0034 YC 1395.858679 1 3.2111 1234 | 2/18
37 h-m-p 0.9560 8.0000 0.0114 +YC 1395.835151 1 3.1885 1273 | 2/18
38 h-m-p 1.6000 8.0000 0.0066 CC 1395.825620 1 2.0216 1312 | 2/18
39 h-m-p 1.6000 8.0000 0.0023 YC 1395.823554 1 2.6920 1350 | 2/18
40 h-m-p 1.6000 8.0000 0.0004 +YC 1395.821343 1 4.7930 1389 | 2/18
41 h-m-p 1.0946 8.0000 0.0016 +C 1395.817742 0 4.5622 1427 | 2/18
42 h-m-p 1.6000 8.0000 0.0011 ++ 1395.798352 m 8.0000 1464 | 2/18
43 h-m-p 0.5694 8.0000 0.0152 YCC 1395.780745 2 1.1473 1504 | 2/18
44 h-m-p 1.6000 8.0000 0.0084 CC 1395.777003 1 1.7270 1543 | 2/18
45 h-m-p 1.6000 8.0000 0.0006 Y 1395.776823 0 1.2762 1580 | 2/18
46 h-m-p 1.6000 8.0000 0.0003 C 1395.776799 0 1.5157 1617 | 2/18
47 h-m-p 1.6000 8.0000 0.0000 Y 1395.776798 0 1.0829 1654 | 2/18
48 h-m-p 1.6000 8.0000 0.0000 Y 1395.776798 0 1.1683 1691 | 2/18
49 h-m-p 1.6000 8.0000 0.0000 C 1395.776798 0 1.6676 1728 | 2/18
50 h-m-p 1.6000 8.0000 0.0000 C 1395.776798 0 1.6000 1765 | 2/18
51 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/18
52 h-m-p 0.0160 8.0000 0.0004 ------------- | 2/18
53 h-m-p 0.0160 8.0000 0.0004 -------------
Out..
lnL = -1395.776798
1913 lfun, 1913 eigenQcodon, 30608 P(t)
Time used: 0:10
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
0.039572 0.047140 0.000001 0.000000 0.046163 0.006178 0.044971 0.047714 0.008498 0.068760 0.133407 0.117517 0.120273 0.043979 0.035418 0.054346 2.833931 0.816750 0.136540
ntime & nrate & np: 16 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.093371
np = 19
lnL0 = -1389.408797
Iterating by ming2
Initial: fx= 1389.408797
x= 0.03957 0.04714 0.00000 0.00000 0.04616 0.00618 0.04497 0.04771 0.00850 0.06876 0.13341 0.11752 0.12027 0.04398 0.03542 0.05435 2.83393 0.81675 0.13654
1 h-m-p 0.0000 0.0000 246.0377 ++ 1389.408110 m 0.0000 43 | 2/19
2 h-m-p 0.0000 0.0001 448.4398 ++ 1381.588132 m 0.0001 84 | 2/19
3 h-m-p 0.0000 0.0002 629.4196 +YYCCC 1375.033414 4 0.0001 130 | 2/19
4 h-m-p 0.0008 0.0041 35.5113 YYCC 1374.664043 3 0.0006 173 | 2/19
5 h-m-p 0.0005 0.0026 28.1470 YC 1374.563057 1 0.0004 213 | 2/19
6 h-m-p 0.0015 0.0082 7.1639 CC 1374.553581 1 0.0004 254 | 2/19
7 h-m-p 0.0012 0.0497 2.4662 YC 1374.550339 1 0.0009 294 | 2/19
8 h-m-p 0.0010 0.0771 2.1050 C 1374.547213 0 0.0011 333 | 2/19
9 h-m-p 0.0014 0.0452 1.6214 C 1374.542610 0 0.0014 372 | 2/19
10 h-m-p 0.0012 0.0967 1.8550 +CC 1374.505768 1 0.0045 414 | 2/19
11 h-m-p 0.0007 0.0385 12.1091 +CYC 1374.299017 2 0.0030 457 | 2/19
12 h-m-p 0.0013 0.0073 27.8739 YCC 1374.138541 2 0.0010 499 | 2/19
13 h-m-p 0.0006 0.0202 41.8098 YCCC 1373.875169 3 0.0011 543 | 2/19
14 h-m-p 0.0021 0.0106 15.6852 CC 1373.844472 1 0.0005 584 | 2/19
15 h-m-p 0.0034 0.0726 2.1284 YC 1373.843285 1 0.0005 624 | 2/19
16 h-m-p 0.0031 0.6581 0.3592 CC 1373.842725 1 0.0047 665 | 2/19
17 h-m-p 0.0008 0.4055 3.7626 +YC 1373.834193 1 0.0069 706 | 2/19
18 h-m-p 0.0016 0.2970 16.1591 +CYC 1373.798414 2 0.0068 749 | 2/19
19 h-m-p 1.6000 8.0000 0.0581 CCC 1373.731599 2 1.2427 792 | 2/19
20 h-m-p 1.6000 8.0000 0.0028 CC 1373.722633 1 1.3501 833 | 2/19
21 h-m-p 1.6000 8.0000 0.0011 YC 1373.722136 1 0.9583 873 | 2/19
22 h-m-p 0.9818 8.0000 0.0011 Y 1373.722061 0 0.7321 912 | 2/19
23 h-m-p 1.6000 8.0000 0.0001 Y 1373.722058 0 1.1502 951 | 2/19
24 h-m-p 1.6000 8.0000 0.0000 Y 1373.722058 0 1.1938 990 | 2/19
25 h-m-p 1.6000 8.0000 0.0000 Y 1373.722058 0 1.1350 1029 | 2/19
26 h-m-p 1.6000 8.0000 0.0000 -Y 1373.722058 0 0.1000 1069
Out..
lnL = -1373.722058
1070 lfun, 3210 eigenQcodon, 34240 P(t)
Time used: 0:21
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
initial w for M2:NSpselection reset.
0.039572 0.047140 0.000000 0.000001 0.046163 0.006178 0.044971 0.047714 0.008498 0.068759 0.133407 0.117517 0.120273 0.043979 0.035418 0.054347 2.792404 1.098208 0.580294 0.458835 2.948231
ntime & nrate & np: 16 3 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.126304
np = 21
lnL0 = -1445.186996
Iterating by ming2
Initial: fx= 1445.186996
x= 0.03957 0.04714 0.00000 0.00000 0.04616 0.00618 0.04497 0.04771 0.00850 0.06876 0.13341 0.11752 0.12027 0.04398 0.03542 0.05435 2.79240 1.09821 0.58029 0.45883 2.94823
1 h-m-p 0.0000 0.0000 244.1759 ++ 1445.186267 m 0.0000 47 | 2/21
2 h-m-p 0.0000 0.0003 218.8698 ++YCCCC 1441.870022 4 0.0002 101 | 2/21
3 h-m-p 0.0001 0.0004 169.9227 ++ 1437.622751 m 0.0004 144 | 2/21
4 h-m-p 0.0000 0.0000 213.5502
h-m-p: 2.74021282e-19 1.37010641e-18 2.13550151e+02 1437.622751
.. | 2/21
5 h-m-p 0.0000 0.0059 398.8385 +CCYC 1435.671866 3 0.0000 233 | 2/21
6 h-m-p 0.0002 0.0054 111.1247 +YCYCCC 1432.433426 5 0.0014 285 | 2/21
7 h-m-p 0.0003 0.0015 209.7218 ++ 1406.641414 m 0.0015 328 | 3/21
8 h-m-p 0.0006 0.0049 211.8268 YCCC 1405.780518 3 0.0005 376 | 3/21
9 h-m-p 0.0034 0.0177 29.1657 CCCCC 1404.026507 4 0.0049 426 | 2/21
10 h-m-p 0.0004 0.0022 230.2071 YCCCC 1403.094465 4 0.0002 475 | 2/21
11 h-m-p 0.0006 0.0118 92.9705 +YCCCCC 1395.851698 5 0.0051 528 | 2/21
12 h-m-p 0.0006 0.0028 335.0525 CCCCC 1391.626035 4 0.0008 579 | 2/21
13 h-m-p 0.0006 0.0028 121.6836 CCCCC 1389.405521 4 0.0010 630 | 2/21
14 h-m-p 0.0006 0.0030 95.7543 CYCCC 1387.162856 4 0.0010 680 | 2/21
15 h-m-p 0.0004 0.0019 42.6841 +YYYCC 1384.623476 4 0.0015 729 | 2/21
16 h-m-p 0.0007 0.0036 18.0722 YCC 1384.536970 2 0.0005 775 | 2/21
17 h-m-p 0.0016 0.0479 5.8747 +YCC 1384.382940 2 0.0055 822 | 2/21
18 h-m-p 0.0007 0.0755 47.2994 ++YCCC 1379.309767 3 0.0252 872 | 2/21
19 h-m-p 0.0018 0.0088 44.0100 YCC 1379.147101 2 0.0009 918 | 2/21
20 h-m-p 0.0121 0.0855 3.1156 CC 1379.123202 1 0.0038 963 | 2/21
21 h-m-p 0.0009 0.3365 12.5782 +++CCCC 1376.768697 3 0.0982 1015 | 2/21
22 h-m-p 0.0006 0.0032 571.2877 YCCC 1375.586376 3 0.0011 1063 | 2/21
23 h-m-p 0.0022 0.0110 118.4478 CYC 1375.170445 2 0.0019 1109 | 2/21
24 h-m-p 0.5376 3.7390 0.4209 CCCC 1374.093224 3 0.8792 1158 | 2/21
25 h-m-p 0.4859 3.2305 0.7615 CCC 1373.582126 2 0.5260 1205 | 2/21
26 h-m-p 0.3480 1.7398 0.4342 CCC 1373.422059 2 0.4517 1252 | 2/21
27 h-m-p 0.7903 8.0000 0.2481 CCCC 1373.258708 3 1.1091 1301 | 2/21
28 h-m-p 1.5633 8.0000 0.1760 CC 1373.149704 1 1.6590 1346 | 2/21
29 h-m-p 1.5112 8.0000 0.1933 YCC 1373.083356 2 1.1598 1392 | 2/21
30 h-m-p 1.2909 8.0000 0.1736 CC 1373.044525 1 1.0548 1437 | 2/21
31 h-m-p 0.7727 8.0000 0.2370 YC 1372.996554 1 1.6055 1481 | 2/21
32 h-m-p 1.2139 8.0000 0.3135 CCC 1372.955964 2 1.3610 1528 | 2/21
33 h-m-p 1.4968 8.0000 0.2850 CCC 1372.917342 2 1.5901 1575 | 2/21
34 h-m-p 1.5032 8.0000 0.3015 CCC 1372.879307 2 1.6103 1622 | 2/21
35 h-m-p 1.6000 8.0000 0.2681 YCC 1372.862208 2 1.2350 1668 | 2/21
36 h-m-p 1.2180 8.0000 0.2719 YYC 1372.850844 2 1.0747 1713 | 2/21
37 h-m-p 1.6000 8.0000 0.1312 YC 1372.846768 1 0.7705 1757 | 2/21
38 h-m-p 0.4320 8.0000 0.2340 YC 1372.844295 1 0.7824 1801 | 2/21
39 h-m-p 1.1477 8.0000 0.1595 C 1372.843024 0 0.9995 1844 | 2/21
40 h-m-p 1.5992 8.0000 0.0997 C 1372.842162 0 1.4376 1887 | 2/21
41 h-m-p 1.6000 8.0000 0.0711 C 1372.841691 0 1.6000 1930 | 2/21
42 h-m-p 0.8426 8.0000 0.1349 Y 1372.841536 0 0.5512 1973 | 2/21
43 h-m-p 0.9589 8.0000 0.0776 C 1372.841378 0 0.9589 2016 | 2/21
44 h-m-p 1.1506 8.0000 0.0646 Y 1372.841330 0 0.8324 2059 | 2/21
45 h-m-p 1.6000 8.0000 0.0299 C 1372.841298 0 1.6000 2102 | 2/21
46 h-m-p 1.0592 8.0000 0.0452 C 1372.841280 0 1.0592 2145 | 2/21
47 h-m-p 1.6000 8.0000 0.0286 C 1372.841269 0 1.5937 2188 | 2/21
48 h-m-p 1.6000 8.0000 0.0153 C 1372.841265 0 1.3962 2231 | 2/21
49 h-m-p 1.6000 8.0000 0.0070 Y 1372.841265 0 0.7584 2274 | 2/21
50 h-m-p 0.3591 8.0000 0.0147 +Y 1372.841264 0 1.1526 2318 | 2/21
51 h-m-p 1.6000 8.0000 0.0058 Y 1372.841264 0 1.0302 2361 | 2/21
52 h-m-p 1.6000 8.0000 0.0015 Y 1372.841264 0 1.0658 2404 | 2/21
53 h-m-p 1.6000 8.0000 0.0002 Y 1372.841264 0 1.0749 2447 | 2/21
54 h-m-p 1.6000 8.0000 0.0000 C 1372.841264 0 1.4654 2490 | 2/21
55 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/21
56 h-m-p 0.0160 8.0000 0.0001 -----Y 1372.841264 0 0.0000 2595
Out..
lnL = -1372.841264
2596 lfun, 10384 eigenQcodon, 124608 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1381.148569 S = -1306.368341 -67.253248
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 107 patterns 0:59
did 20 / 107 patterns 0:59
did 30 / 107 patterns 0:59
did 40 / 107 patterns 1:00
did 50 / 107 patterns 1:00
did 60 / 107 patterns 1:00
did 70 / 107 patterns 1:00
did 80 / 107 patterns 1:00
did 90 / 107 patterns 1:00
did 100 / 107 patterns 1:00
did 107 / 107 patterns 1:00
Time used: 1:00
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
0.039572 0.047140 0.000002 0.000000 0.046162 0.006177 0.044972 0.047714 0.008501 0.068760 0.133405 0.117515 0.120271 0.043979 0.035420 0.054348 2.813218 0.923969 0.634343 0.068200 0.170675 0.238406
ntime & nrate & np: 16 4 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 9.754920
np = 22
lnL0 = -1392.994238
Iterating by ming2
Initial: fx= 1392.994238
x= 0.03957 0.04714 0.00000 0.00000 0.04616 0.00618 0.04497 0.04771 0.00850 0.06876 0.13340 0.11751 0.12027 0.04398 0.03542 0.05435 2.81322 0.92397 0.63434 0.06820 0.17068 0.23841
1 h-m-p 0.0000 0.0000 195.9690 ++ 1392.993780 m 0.0000 49 | 2/22
2 h-m-p 0.0000 0.0002 180.8849 ++YCCC 1391.215219 3 0.0002 103 | 2/22
3 h-m-p 0.0000 0.0001 449.0451 ++ 1386.882875 m 0.0001 148 | 3/22
4 h-m-p 0.0003 0.0013 63.5784 +CCCC 1386.001278 3 0.0009 200 | 3/22
5 h-m-p 0.0007 0.0034 84.2593 CCCC 1384.663025 3 0.0011 250 | 3/22
6 h-m-p 0.0005 0.0026 116.6917 YCCCCC 1382.911796 5 0.0011 303 | 3/22
7 h-m-p 0.0000 0.0002 444.5788 ++ 1380.856387 m 0.0002 347 | 3/22
8 h-m-p -0.0000 -0.0000 217.9483
h-m-p: -1.45676418e-21 -7.28382091e-21 2.17948267e+02 1380.856387
.. | 3/22
9 h-m-p 0.0000 0.0027 308.0426 +YYYCC 1378.948639 4 0.0000 438 | 3/22
10 h-m-p 0.0002 0.0017 70.6337 YCCC 1377.898828 3 0.0005 487 | 3/22
11 h-m-p 0.0006 0.0030 55.4382 CCCCC 1376.680695 4 0.0011 539 | 3/22
12 h-m-p 0.0004 0.0022 50.1767 CC 1376.402513 1 0.0004 585 | 3/22
13 h-m-p 0.0014 0.0071 14.3808 YCCC 1376.338589 3 0.0008 634 | 2/22
14 h-m-p 0.0003 0.0070 39.3574 +YCCC 1376.114006 3 0.0007 684 | 2/22
15 h-m-p 0.0006 0.0032 47.4728 YC 1375.847942 1 0.0010 730 | 2/22
16 h-m-p 0.0003 0.0016 42.3206 CCCC 1375.733515 3 0.0005 781 | 2/22
17 h-m-p 0.0007 0.0071 30.9855 CCC 1375.654953 2 0.0007 830 | 2/22
18 h-m-p 0.0005 0.0094 41.1842 +CYC 1375.384310 2 0.0021 879 | 2/22
19 h-m-p 0.0007 0.0033 52.0105 CYC 1375.286090 2 0.0006 927 | 2/22
20 h-m-p 0.0011 0.0054 31.7927 CCC 1375.209566 2 0.0009 976 | 2/22
21 h-m-p 0.0015 0.0091 18.6135 CC 1375.183853 1 0.0006 1023 | 2/22
22 h-m-p 0.0022 0.0413 5.1471 CC 1375.166139 1 0.0022 1070 | 2/22
23 h-m-p 0.0008 0.0848 13.8759 ++CCCC 1374.866944 3 0.0150 1123 | 2/22
24 h-m-p 0.0005 0.0193 446.8915 +CYC 1373.881266 2 0.0016 1172 | 2/22
25 h-m-p 0.0020 0.0099 274.2470 CYC 1373.665757 2 0.0006 1220 | 2/22
26 h-m-p 0.0102 0.0763 15.7531 YC 1373.639558 1 0.0013 1266 | 2/22
27 h-m-p 0.0741 6.9756 0.2832 ++CCCC 1373.242783 3 1.4479 1319 | 2/22
28 h-m-p 0.6834 3.4168 0.1674 CCC 1372.980429 2 0.8867 1368 | 2/22
29 h-m-p 0.6378 8.0000 0.2327 CYC 1372.893033 2 0.7098 1416 | 2/22
30 h-m-p 0.8053 8.0000 0.2052 YC 1372.862371 1 0.4890 1462 | 2/22
31 h-m-p 1.3118 6.5592 0.0666 YCCC 1372.853001 3 0.8492 1512 | 2/22
32 h-m-p 0.9895 8.0000 0.0572 CY 1372.845239 1 0.9040 1559 | 2/22
33 h-m-p 1.6000 8.0000 0.0165 CCC 1372.839365 2 2.1682 1608 | 2/22
34 h-m-p 1.6000 8.0000 0.0064 C 1372.837854 0 1.6426 1653 | 2/22
35 h-m-p 0.8363 8.0000 0.0127 C 1372.837433 0 0.8895 1698 | 2/22
36 h-m-p 1.6000 8.0000 0.0028 C 1372.837289 0 1.4269 1743 | 2/22
37 h-m-p 1.6000 8.0000 0.0011 Y 1372.837274 0 1.2496 1788 | 2/22
38 h-m-p 1.6000 8.0000 0.0001 Y 1372.837274 0 1.2382 1833 | 2/22
39 h-m-p 1.6000 8.0000 0.0001 Y 1372.837274 0 1.2605 1878 | 2/22
40 h-m-p 1.6000 8.0000 0.0000 C 1372.837274 0 1.6000 1923 | 2/22
41 h-m-p 1.6000 8.0000 0.0000 Y 1372.837274 0 0.9585 1968 | 2/22
42 h-m-p 1.6000 8.0000 0.0000 C 1372.837274 0 1.6000 2013 | 2/22
43 h-m-p 1.6000 8.0000 0.0000 -Y 1372.837274 0 0.1000 2059
Out..
lnL = -1372.837274
2060 lfun, 8240 eigenQcodon, 98880 P(t)
Time used: 1:31
Model 7: beta
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
0.039573 0.047141 0.000000 0.000002 0.046162 0.006177 0.044972 0.047714 0.008500 0.068760 0.133407 0.117516 0.120271 0.043978 0.035419 0.054346 2.830913 1.091300 1.180709
ntime & nrate & np: 16 1 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.403111
np = 19
lnL0 = -1414.265829
Iterating by ming2
Initial: fx= 1414.265829
x= 0.03957 0.04714 0.00000 0.00000 0.04616 0.00618 0.04497 0.04771 0.00850 0.06876 0.13341 0.11752 0.12027 0.04398 0.03542 0.05435 2.83091 1.09130 1.18071
1 h-m-p 0.0000 0.0000 203.3531 ++ 1414.265325 m 0.0000 43 | 2/19
2 h-m-p 0.0000 0.0004 133.0124 ++CCCC 1413.169733 3 0.0002 92 | 2/19
3 h-m-p 0.0001 0.0005 103.7015 +YYCC 1411.965600 3 0.0003 136 | 2/19
4 h-m-p 0.0005 0.0082 71.7481 +YYYC 1409.336949 3 0.0019 179 | 2/19
5 h-m-p 0.0006 0.0031 197.3798 YCCCCC 1404.475432 5 0.0014 227 | 2/19
6 h-m-p 0.0003 0.0013 680.6731 +YCYCCC 1389.911230 5 0.0008 276 | 2/19
7 h-m-p 0.0001 0.0007 421.5156 YYC 1389.079106 2 0.0001 317 | 2/19
8 h-m-p 0.0008 0.0042 26.8529 YCCC 1388.937950 3 0.0005 361 | 2/19
9 h-m-p 0.0010 0.0175 13.8921 CC 1388.810988 1 0.0016 402 | 2/19
10 h-m-p 0.0007 0.0177 34.4439 +CCCC 1388.090462 3 0.0041 448 | 2/19
11 h-m-p 0.0007 0.0033 151.6454 CCCC 1387.554785 3 0.0007 493 | 2/19
12 h-m-p 0.0014 0.0085 76.0457 YCC 1387.206519 2 0.0010 535 | 2/19
13 h-m-p 0.0012 0.0087 59.7191 YC 1387.048490 1 0.0006 575 | 2/19
14 h-m-p 0.0013 0.0084 27.6429 YCC 1386.943051 2 0.0009 617 | 2/19
15 h-m-p 0.0251 0.1866 1.0134 CCC 1386.749241 2 0.0199 660 | 2/19
16 h-m-p 0.0012 0.0304 16.1366 +YCCCC 1384.094012 4 0.0091 707 | 2/19
17 h-m-p 0.0020 0.0098 36.1315 YCCCCC 1381.419874 5 0.0040 755 | 2/19
18 h-m-p 0.4988 3.2927 0.2887 CCC 1380.182110 2 0.6667 798 | 2/19
19 h-m-p 0.6034 4.2787 0.3189 CCCCC 1379.501207 4 0.9696 845 | 2/19
20 h-m-p 0.7555 5.4437 0.4093 +YYYCCC 1377.730558 5 2.7431 892 | 2/19
21 h-m-p 0.0457 0.2283 4.2497 CYCYC 1377.025121 4 0.0945 938 | 2/19
22 h-m-p 0.1859 0.9293 0.5775 CYCCC 1376.485098 4 0.2891 984 | 2/19
23 h-m-p 0.1226 5.5965 1.3625 YCCC 1375.688937 3 0.2866 1028 | 2/19
24 h-m-p 0.8253 4.1266 0.1731 YYCC 1375.557514 3 0.5888 1071 | 2/19
25 h-m-p 1.6000 8.0000 0.0430 CC 1375.508631 1 0.5978 1112 | 2/19
26 h-m-p 0.9398 8.0000 0.0273 CC 1375.481171 1 1.5045 1153 | 2/19
27 h-m-p 1.6000 8.0000 0.0182 CY 1375.456234 1 1.5649 1194 | 2/19
28 h-m-p 1.6000 8.0000 0.0091 YC 1375.452032 1 0.9241 1234 | 2/19
29 h-m-p 1.6000 8.0000 0.0022 YC 1375.451640 1 1.2367 1274 | 2/19
30 h-m-p 1.6000 8.0000 0.0006 C 1375.451476 0 1.5141 1313 | 2/19
31 h-m-p 1.0146 8.0000 0.0009 C 1375.451425 0 1.2405 1352 | 2/19
32 h-m-p 1.6000 8.0000 0.0002 Y 1375.451420 0 1.1366 1391 | 2/19
33 h-m-p 1.5851 8.0000 0.0001 Y 1375.451419 0 1.1663 1430 | 2/19
34 h-m-p 1.6000 8.0000 0.0000 Y 1375.451419 0 1.0722 1469 | 2/19
35 h-m-p 1.1181 8.0000 0.0000 C 1375.451419 0 1.7284 1508 | 2/19
36 h-m-p 1.6000 8.0000 0.0000 Y 1375.451419 0 1.0735 1547 | 2/19
37 h-m-p 1.6000 8.0000 0.0000 C 1375.451419 0 2.4935 1586 | 2/19
38 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/19
39 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1375.451419
1690 lfun, 18590 eigenQcodon, 270400 P(t)
Time used: 2:54
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
initial w for M8:NSbetaw>1 reset.
0.039572 0.047142 0.000001 0.000000 0.046163 0.006179 0.044971 0.047714 0.008499 0.068760 0.133406 0.117516 0.120272 0.043979 0.035418 0.054346 2.752972 0.900000 0.318342 1.765725 2.851152
ntime & nrate & np: 16 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.958365
np = 21
lnL0 = -1388.050151
Iterating by ming2
Initial: fx= 1388.050151
x= 0.03957 0.04714 0.00000 0.00000 0.04616 0.00618 0.04497 0.04771 0.00850 0.06876 0.13341 0.11752 0.12027 0.04398 0.03542 0.05435 2.75297 0.90000 0.31834 1.76572 2.85115
1 h-m-p 0.0000 0.0000 298.6063 ++ 1388.049104 m 0.0000 47 | 2/21
2 h-m-p 0.0000 0.0001 557.5162 ++ 1381.264208 m 0.0001 92 | 2/21
3 h-m-p 0.0000 0.0001 232.6503 +YCCCC 1378.384445 4 0.0001 143 | 2/21
4 h-m-p 0.0001 0.0006 114.2275 YCCCC 1377.102060 4 0.0003 193 | 2/21
5 h-m-p 0.0006 0.0032 40.2200 CCCC 1376.639922 3 0.0007 242 | 2/21
6 h-m-p 0.0004 0.0042 66.0219 YCCC 1375.687289 3 0.0010 290 | 2/21
7 h-m-p 0.0011 0.0053 45.1019 CCC 1375.535416 2 0.0003 337 | 2/21
8 h-m-p 0.0015 0.0112 10.2632 CC 1375.516549 1 0.0004 382 | 2/21
9 h-m-p 0.0009 0.0265 4.5864 C 1375.506125 0 0.0009 425 | 2/21
10 h-m-p 0.0009 0.0422 4.3283 YC 1375.499526 1 0.0006 469 | 2/21
11 h-m-p 0.0013 0.2937 2.0893 +YCC 1375.427686 2 0.0087 516 | 2/21
12 h-m-p 0.0004 0.0449 43.6890 +YCCC 1374.734417 3 0.0040 565 | 2/21
13 h-m-p 0.0020 0.0110 90.0740 YCCC 1374.189662 3 0.0014 613 | 2/21
14 h-m-p 0.0009 0.0044 84.2535 YCY 1373.987180 2 0.0006 659 | 2/21
15 h-m-p 0.0076 0.0382 3.0380 -C 1373.984981 0 0.0005 703 | 2/21
16 h-m-p 0.0020 0.8715 0.7277 ++CC 1373.972814 1 0.0282 750 | 2/21
17 h-m-p 0.0006 0.0608 34.2728 ++CCCC 1373.708943 3 0.0126 801 | 2/21
18 h-m-p 0.0042 0.0212 79.9542 CC 1373.634210 1 0.0016 846 | 2/21
19 h-m-p 0.3511 5.0656 0.3685 +YCC 1373.442196 2 1.0001 893 | 2/21
20 h-m-p 1.3711 8.0000 0.2688 YC 1373.387923 1 0.6178 937 | 2/21
21 h-m-p 1.0462 8.0000 0.1587 YC 1373.359078 1 0.5913 981 | 2/21
22 h-m-p 0.4505 8.0000 0.2083 +YC 1373.292059 1 2.9681 1026 | 2/21
23 h-m-p 1.6000 8.0000 0.2282 YC 1373.222035 1 3.0899 1070 | 2/21
24 h-m-p 0.6546 3.2732 0.7455 YYC 1373.194877 2 0.5556 1115 | 2/21
25 h-m-p 1.3635 8.0000 0.3038 YC 1373.145980 1 2.5436 1159 | 2/21
26 h-m-p 1.6000 8.0000 0.1356 CCC 1373.111598 2 1.9524 1206 | 2/21
27 h-m-p 0.3795 7.0981 0.6979 +YCC 1373.085235 2 1.1629 1253 | 2/21
28 h-m-p 1.6000 8.0000 0.3257 +YC 1373.053079 1 4.4526 1298 | 2/21
29 h-m-p 1.6000 8.0000 0.5713 YCCC 1373.008508 3 3.4917 1346 | 2/21
30 h-m-p 1.4302 8.0000 1.3946 CCC 1372.986006 2 1.6398 1393 | 2/21
31 h-m-p 1.6000 8.0000 1.2623 CCC 1372.967493 2 1.2319 1440 | 2/21
32 h-m-p 0.8731 8.0000 1.7812 +YC 1372.937254 1 2.9503 1485 | 2/21
33 h-m-p 1.6000 8.0000 2.5485 CCC 1372.914436 2 2.0878 1532 | 2/21
34 h-m-p 1.6000 8.0000 2.6884 CC 1372.901002 1 2.3436 1577 | 2/21
35 h-m-p 1.6000 8.0000 3.3936 +YC 1372.880692 1 4.7345 1622 | 2/21
36 h-m-p 1.6000 8.0000 6.0869 CYC 1372.869127 2 1.8454 1668 | 2/21
37 h-m-p 0.8118 4.0589 10.5044 YC 1372.863809 1 1.3813 1712 | 2/21
38 h-m-p 0.5691 2.8455 9.8844 ++ 1372.856563 m 2.8455 1755 | 3/21
39 h-m-p 1.0208 5.1038 1.0142 -YC 1372.856318 1 0.0355 1800 | 3/21
40 h-m-p 0.9168 8.0000 0.0392 -------------Y 1372.856318 0 0.0000 1855 | 3/21
41 h-m-p 0.0039 1.9677 0.2725 +C 1372.856148 0 0.0167 1898 | 3/21
42 h-m-p 1.2745 8.0000 0.0036 CC 1372.855240 1 1.9900 1942 | 3/21
43 h-m-p 1.6000 8.0000 0.0013 Y 1372.855189 0 1.2484 1984 | 3/21
44 h-m-p 1.6000 8.0000 0.0003 C 1372.855187 0 1.3885 2026 | 3/21
45 h-m-p 1.6000 8.0000 0.0001 ++ 1372.855184 m 8.0000 2068 | 2/21
46 h-m-p 0.0000 0.0000 0.0084
h-m-p: 0.00000000e+00 0.00000000e+00 8.44235690e-03 1372.855184
.. | 2/21
47 h-m-p 0.0023 1.1668 0.0259 Y 1372.855184 0 0.0003 2150 | 2/21
48 h-m-p 0.0099 4.9361 0.0297 --C 1372.855184 0 0.0002 2195 | 2/21
49 h-m-p 0.0160 8.0000 0.0201 -C 1372.855184 0 0.0009 2239 | 2/21
50 h-m-p 0.0160 8.0000 0.0278 -C 1372.855184 0 0.0012 2283 | 2/21
51 h-m-p 0.0045 2.2695 0.0635 C 1372.855184 0 0.0012 2326 | 2/21
52 h-m-p 0.0155 7.7443 0.1282 -C 1372.855183 0 0.0012 2370 | 2/21
53 h-m-p 0.0058 2.9138 0.3615 C 1372.855180 0 0.0021 2413 | 2/21
54 h-m-p 0.0046 2.3053 0.9942 C 1372.855175 0 0.0012 2456 | 2/21
55 h-m-p 0.0055 2.7584 0.9232 Y 1372.855172 0 0.0008 2499 | 2/21
56 h-m-p 0.0037 1.8472 0.5591 Y 1372.855171 0 0.0006 2542 | 2/21
57 h-m-p 0.0115 5.7682 0.1810 -C 1372.855170 0 0.0007 2586 | 2/21
58 h-m-p 0.0160 8.0000 0.0257 -Y 1372.855170 0 0.0007 2630 | 2/21
59 h-m-p 0.0160 8.0000 0.0106 C 1372.855170 0 0.0054 2673 | 2/21
60 h-m-p 0.0160 8.0000 0.1203 Y 1372.855168 0 0.0075 2716 | 2/21
61 h-m-p 0.0143 7.1518 0.7492 C 1372.855158 0 0.0055 2759 | 2/21
62 h-m-p 0.0037 1.8578 4.3534 Y 1372.855141 0 0.0016 2802 | 2/21
63 h-m-p 0.0096 3.0457 0.7256 -Y 1372.855140 0 0.0004 2846 | 2/21
64 h-m-p 0.0178 8.0000 0.0177 ++Y 1372.855132 0 0.2154 2891 | 2/21
65 h-m-p 0.2531 1.2654 0.0002 ++ 1372.855132 m 1.2654 2934 | 3/21
66 h-m-p 1.6000 8.0000 0.0000 C 1372.855132 0 0.4000 2977 | 3/21
67 h-m-p 0.6282 8.0000 0.0000 ---------------Y 1372.855132 0 0.0000 3034
Out..
lnL = -1372.855132
3035 lfun, 36420 eigenQcodon, 534160 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1380.625135 S = -1306.392775 -67.390960
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 107 patterns 5:40
did 20 / 107 patterns 5:40
did 30 / 107 patterns 5:41
did 40 / 107 patterns 5:41
did 50 / 107 patterns 5:41
did 60 / 107 patterns 5:41
did 70 / 107 patterns 5:41
did 80 / 107 patterns 5:42
did 90 / 107 patterns 5:42
did 100 / 107 patterns 5:42
did 107 / 107 patterns 5:42
Time used: 5:42
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=215
D_melanogaster_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_sechellia_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_simulans_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_yakuba_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_erecta_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_takahashii_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_biarmipes_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_eugracilis_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_rhopaloa_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
D_elegans_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE
**************************************************
D_melanogaster_bun-PC VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
D_sechellia_bun-PC VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
D_simulans_bun-PC VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI
D_yakuba_bun-PC VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
D_erecta_bun-PC VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
D_takahashii_bun-PC VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
D_biarmipes_bun-PC VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
D_eugracilis_bun-PC VLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI
D_rhopaloa_bun-PC VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
D_elegans_bun-PC VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI
**********:*********.***************:***:*********
D_melanogaster_bun-PC QAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASAVVP
D_sechellia_bun-PC QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
D_simulans_bun-PC QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP
D_yakuba_bun-PC QAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASAVVP
D_erecta_bun-PC QAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASAAVP
D_takahashii_bun-PC QAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASAVIP
D_biarmipes_bun-PC QAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVP
D_eugracilis_bun-PC QAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASAVVP
D_rhopaloa_bun-PC QAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASAVAP
D_elegans_bun-PC QAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASAVAP
**** *. :***** * * * **:*:*******. *
D_melanogaster_bun-PC TSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTANGP
D_sechellia_bun-PC TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
D_simulans_bun-PC TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP
D_yakuba_bun-PC TSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTANGP
D_erecta_bun-PC TSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTANGP
D_takahashii_bun-PC TIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTTNGP
D_biarmipes_bun-PC TIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTTNGP
D_eugracilis_bun-PC TSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTTNGP
D_rhopaloa_bun-PC TTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTANGP
D_elegans_bun-PC TTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTANGP
* *********.***: ..:.** ::* :. *:***
D_melanogaster_bun-PC MSooooo--------
D_sechellia_bun-PC MS-------------
D_simulans_bun-PC MS-------------
D_yakuba_bun-PC MS-------------
D_erecta_bun-PC MSoooooo-------
D_takahashii_bun-PC MSooo----------
D_biarmipes_bun-PC MSoo-----------
D_eugracilis_bun-PC MSooooooo------
D_rhopaloa_bun-PC MSooooooooooooo
D_elegans_bun-PC MSoooooooooo---
**
>D_melanogaster_bun-PC ATGATGGGCACTATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCTAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGC AGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACGCCCGCCATT CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG TCAGGCAGTTCAG---------CAGCAGGCCGCTGGA------------G CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCA------- --------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCCAATGGTCCC ATGTCC--------------------------------------- >D_sechellia_bun-PC ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT TTGGCAGAAGGGCTACGATAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC AGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCATT CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG TCAGGCAGTTCAA---------CAGCAGTCCGCTGGA------------G CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC ACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAGAC AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGG CAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCAATGGTCCC ATGTCC--------------------------------------- >D_simulans_bun-PC ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT TTGGCAGAAGGGCTACGATAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC AGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCATT CAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCGGG TCAGGCAGTTCAA---------CAGCAGTCCGCTGGA------------G CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC ACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAGAC AGCAGCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCAGCAGCGG CAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCAATGGTCCC ATGTCC--------------------------------------- >D_yakuba_bun-PC ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTATACGAGAT CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGACACTGCAGC AGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACGCCCGCCATT CAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCGGG TCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGGTTGCGGTAG CGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTACCC ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC A---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACTTCAGCA---- --------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCAAACGGTCCC ATGTCC--------------------------------------- >D_erecta_bun-PC ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACACTGCAGC AGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACGCCCGCCATT CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGCTGCCGCGGG TCAGGCAGTTCAG---------CAGCAGCAGGCC------GCTGGAGGAG CGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGCGGTACCC ACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAGTC A---GCGGTATCGGTGGAGCAGCAGGTGCAGCAGGTGACATCA------- --------------GCAGCGGCGGCAGCAGTGGTCACAGCCAATGGTCCC ATGTCC--------------------------------------- >D_takahashii_bun-PC ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC AGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCATC CAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCGGG TCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT------------G CGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCGGTGATCCCA ACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGCTGTCGAGTC AGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG------------- -----GTGACGTCAGCAGCGGCAACAGCGGTAACCACGACCAACGGTCCC ATGTCC--------------------------------------- >D_biarmipes_bun-PC ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT TTGGCAGAAGGGCTACGACAGCCCCTGCTACGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC AGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCATC CAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGCTGCCGCGGG TCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGGTGGCGGTGG CGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCGGTGGTCCCC ACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAGCT GTCAGCGGCAGCGGCGGAGCAGCAGCAG---------------------- -----GTGGCGTCGGCAGCGGCTGGAGCGGCAACCACGACCAACGGCCCC ATGTCC--------------------------------------- >D_eugracilis_bun-PC ATGATGGGCACAATGTCGCTGCGCCAGCCAGAGAATTGGCTCTACGAGAT TTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAACAAGCTGGA GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC AGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACGCCAGCCATT CAAGCGGCGCCG---GCGGCAACG---------------ACTGCCGCGGG TCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA------------A CGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCGGTGGTCCCC ACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGCAGTCGAGTC AGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAG---------- -----GTGACGTCAGCAGCGGCAACAGCGGTAACCACAACCAATGGTCCC ATGTCC--------------------------------------- >D_rhopaloa_bun-PC ATGATGGGCACAATGTCGCTCCGCCAGCCAGAGAATTGGCTCTACGAGAT CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC AGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACGCCCGCCATT CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCGGG TCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA------------- -----GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCAGTGGCGCCC ACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCAAGTC A---GCGGTGGCGGTGGAGCAG------CAGCAGGTG------------- --------------ACGTCAGCAGCAGCGGTACCCACAGCAAACGGTCCC ATGTCC--------------------------------------- >D_elegans_bun-PC ATGATGGGCACAATGTCGCTCCGCCAGCCAGAGAATTGGCTCTACGAAAT CTGGCAGAAGGGCTACGACAGCCCCTGCTATGTGATGGTGCCCAATGCAA AAGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGGAA GTTCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTGGA GCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCAGC AGTTGCAGATGCAGCTCCAAGTGGCCGCTCCCCCGGCCACGCCCGCCATT CAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCGGG TCAGGCAGGGCAGGGTGGT---CAGGTGGCCGCCGGT------------- -----GCGGTGACGGGAGTTGCCACCAGTCCAGCGTCCGCAGTGGCGCCC ACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAGTC A---GCGGTAGCGGTGGAGCAG------CAGCATGTGGCGGCAGCA---- --------------ACAGCAGCAGCAGCGGTACCCACAGCCAACGGACCT ATGTCC---------------------------------------
>D_melanogaster_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI QAAP-AVQSVVAPAAAGQAVQ---QQAAG----AVAVTGVATSPASAVVP TSIPNGSAENGSSAVESAAVSVEQQVQQVTS-----AAAAAASVVTANGP MS >D_sechellia_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP MS >D_simulans_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAI QAAP-AVQSVVAPAAAGQAVQ---QQSAG----AVAVTGVATSPASAVVP TSIPNGSAENGSSAVETAAVSVEQQVQQVTSAAAAAAAAAAASVVTANGP MS >D_yakuba_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI QAAPAAVQSAVAPAAAGQAVQ---QQAAGAVAVAVAVTGVATSPASAVVP TSIPNGSAENGSSAVES-AVSVEQQVQQVTSA----AAAAAAAAVTANGP MS >D_erecta_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI QAAP-AVQSAVAPAAAGQAVQ---QQQA--AGGAVAVTGVATSPASAAVP TSIPNGSAENGSSAVES-AVSVEQQVQQVTS-------AAAAAVVTANGP MS >D_takahashii_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI QAAP-AVQSAVAPAAAGQAVQGGQQQTAG----AVAVTGVATSPASAVIP TIIPNGSAENGGSAVESAAVSVEQQQQQQ------VTSAAATAVTTTNGP MS >D_biarmipes_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI QAAP-AVQSAVASAAAGQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVP TIIPNGSAENGGSAVELSAAAAEQQQ---------VASAAAGAATTTNGP MS >D_eugracilis_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMEKINKLELENNILKSNIPQETLQQLQMQLQIAAPPATPAI QAAP-AAT-----TAAGQAVQGGQQQTAG----TVAVTGLATSPASAVVP TSIPNGSAENGGSAVESVVVSVEQQQQQQQ-----VTSAAATAVTTTNGP MS >D_rhopaloa_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI QAAP-AVQSAVA-AAAGQAAQGG-QVAAG------AVTGVATSPASAVAP TTIPNGSAENGGSAVKS-AVAVEQ--QQV---------TSAAAVPTANGP MS >D_elegans_bun-PC MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVE VLKERISELMDKINKLELENNILKSNIPQETLQQLQMQLQVAAPPATPAI QAAP-AVQSAVA-AAAGQAGQGG-QVAAG------AVTGVATSPASAVAP TTIPNGSAENGGSAVES-AVAVEQ--QHVAAA------TAAAAVPTANGP MS
#NEXUS
[ID: 2739748591]
begin taxa;
dimensions ntax=10;
taxlabels
D_melanogaster_bun-PC
D_sechellia_bun-PC
D_simulans_bun-PC
D_yakuba_bun-PC
D_erecta_bun-PC
D_takahashii_bun-PC
D_biarmipes_bun-PC
D_eugracilis_bun-PC
D_rhopaloa_bun-PC
D_elegans_bun-PC
;
end;
begin trees;
translate
1 D_melanogaster_bun-PC,
2 D_sechellia_bun-PC,
3 D_simulans_bun-PC,
4 D_yakuba_bun-PC,
5 D_erecta_bun-PC,
6 D_takahashii_bun-PC,
7 D_biarmipes_bun-PC,
8 D_eugracilis_bun-PC,
9 D_rhopaloa_bun-PC,
10 D_elegans_bun-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01642508,(2:0.001457765,3:0.001419798)1.000:0.02063851,((4:0.02518666,((6:0.03668431,7:0.0913548,8:0.07281554)0.693:0.01999417,(9:0.02747447,10:0.02842372)1.000:0.08687372)1.000:0.04629726)0.740:0.01395407,5:0.03630926)1.000:0.02797251);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01642508,(2:0.001457765,3:0.001419798):0.02063851,((4:0.02518666,((6:0.03668431,7:0.0913548,8:0.07281554):0.01999417,(9:0.02747447,10:0.02842372):0.08687372):0.04629726):0.01395407,5:0.03630926):0.02797251);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1785.13 -1801.27
2 -1784.96 -1803.44
--------------------------------------
TOTAL -1785.04 -1802.85
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.581602 0.006099 0.440886 0.737678 0.574211 1326.95 1413.98 1.000
r(A<->C){all} 0.116460 0.000830 0.065372 0.176433 0.114980 917.72 935.04 1.000
r(A<->G){all} 0.283141 0.002160 0.194390 0.371155 0.281966 691.78 793.11 1.000
r(A<->T){all} 0.179412 0.001817 0.098364 0.264455 0.176990 624.37 803.54 1.000
r(C<->G){all} 0.030736 0.000144 0.008551 0.053751 0.029551 1181.06 1186.23 1.000
r(C<->T){all} 0.314199 0.002745 0.220042 0.421601 0.311335 722.05 787.86 1.000
r(G<->T){all} 0.076052 0.000629 0.030283 0.123347 0.073424 679.62 841.29 1.000
pi(A){all} 0.213352 0.000233 0.184588 0.243273 0.212914 1100.47 1216.89 1.000
pi(C){all} 0.291931 0.000308 0.257384 0.324839 0.291609 1350.77 1371.94 1.000
pi(G){all} 0.344712 0.000354 0.309174 0.381064 0.344756 1232.42 1252.98 1.000
pi(T){all} 0.150006 0.000193 0.121740 0.175841 0.149616 829.14 914.82 1.001
alpha{1,2} 0.238626 0.008369 0.098109 0.440404 0.224758 909.93 974.09 1.000
alpha{3} 1.790466 0.702420 0.380481 3.434864 1.646187 1058.30 1088.41 1.000
pinvar{all} 0.321774 0.014547 0.067510 0.525933 0.335492 912.53 928.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/28/bun-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 10 ls = 171
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 3 4 4 3 3 3 | TAC 2 2 2 2 2 2 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 0 0 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 0 0 0 | TCG 5 5 5 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 1 0 1 0 | Pro CCT 1 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 4 3 3 4 4 5 | CCC 5 6 6 6 6 6 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 3 2 2 1 0 0 | CCA 2 2 2 2 2 3 | Gln CAA 3 4 4 1 0 1 | CGA 0 0 0 0 0 0
CTG 6 7 7 7 7 7 | CCG 4 4 4 4 4 3 | CAG 12 11 11 14 16 14 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 3 4 3 | Thr ACT 1 0 0 1 0 0 | Asn AAT 3 3 3 2 3 3 | Ser AGT 2 3 3 2 2 2
ATC 3 3 3 4 4 6 | ACC 1 1 1 1 1 4 | AAC 5 5 5 7 6 6 | AGC 5 4 4 4 4 2
ATA 1 1 1 2 1 2 | ACA 2 3 3 2 3 3 | Lys AAA 2 2 2 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 8 8 8 | ACG 3 4 4 3 3 4 | AAG 5 5 5 6 6 6 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 2 2 2 2 1 3 | Asp GAT 1 2 2 1 1 1 | Gly GGT 3 3 3 3 3 2
GTC 3 3 3 3 3 2 | GCC 8 8 8 8 9 7 | GAC 2 1 1 2 2 2 | GGC 4 4 4 4 4 5
GTA 5 4 4 4 4 4 | GCA 9 7 7 8 6 4 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 1
GTG 8 9 9 8 8 8 | GCG 8 9 9 11 12 11 | GAG 12 12 12 12 12 12 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 | Ser TCT 0 0 0 0 | Tyr TAT 0 1 1 1 | Cys TGT 0 0 0 0
TTC 0 0 0 0 | TCC 3 2 3 3 | TAC 3 2 2 2 | TGC 1 1 1 1
Leu TTA 0 1 0 0 | TCA 0 2 2 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 0 1 1 1 | TCG 3 4 3 3 | TAG 0 0 0 0 | Trp TGG 2 2 2 2
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 0 0 0 1 | His CAT 1 1 1 1 | Arg CGT 0 0 0 0
CTC 4 3 5 5 | CCC 8 6 8 7 | CAC 0 0 0 0 | CGC 3 3 3 3
CTA 0 2 0 0 | CCA 1 3 2 2 | Gln CAA 0 1 1 1 | CGA 0 0 0 0
CTG 9 6 6 6 | CCG 3 3 3 3 | CAG 15 13 13 13 | CGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Ile ATT 3 5 3 3 | Thr ACT 0 1 0 0 | Asn AAT 2 3 2 2 | Ser AGT 1 2 1 2
ATC 6 3 3 4 | ACC 3 4 2 2 | AAC 7 6 7 7 | AGC 3 3 3 2
ATA 1 1 2 1 | ACA 1 3 2 3 | Lys AAA 1 2 1 1 | Arg AGA 0 0 0 0
Met ATG 8 8 8 8 | ACG 4 5 5 4 | AAG 6 5 7 6 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 1 0 2 2 | Ala GCT 3 1 1 2 | Asp GAT 1 1 1 1 | Gly GGT 1 3 2 1
GTC 3 3 2 2 | GCC 9 7 9 9 | GAC 2 1 2 2 | GGC 7 4 5 5
GTA 0 5 3 3 | GCA 6 6 7 7 | Glu GAA 1 2 1 2 | GGA 1 1 1 2
GTG 9 7 9 9 | GCG 13 10 12 11 | GAG 12 12 11 11 | GGG 0 0 0 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_bun-PC
position 1: T:0.09357 C:0.25731 A:0.25731 G:0.39181
position 2: T:0.26901 C:0.32164 A:0.29240 G:0.11696
position 3: T:0.11696 C:0.28655 A:0.16959 G:0.42690
Average T:0.15984 C:0.28850 A:0.23977 G:0.31189
#2: D_sechellia_bun-PC
position 1: T:0.09357 C:0.25731 A:0.26316 G:0.38596
position 2: T:0.26901 C:0.32164 A:0.29240 G:0.11696
position 3: T:0.12281 C:0.28070 A:0.15205 G:0.44444
Average T:0.16179 C:0.28655 A:0.23587 G:0.31579
#3: D_simulans_bun-PC
position 1: T:0.09357 C:0.25731 A:0.26316 G:0.38596
position 2: T:0.26901 C:0.32164 A:0.29240 G:0.11696
position 3: T:0.12281 C:0.28070 A:0.15205 G:0.44444
Average T:0.16179 C:0.28655 A:0.23587 G:0.31579
#4: D_yakuba_bun-PC
position 1: T:0.08187 C:0.25146 A:0.26901 G:0.39766
position 2: T:0.26316 C:0.32749 A:0.29825 G:0.11111
position 3: T:0.09942 C:0.30409 A:0.13450 G:0.46199
Average T:0.14815 C:0.29435 A:0.23392 G:0.32359
#5: D_erecta_bun-PC
position 1: T:0.08187 C:0.25731 A:0.26901 G:0.39181
position 2: T:0.26316 C:0.32164 A:0.30409 G:0.11111
position 3: T:0.10526 C:0.30409 A:0.11111 G:0.47953
Average T:0.15010 C:0.29435 A:0.22807 G:0.32749
#6: D_takahashii_bun-PC
position 1: T:0.08187 C:0.25146 A:0.29240 G:0.37427
position 2: T:0.26901 C:0.32749 A:0.29825 G:0.10526
position 3: T:0.09942 C:0.31579 A:0.12281 G:0.46199
Average T:0.15010 C:0.29825 A:0.23782 G:0.31384
#7: D_biarmipes_bun-PC
position 1: T:0.07018 C:0.25731 A:0.26901 G:0.40351
position 2: T:0.25731 C:0.33333 A:0.29825 G:0.11111
position 3: T:0.07602 C:0.36257 A:0.07018 G:0.49123
Average T:0.13450 C:0.31774 A:0.21248 G:0.33528
#8: D_eugracilis_bun-PC
position 1: T:0.09357 C:0.23977 A:0.29825 G:0.36842
position 2: T:0.26316 C:0.33333 A:0.29240 G:0.11111
position 3: T:0.10526 C:0.28070 A:0.16959 G:0.44444
Average T:0.15400 C:0.28460 A:0.25341 G:0.30799
#9: D_rhopaloa_bun-PC
position 1: T:0.08772 C:0.24561 A:0.26901 G:0.39766
position 2: T:0.25731 C:0.34503 A:0.29240 G:0.10526
position 3: T:0.08187 C:0.32164 A:0.12865 G:0.46784
Average T:0.14230 C:0.30409 A:0.23002 G:0.32359
#10: D_elegans_bun-PC
position 1: T:0.08187 C:0.24561 A:0.26316 G:0.40936
position 2: T:0.25731 C:0.33918 A:0.29240 G:0.11111
position 3: T:0.09357 C:0.31579 A:0.13450 G:0.45614
Average T:0.14425 C:0.30019 A:0.23002 G:0.32554
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 9 | Cys C TGT 0
TTC 0 | TCC 31 | TAC 21 | TGC 10
Leu L TTA 1 | TCA 9 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 40 | TAG 0 | Trp W TGG 20
------------------------------------------------------------------------------
Leu L CTT 3 | Pro P CCT 2 | His H CAT 10 | Arg R CGT 0
CTC 40 | CCC 64 | CAC 0 | CGC 30
CTA 10 | CCA 21 | Gln Q CAA 16 | CGA 0
CTG 68 | CCG 35 | CAG 132 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 36 | Thr T ACT 3 | Asn N AAT 26 | Ser S AGT 20
ATC 39 | ACC 20 | AAC 61 | AGC 34
ATA 13 | ACA 25 | Lys K AAA 14 | Arg R AGA 0
Met M ATG 77 | ACG 39 | AAG 57 | AGG 0
------------------------------------------------------------------------------
Val V GTT 11 | Ala A GCT 19 | Asp D GAT 12 | Gly G GGT 24
GTC 27 | GCC 82 | GAC 17 | GGC 46
GTA 36 | GCA 67 | Glu E GAA 12 | GGA 6
GTG 84 | GCG 106 | GAG 118 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.08596 C:0.25205 A:0.27135 G:0.39064
position 2: T:0.26374 C:0.32924 A:0.29532 G:0.11170
position 3: T:0.10234 C:0.30526 A:0.13450 G:0.45789
Average T:0.15068 C:0.29552 A:0.23372 G:0.32008
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_bun-PC
D_sechellia_bun-PC 0.0519 (0.0052 0.1004)
D_simulans_bun-PC 0.0519 (0.0052 0.1004)-1.0000 (0.0000 0.0000)
D_yakuba_bun-PC 0.1017 (0.0131 0.1285) 0.1330 (0.0184 0.1380) 0.1330 (0.0184 0.1380)
D_erecta_bun-PC 0.1373 (0.0197 0.1432) 0.1794 (0.0223 0.1244) 0.1794 (0.0223 0.1244) 0.0936 (0.0117 0.1252)
D_takahashii_bun-PC 0.1536 (0.0318 0.2068) 0.1753 (0.0345 0.1967) 0.1753 (0.0345 0.1967) 0.1597 (0.0237 0.1481) 0.1691 (0.0276 0.1634)
D_biarmipes_bun-PC 0.1596 (0.0441 0.2763) 0.1888 (0.0487 0.2579) 0.1888 (0.0487 0.2579) 0.1429 (0.0304 0.2127) 0.2150 (0.0426 0.1980) 0.1822 (0.0277 0.1521)
D_eugracilis_bun-PC 0.2448 (0.0455 0.1857) 0.2460 (0.0482 0.1960) 0.2460 (0.0482 0.1960) 0.1705 (0.0372 0.2180) 0.2136 (0.0412 0.1929) 0.1341 (0.0237 0.1766) 0.2012 (0.0468 0.2327)
D_rhopaloa_bun-PC 0.1518 (0.0427 0.2815) 0.1712 (0.0482 0.2817) 0.1712 (0.0482 0.2817) 0.1908 (0.0385 0.2020) 0.1978 (0.0453 0.2292) 0.2024 (0.0422 0.2085) 0.1941 (0.0482 0.2485) 0.2743 (0.0594 0.2165)
D_elegans_bun-PC 0.1378 (0.0373 0.2703) 0.1516 (0.0427 0.2819) 0.1516 (0.0427 0.2819) 0.1354 (0.0331 0.2445) 0.1738 (0.0399 0.2293) 0.1600 (0.0367 0.2297) 0.1796 (0.0427 0.2378) 0.2483 (0.0538 0.2165) 0.0947 (0.0078 0.0827)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
check convergence..
lnL(ntime: 16 np: 18): -1395.776798 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.035769 0.049358 0.000004 0.000004 0.046394 0.010213 0.040357 0.061004 0.014941 0.067660 0.146162 0.138632 0.146388 0.048699 0.032431 0.067488 2.833931 0.136401
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.90550
(1: 0.035769, (2: 0.000004, 3: 0.000004): 0.049358, ((4: 0.040357, ((6: 0.067660, 7: 0.146162, 8: 0.138632): 0.014941, (9: 0.048699, 10: 0.032431): 0.146388): 0.061004): 0.010213, 5: 0.067488): 0.046394);
(D_melanogaster_bun-PC: 0.035769, (D_sechellia_bun-PC: 0.000004, D_simulans_bun-PC: 0.000004): 0.049358, ((D_yakuba_bun-PC: 0.040357, ((D_takahashii_bun-PC: 0.067660, D_biarmipes_bun-PC: 0.146162, D_eugracilis_bun-PC: 0.138632): 0.014941, (D_rhopaloa_bun-PC: 0.048699, D_elegans_bun-PC: 0.032431): 0.146388): 0.061004): 0.010213, D_erecta_bun-PC: 0.067488): 0.046394);
Detailed output identifying parameters
kappa (ts/tv) = 2.83393
omega (dN/dS) = 0.13640
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.036 395.8 117.2 0.1364 0.0049 0.0357 1.9 4.2
11..12 0.049 395.8 117.2 0.1364 0.0067 0.0493 2.7 5.8
12..2 0.000 395.8 117.2 0.1364 0.0000 0.0000 0.0 0.0
12..3 0.000 395.8 117.2 0.1364 0.0000 0.0000 0.0 0.0
11..13 0.046 395.8 117.2 0.1364 0.0063 0.0463 2.5 5.4
13..14 0.010 395.8 117.2 0.1364 0.0014 0.0102 0.6 1.2
14..4 0.040 395.8 117.2 0.1364 0.0055 0.0403 2.2 4.7
14..15 0.061 395.8 117.2 0.1364 0.0083 0.0609 3.3 7.1
15..16 0.015 395.8 117.2 0.1364 0.0020 0.0149 0.8 1.7
16..6 0.068 395.8 117.2 0.1364 0.0092 0.0676 3.6 7.9
16..7 0.146 395.8 117.2 0.1364 0.0199 0.1460 7.9 17.1
16..8 0.139 395.8 117.2 0.1364 0.0189 0.1384 7.5 16.2
15..17 0.146 395.8 117.2 0.1364 0.0199 0.1462 7.9 17.1
17..9 0.049 395.8 117.2 0.1364 0.0066 0.0486 2.6 5.7
17..10 0.032 395.8 117.2 0.1364 0.0044 0.0324 1.7 3.8
13..5 0.067 395.8 117.2 0.1364 0.0092 0.0674 3.6 7.9
tree length for dN: 0.1233
tree length for dS: 0.9043
Time used: 0:10
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
lnL(ntime: 16 np: 19): -1373.722058 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.038337 0.052927 0.000004 0.000004 0.049721 0.010863 0.042804 0.067191 0.013175 0.071554 0.158378 0.147970 0.159860 0.050210 0.033211 0.071682 2.792404 0.882561 0.038432
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.96789
(1: 0.038337, (2: 0.000004, 3: 0.000004): 0.052927, ((4: 0.042804, ((6: 0.071554, 7: 0.158378, 8: 0.147970): 0.013175, (9: 0.050210, 10: 0.033211): 0.159860): 0.067191): 0.010863, 5: 0.071682): 0.049721);
(D_melanogaster_bun-PC: 0.038337, (D_sechellia_bun-PC: 0.000004, D_simulans_bun-PC: 0.000004): 0.052927, ((D_yakuba_bun-PC: 0.042804, ((D_takahashii_bun-PC: 0.071554, D_biarmipes_bun-PC: 0.158378, D_eugracilis_bun-PC: 0.147970): 0.013175, (D_rhopaloa_bun-PC: 0.050210, D_elegans_bun-PC: 0.033211): 0.159860): 0.067191): 0.010863, D_erecta_bun-PC: 0.071682): 0.049721);
Detailed output identifying parameters
kappa (ts/tv) = 2.79240
dN/dS (w) for site classes (K=2)
p: 0.88256 0.11744
w: 0.03843 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.038 395.8 117.2 0.1514 0.0056 0.0370 2.2 4.3
11..12 0.053 395.8 117.2 0.1514 0.0077 0.0511 3.1 6.0
12..2 0.000 395.8 117.2 0.1514 0.0000 0.0000 0.0 0.0
12..3 0.000 395.8 117.2 0.1514 0.0000 0.0000 0.0 0.0
11..13 0.050 395.8 117.2 0.1514 0.0073 0.0480 2.9 5.6
13..14 0.011 395.8 117.2 0.1514 0.0016 0.0105 0.6 1.2
14..4 0.043 395.8 117.2 0.1514 0.0063 0.0413 2.5 4.8
14..15 0.067 395.8 117.2 0.1514 0.0098 0.0649 3.9 7.6
15..16 0.013 395.8 117.2 0.1514 0.0019 0.0127 0.8 1.5
16..6 0.072 395.8 117.2 0.1514 0.0105 0.0691 4.1 8.1
16..7 0.158 395.8 117.2 0.1514 0.0232 0.1529 9.2 17.9
16..8 0.148 395.8 117.2 0.1514 0.0216 0.1429 8.6 16.7
15..17 0.160 395.8 117.2 0.1514 0.0234 0.1544 9.2 18.1
17..9 0.050 395.8 117.2 0.1514 0.0073 0.0485 2.9 5.7
17..10 0.033 395.8 117.2 0.1514 0.0049 0.0321 1.9 3.8
13..5 0.072 395.8 117.2 0.1514 0.0105 0.0692 4.1 8.1
Time used: 0:21
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
lnL(ntime: 16 np: 21): -1372.841264 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.039602 0.054165 0.000004 0.000004 0.051146 0.011410 0.043831 0.069014 0.013553 0.072320 0.163076 0.150197 0.164155 0.050994 0.033702 0.073111 2.813218 0.898593 0.061755 0.045413 2.030393
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99028
(1: 0.039602, (2: 0.000004, 3: 0.000004): 0.054165, ((4: 0.043831, ((6: 0.072320, 7: 0.163076, 8: 0.150197): 0.013553, (9: 0.050994, 10: 0.033702): 0.164155): 0.069014): 0.011410, 5: 0.073111): 0.051146);
(D_melanogaster_bun-PC: 0.039602, (D_sechellia_bun-PC: 0.000004, D_simulans_bun-PC: 0.000004): 0.054165, ((D_yakuba_bun-PC: 0.043831, ((D_takahashii_bun-PC: 0.072320, D_biarmipes_bun-PC: 0.163076, D_eugracilis_bun-PC: 0.150197): 0.013553, (D_rhopaloa_bun-PC: 0.050994, D_elegans_bun-PC: 0.033702): 0.164155): 0.069014): 0.011410, D_erecta_bun-PC: 0.073111): 0.051146);
Detailed output identifying parameters
kappa (ts/tv) = 2.81322
dN/dS (w) for site classes (K=3)
p: 0.89859 0.06176 0.03965
w: 0.04541 1.00000 2.03039
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.040 395.8 117.2 0.1831 0.0065 0.0357 2.6 4.2
11..12 0.054 395.8 117.2 0.1831 0.0089 0.0488 3.5 5.7
12..2 0.000 395.8 117.2 0.1831 0.0000 0.0000 0.0 0.0
12..3 0.000 395.8 117.2 0.1831 0.0000 0.0000 0.0 0.0
11..13 0.051 395.8 117.2 0.1831 0.0084 0.0461 3.3 5.4
13..14 0.011 395.8 117.2 0.1831 0.0019 0.0103 0.7 1.2
14..4 0.044 395.8 117.2 0.1831 0.0072 0.0395 2.9 4.6
14..15 0.069 395.8 117.2 0.1831 0.0114 0.0622 4.5 7.3
15..16 0.014 395.8 117.2 0.1831 0.0022 0.0122 0.9 1.4
16..6 0.072 395.8 117.2 0.1831 0.0119 0.0652 4.7 7.6
16..7 0.163 395.8 117.2 0.1831 0.0269 0.1470 10.7 17.2
16..8 0.150 395.8 117.2 0.1831 0.0248 0.1354 9.8 15.9
15..17 0.164 395.8 117.2 0.1831 0.0271 0.1480 10.7 17.3
17..9 0.051 395.8 117.2 0.1831 0.0084 0.0460 3.3 5.4
17..10 0.034 395.8 117.2 0.1831 0.0056 0.0304 2.2 3.6
13..5 0.073 395.8 117.2 0.1831 0.0121 0.0659 4.8 7.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PC)
Pr(w>1) post mean +- SE for w
118 A 0.852 1.878
136 S 0.512 1.524
151 S 0.704 1.722
161 A 0.704 1.724
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PC)
Pr(w>1) post mean +- SE for w
118 A 0.853 2.496 +- 1.517
151 S 0.720 2.209 +- 1.404
161 A 0.714 2.177 +- 1.361
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.389 0.338 0.137 0.061 0.032 0.018 0.011 0.007 0.005 0.003
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.254
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.030 0.321 0.393
sum of density on p0-p1 = 1.000000
Time used: 1:00
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
lnL(ntime: 16 np: 22): -1372.837274 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.039466 0.054191 0.000004 0.000004 0.051004 0.011347 0.043708 0.068332 0.013967 0.072440 0.162462 0.150298 0.162925 0.050721 0.033539 0.073028 2.830913 0.413495 0.495042 0.048111 0.048112 1.517818
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.98744
(1: 0.039466, (2: 0.000004, 3: 0.000004): 0.054191, ((4: 0.043708, ((6: 0.072440, 7: 0.162462, 8: 0.150298): 0.013967, (9: 0.050721, 10: 0.033539): 0.162925): 0.068332): 0.011347, 5: 0.073028): 0.051004);
(D_melanogaster_bun-PC: 0.039466, (D_sechellia_bun-PC: 0.000004, D_simulans_bun-PC: 0.000004): 0.054191, ((D_yakuba_bun-PC: 0.043708, ((D_takahashii_bun-PC: 0.072440, D_biarmipes_bun-PC: 0.162462, D_eugracilis_bun-PC: 0.150298): 0.013967, (D_rhopaloa_bun-PC: 0.050721, D_elegans_bun-PC: 0.033539): 0.162925): 0.068332): 0.011347, D_erecta_bun-PC: 0.073028): 0.051004);
Detailed output identifying parameters
kappa (ts/tv) = 2.83091
dN/dS (w) for site classes (K=3)
p: 0.41350 0.49504 0.09146
w: 0.04811 0.04811 1.51782
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.039 395.8 117.2 0.1825 0.0065 0.0356 2.6 4.2
11..12 0.054 395.8 117.2 0.1825 0.0089 0.0489 3.5 5.7
12..2 0.000 395.8 117.2 0.1825 0.0000 0.0000 0.0 0.0
12..3 0.000 395.8 117.2 0.1825 0.0000 0.0000 0.0 0.0
11..13 0.051 395.8 117.2 0.1825 0.0084 0.0460 3.3 5.4
13..14 0.011 395.8 117.2 0.1825 0.0019 0.0102 0.7 1.2
14..4 0.044 395.8 117.2 0.1825 0.0072 0.0394 2.8 4.6
14..15 0.068 395.8 117.2 0.1825 0.0113 0.0617 4.5 7.2
15..16 0.014 395.8 117.2 0.1825 0.0023 0.0126 0.9 1.5
16..6 0.072 395.8 117.2 0.1825 0.0119 0.0654 4.7 7.7
16..7 0.162 395.8 117.2 0.1825 0.0268 0.1466 10.6 17.2
16..8 0.150 395.8 117.2 0.1825 0.0248 0.1356 9.8 15.9
15..17 0.163 395.8 117.2 0.1825 0.0268 0.1470 10.6 17.2
17..9 0.051 395.8 117.2 0.1825 0.0084 0.0458 3.3 5.4
17..10 0.034 395.8 117.2 0.1825 0.0055 0.0303 2.2 3.5
13..5 0.073 395.8 117.2 0.1825 0.0120 0.0659 4.8 7.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PC)
Pr(w>1) post mean +- SE for w
91 L 0.921 1.402
107 Q 0.897 1.366
108 A 0.526 0.821
114 V 0.956* 1.453
117 Q 0.858 1.309
118 A 1.000** 1.518
133 V 0.874 1.332
136 S 0.997** 1.513
151 S 0.996** 1.512
154 S 0.841 1.284
161 A 0.999** 1.516
163 V 0.953* 1.449
164 V 0.995** 1.511
Time used: 1:31
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
check convergence..
lnL(ntime: 16 np: 19): -1375.451419 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.037902 0.052275 0.000004 0.000004 0.048992 0.010730 0.042043 0.067180 0.011519 0.071011 0.155106 0.146530 0.158603 0.049764 0.033450 0.070708 2.752972 0.085497 0.477491
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95582
(1: 0.037902, (2: 0.000004, 3: 0.000004): 0.052275, ((4: 0.042043, ((6: 0.071011, 7: 0.155106, 8: 0.146530): 0.011519, (9: 0.049764, 10: 0.033450): 0.158603): 0.067180): 0.010730, 5: 0.070708): 0.048992);
(D_melanogaster_bun-PC: 0.037902, (D_sechellia_bun-PC: 0.000004, D_simulans_bun-PC: 0.000004): 0.052275, ((D_yakuba_bun-PC: 0.042043, ((D_takahashii_bun-PC: 0.071011, D_biarmipes_bun-PC: 0.155106, D_eugracilis_bun-PC: 0.146530): 0.011519, (D_rhopaloa_bun-PC: 0.049764, D_elegans_bun-PC: 0.033450): 0.158603): 0.067180): 0.010730, D_erecta_bun-PC: 0.070708): 0.048992);
Detailed output identifying parameters
kappa (ts/tv) = 2.75297
Parameters in M7 (beta):
p = 0.08550 q = 0.47749
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00002 0.00034 0.00358 0.02500 0.12657 0.44765 0.91638
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.038 395.9 117.1 0.1520 0.0056 0.0366 2.2 4.3
11..12 0.052 395.9 117.1 0.1520 0.0077 0.0504 3.0 5.9
12..2 0.000 395.9 117.1 0.1520 0.0000 0.0000 0.0 0.0
12..3 0.000 395.9 117.1 0.1520 0.0000 0.0000 0.0 0.0
11..13 0.049 395.9 117.1 0.1520 0.0072 0.0473 2.8 5.5
13..14 0.011 395.9 117.1 0.1520 0.0016 0.0104 0.6 1.2
14..4 0.042 395.9 117.1 0.1520 0.0062 0.0406 2.4 4.7
14..15 0.067 395.9 117.1 0.1520 0.0098 0.0648 3.9 7.6
15..16 0.012 395.9 117.1 0.1520 0.0017 0.0111 0.7 1.3
16..6 0.071 395.9 117.1 0.1520 0.0104 0.0685 4.1 8.0
16..7 0.155 395.9 117.1 0.1520 0.0227 0.1497 9.0 17.5
16..8 0.147 395.9 117.1 0.1520 0.0215 0.1414 8.5 16.6
15..17 0.159 395.9 117.1 0.1520 0.0233 0.1530 9.2 17.9
17..9 0.050 395.9 117.1 0.1520 0.0073 0.0480 2.9 5.6
17..10 0.033 395.9 117.1 0.1520 0.0049 0.0323 1.9 3.8
13..5 0.071 395.9 117.1 0.1520 0.0104 0.0682 4.1 8.0
Time used: 2:54
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, ((6, 7, 8), (9, 10))), 5)); MP score: 129
lnL(ntime: 16 np: 21): -1372.855132 +0.000000
11..1 11..12 12..2 12..3 11..13 13..14 14..4 14..15 15..16 16..6 16..7 16..8 15..17 17..9 17..10 13..5
0.039461 0.054175 0.000004 0.000004 0.050995 0.011348 0.043697 0.068344 0.013930 0.072431 0.162434 0.150258 0.162949 0.050739 0.033558 0.073010 2.828046 0.909984 5.161225 99.000000 1.530659
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.98734
(1: 0.039461, (2: 0.000004, 3: 0.000004): 0.054175, ((4: 0.043697, ((6: 0.072431, 7: 0.162434, 8: 0.150258): 0.013930, (9: 0.050739, 10: 0.033558): 0.162949): 0.068344): 0.011348, 5: 0.073010): 0.050995);
(D_melanogaster_bun-PC: 0.039461, (D_sechellia_bun-PC: 0.000004, D_simulans_bun-PC: 0.000004): 0.054175, ((D_yakuba_bun-PC: 0.043697, ((D_takahashii_bun-PC: 0.072431, D_biarmipes_bun-PC: 0.162434, D_eugracilis_bun-PC: 0.150258): 0.013930, (D_rhopaloa_bun-PC: 0.050739, D_elegans_bun-PC: 0.033558): 0.162949): 0.068344): 0.011348, D_erecta_bun-PC: 0.073010): 0.050995);
Detailed output identifying parameters
kappa (ts/tv) = 2.82805
Parameters in M8 (beta&w>1):
p0 = 0.90998 p = 5.16122 q = 99.00000
(p1 = 0.09002) w = 1.53066
dN/dS (w) for site classes (K=11)
p: 0.09100 0.09100 0.09100 0.09100 0.09100 0.09100 0.09100 0.09100 0.09100 0.09100 0.09002
w: 0.02029 0.02836 0.03408 0.03917 0.04414 0.04932 0.05507 0.06193 0.07122 0.08860 1.53066
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
11..1 0.039 395.8 117.2 0.1826 0.0065 0.0356 2.6 4.2
11..12 0.054 395.8 117.2 0.1826 0.0089 0.0489 3.5 5.7
12..2 0.000 395.8 117.2 0.1826 0.0000 0.0000 0.0 0.0
12..3 0.000 395.8 117.2 0.1826 0.0000 0.0000 0.0 0.0
11..13 0.051 395.8 117.2 0.1826 0.0084 0.0460 3.3 5.4
13..14 0.011 395.8 117.2 0.1826 0.0019 0.0102 0.7 1.2
14..4 0.044 395.8 117.2 0.1826 0.0072 0.0394 2.8 4.6
14..15 0.068 395.8 117.2 0.1826 0.0113 0.0617 4.5 7.2
15..16 0.014 395.8 117.2 0.1826 0.0023 0.0126 0.9 1.5
16..6 0.072 395.8 117.2 0.1826 0.0119 0.0654 4.7 7.7
16..7 0.162 395.8 117.2 0.1826 0.0268 0.1466 10.6 17.2
16..8 0.150 395.8 117.2 0.1826 0.0248 0.1356 9.8 15.9
15..17 0.163 395.8 117.2 0.1826 0.0268 0.1470 10.6 17.2
17..9 0.051 395.8 117.2 0.1826 0.0084 0.0458 3.3 5.4
17..10 0.034 395.8 117.2 0.1826 0.0055 0.0303 2.2 3.6
13..5 0.073 395.8 117.2 0.1826 0.0120 0.0659 4.8 7.7
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PC)
Pr(w>1) post mean +- SE for w
91 L 0.906 1.392
107 Q 0.878 1.351
108 A 0.517 0.819
114 V 0.948 1.454
117 Q 0.834 1.287
118 A 1.000** 1.531
133 V 0.852 1.313
136 S 0.995** 1.523
151 S 0.995** 1.523
154 S 0.814 1.258
161 A 0.998** 1.528
163 V 0.944 1.449
164 V 0.993** 1.520
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PC)
Pr(w>1) post mean +- SE for w
114 V 0.585 1.598 +- 1.143
118 A 0.970* 2.417 +- 1.008
136 S 0.683 1.780 +- 1.026
151 S 0.884 2.269 +- 1.094
161 A 0.891 2.279 +- 1.076
163 V 0.554 1.517 +- 1.110
164 V 0.637 1.687 +- 1.030
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.993
p : 0.993 0.007 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.002 0.026 0.078 0.131 0.169 0.191 0.200 0.203
ws: 0.343 0.457 0.140 0.038 0.012 0.005 0.002 0.001 0.001 0.000
Time used: 5:42
Model 1: NearlyNeutral -1373.722058 Model 2: PositiveSelection -1372.841264 Model 0: one-ratio -1395.776798 Model 3: discrete -1372.837274 Model 7: beta -1375.451419 Model 8: beta&w>1 -1372.855132 Model 0 vs 1 44.109480000000076 Model 2 vs 1 1.7615880000003017 Model 8 vs 7 5.19257400000015
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
