--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Nov 19 01:43:37 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/28/bun-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2013.09 -2026.58
2 -2013.03 -2028.11
--------------------------------------
TOTAL -2013.06 -2027.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.491270 0.002971 0.384460 0.598395 0.487948 1140.48 1320.74 1.000
r(A<->C){all} 0.109884 0.000650 0.060995 0.157733 0.107649 972.10 974.11 1.001
r(A<->G){all} 0.238689 0.001415 0.169356 0.314825 0.236885 900.22 959.23 1.001
r(A<->T){all} 0.132327 0.001136 0.069231 0.199724 0.128943 911.89 986.11 1.000
r(C<->G){all} 0.039563 0.000203 0.013796 0.067283 0.038049 819.01 876.29 1.000
r(C<->T){all} 0.405286 0.002302 0.314696 0.499111 0.406139 706.84 778.93 1.000
r(G<->T){all} 0.074251 0.000526 0.031648 0.119302 0.072666 846.88 931.50 1.000
pi(A){all} 0.253035 0.000226 0.223141 0.281496 0.252947 1085.67 1262.78 1.001
pi(C){all} 0.271081 0.000247 0.241559 0.301340 0.271071 1231.21 1366.11 1.000
pi(G){all} 0.310385 0.000262 0.277411 0.340441 0.310434 1255.58 1298.38 1.000
pi(T){all} 0.165499 0.000163 0.140098 0.190442 0.165074 1142.78 1200.19 1.000
alpha{1,2} 0.182041 0.006366 0.000190 0.319356 0.176080 868.24 891.75 1.000
alpha{3} 1.585450 0.506128 0.496327 2.974763 1.461350 1071.41 1075.76 1.000
pinvar{all} 0.248030 0.014776 0.008907 0.442759 0.254655 837.62 992.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1574.979545
Model 2: PositiveSelection -1573.957516
Model 0: one-ratio -1598.380834
Model 3: discrete -1574.131701
Model 7: beta -1575.738712
Model 8: beta&w>1 -1574.139136
Model 0 vs 1 46.80257800000027
Model 2 vs 1 2.04405799999995
Model 8 vs 7 3.19915200000014
>C1
MKTETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDASG
TSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELEN
SILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPAVQSVVAPAAAGQAVQ
QQAAGAVAVTGVATSPASAVVPTSIPNGSAENGSSAVESAAVSVEQQVQQ
VTSAAAAAASVVTANGPMSooooooo
>C2
MKAETGSNNNNTTVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDASG
TSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELEN
SILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPAVQSVVAPAAAGQAVQ
QQSAGAVAVTGVATSPASAVVPTSIPNGSAENGSSAVETAAVSVEQQVQQ
VTSAAAAAAAAAAASVVTANGPMSoo
>C3
MKAETGSNNNNTTVVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDAS
GTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELE
NSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPAVQSVVAPAAAGQAV
QQQSAGAVAVTGVATSPASAVVPTSIPNGSAENGSSAVETAAVSVEQQVQ
QVTSAAAAAAAAAAASVVTANGPMSo
>C4
MKTETGSNNNNNNTTGGNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDA
SGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLEL
ENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAAVQSAVAPAAAGQ
AVQQQAAGAVAVAVAVTGVATSPASAVVPTSIPNGSAENGSSAVESAVSV
EQQVQQVTSAAAAAAAAAVTANGPMS
>C5
MKTETGSNNNHNNTIVNMDFDMYPSISGKQQDPVREVVMKYIDYFLPDAS
GTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELE
NNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAVQSAVAPAAAGQAV
QQQQAAGGAVAVTGVATSPASAAVPTSIPNGSAENGSSAVESAVSVEQQV
QQVTSAAAAAVVTANGPMSooooooo
>C6
MKTETGSNNNNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLPDA
SGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLEL
ENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAVQSAVAPAAAGQA
VQGGQQQTAGAVAVTGVATSPASAVIPTIIPNGSAENGGSAVESAAVSVE
QQQQQQVTSAAATAVTTTNGPMSooo
>C7
MKTETGSNNNNNTGRKMDFDMYPSLSGKQQDPVREVVMKYIDYFLPDASG
TSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELEN
NILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAVQSAVASAAAGQAVQ
AGQQQAAGAVAVAVAVAGVATSPASAVVPTIIPNGSAENGGSAVELSAAA
AEQQQVASAAAGAATTTNGPMSoooo
>C8
MKTETGSNNNINNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMEKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAATTAAGQAVQG
GQQQTAGTVAVTGLATSPASAVVPTSIPNGSAENGGSAVESVVVSVEQQQ
QQQQVTSAAATAVTTTNGPMSooooo
>C9
MKAETGSNNNNNINTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLPDA
SGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLEL
ENNILKSNIPQETLQQLQMQLQVAAPPATPAIQAAPAVQSAVAAAAGQAA
QGGQVAAGAVTGVATSPASAVAPTTIPNGSAENGGSAVKSAVAVEQQQVT
SAAAVPTANGPMSooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=9, Len=251
C1 MKTETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
C2 MKAETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
C3 MKAETGSNNN-NTTV--VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
C4 MKTETGSNNNNNNTT--GGNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
C5 MKTETGSNNNHNNTI--V-NMDFDMYPSISGKQQDPVREVVMKYIDYFLP
C6 MKTETGSNN--NNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
C7 MKTETGSNNN-NNT---GRKMDFDMYPSLSGKQQDPVREVVMKYIDYFLP
C8 MKTETGSNNNINNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
C9 MKAETGSNNNNNINT--VSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
**:****** * . :********:*********************
C1 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
C2 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
C3 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
C4 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
C5 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
C6 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
C7 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
C8 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMEKINKL
C9 DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
********************************************:*****
C1 ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
C2 ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
C3 ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
C4 ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAAVQSAVAPAAA
C5 ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
C6 ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
C7 ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVASAAA
C8 ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AAT-----TAA
C9 ELENNILKSNIPQETLQQLQMQLQVAAPPATPAIQAAP-AVQSAVA-AAA
****.***************:***:************* *. :**
C1 GQAVQ---QQAAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
C2 GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
C3 GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
C4 GQAVQ---QQAAGAVAVAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
C5 GQAVQ---QQQA--AGGAVAVTGVATSPASAAVPTSIPNGSAENGSSAVE
C6 GQAVQGGQQQTAG----AVAVTGVATSPASAVIPTIIPNGSAENGGSAVE
C7 GQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVPTIIPNGSAENGGSAVE
C8 GQAVQGGQQQTAG----TVAVTGLATSPASAVVPTSIPNGSAENGGSAVE
C9 GQAAQGG-QVAAG------AVTGVATSPASAVAPTTIPNGSAENGGSAVK
***.* * * **:*:*******. ** *********.***:
C1 SAAVSVEQQ--VQQVTS-----AAAAAASVVTANGPMSooooooo-----
C2 TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSoo----------
C3 TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSo-----------
C4 S-AVSVEQQ--VQQVTSA----AAAAAAAAVTANGPMS------------
C5 S-AVSVEQQ--VQQVTS-------AAAAAVVTANGPMSooooooo-----
C6 SAAVSVEQQQQQQ-VTS-------AAATAVTTTNGPMSooo---------
C7 LSAAAAEQ----QQVAS-------AAAGAATTTNGPMSoooo--------
C8 SVVVSVEQQQQQQQVTS-------AAATAVTTTNGPMSooooo-------
C9 S-AVAVEQQ----QVTS---------AAAVPTANGPMSoooooooooooo
..:.** *:* * :. *:*****
C1 -
C2 -
C3 -
C4 -
C5 -
C6 -
C7 -
C8 -
C9 o
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 226 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [24670]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [24670]--->[22856]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/28/bun-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.505 Mb, Max= 31.118 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MKTETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
GQAVQ---QQAAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
SAAVSVEQQ--VQQVTS-----AAAAAASVVTANGPMSooooooo-----
-
>C2
MKAETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSoo----------
-
>C3
MKAETGSNNN-NTTV--VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSo-----------
-
>C4
MKTETGSNNNNNNTT--GGNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAAVQSAVAPAAA
GQAVQ---QQAAGAVAVAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
S-AVSVEQQ--VQQVTSA----AAAAAAAAVTANGPMS------------
-
>C5
MKTETGSNNNHNNTI--V-NMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
GQAVQ---QQQA--AGGAVAVTGVATSPASAAVPTSIPNGSAENGSSAVE
S-AVSVEQQ--VQQVTS-------AAAAAVVTANGPMSooooooo-----
-
>C6
MKTETGSNN--NNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
GQAVQGGQQQTAG----AVAVTGVATSPASAVIPTIIPNGSAENGGSAVE
SAAVSVEQQQQQQ-VTS-------AAATAVTTTNGPMSooo---------
-
>C7
MKTETGSNNN-NNT---GRKMDFDMYPSLSGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVASAAA
GQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVPTIIPNGSAENGGSAVE
LSAAAAEQ----QQVAS-------AAAGAATTTNGPMSoooo--------
-
>C8
MKTETGSNNNINNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMEKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AAT-----TAA
GQAVQGGQQQTAG----TVAVTGLATSPASAVVPTSIPNGSAENGGSAVE
SVVVSVEQQQQQQQVTS-------AAATAVTTTNGPMSooooo-------
-
>C9
MKAETGSNNNNNINT--VSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQVAAPPATPAIQAAP-AVQSAVA-AAA
GQAAQGG-QVAAG------AVTGVATSPASAVAPTTIPNGSAENGGSAVK
S-AVAVEQQ----QVTS---------AAAVPTANGPMSoooooooooooo
o
FORMAT of file /tmp/tmp8159342912683390466aln Not Supported[FATAL:T-COFFEE]
>C1
MKTETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
GQAVQ---QQAAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
SAAVSVEQQ--VQQVTS-----AAAAAASVVTANGPMSooooooo-----
-
>C2
MKAETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSoo----------
-
>C3
MKAETGSNNN-NTTV--VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSo-----------
-
>C4
MKTETGSNNNNNNTT--GGNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAAVQSAVAPAAA
GQAVQ---QQAAGAVAVAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
S-AVSVEQQ--VQQVTSA----AAAAAAAAVTANGPMS------------
-
>C5
MKTETGSNNNHNNTI--V-NMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
GQAVQ---QQQA--AGGAVAVTGVATSPASAAVPTSIPNGSAENGSSAVE
S-AVSVEQQ--VQQVTS-------AAAAAVVTANGPMSooooooo-----
-
>C6
MKTETGSNN--NNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
GQAVQGGQQQTAG----AVAVTGVATSPASAVIPTIIPNGSAENGGSAVE
SAAVSVEQQQQQQ-VTS-------AAATAVTTTNGPMSooo---------
-
>C7
MKTETGSNNN-NNT---GRKMDFDMYPSLSGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVASAAA
GQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVPTIIPNGSAENGGSAVE
LSAAAAEQ----QQVAS-------AAAGAATTTNGPMSoooo--------
-
>C8
MKTETGSNNNINNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMEKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AAT-----TAA
GQAVQGGQQQTAG----TVAVTGLATSPASAVVPTSIPNGSAENGGSAVE
SVVVSVEQQQQQQQVTS-------AAATAVTTTNGPMSooooo-------
-
>C9
MKAETGSNNNNNINT--VSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQVAAPPATPAIQAAP-AVQSAVA-AAA
GQAAQGG-QVAAG------AVTGVATSPASAVAPTTIPNGSAENGGSAVK
S-AVAVEQQ----QVTS---------AAAVPTANGPMSoooooooooooo
o
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:251 S:90 BS:251
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# PW_SEQ_DISTANCES
BOT 0 1 98.64 C1 C2 98.64
TOP 1 0 98.64 C2 C1 98.64
BOT 0 2 98.64 C1 C3 98.64
TOP 2 0 98.64 C3 C1 98.64
BOT 0 3 95.87 C1 C4 95.87
TOP 3 0 95.87 C4 C1 95.87
BOT 0 4 96.38 C1 C5 96.38
TOP 4 0 96.38 C5 C1 96.38
BOT 0 5 92.20 C1 C6 92.20
TOP 5 0 92.20 C6 C1 92.20
BOT 0 6 89.04 C1 C7 89.04
TOP 6 0 89.04 C7 C1 89.04
BOT 0 7 89.86 C1 C8 89.86
TOP 7 0 89.86 C8 C1 89.86
BOT 0 8 91.67 C1 C9 91.67
TOP 8 0 91.67 C9 C1 91.67
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 94.52 C2 C4 94.52
TOP 3 1 94.52 C4 C2 94.52
BOT 1 4 95.37 C2 C5 95.37
TOP 4 1 95.37 C5 C2 95.37
BOT 1 5 91.24 C2 C6 91.24
TOP 5 1 91.24 C6 C2 91.24
BOT 1 6 88.02 C2 C7 88.02
TOP 6 1 88.02 C7 C2 88.02
BOT 1 7 88.79 C2 C8 88.79
TOP 7 1 88.79 C8 C2 88.79
BOT 1 8 91.00 C2 C9 91.00
TOP 8 1 91.00 C9 C2 91.00
BOT 2 3 94.09 C3 C4 94.09
TOP 3 2 94.09 C4 C3 94.09
BOT 2 4 94.91 C3 C5 94.91
TOP 4 2 94.91 C5 C3 94.91
BOT 2 5 90.78 C3 C6 90.78
TOP 5 2 90.78 C6 C3 90.78
BOT 2 6 87.96 C3 C7 87.96
TOP 6 2 87.96 C7 C3 87.96
BOT 2 7 88.32 C3 C8 88.32
TOP 7 2 88.32 C8 C3 88.32
BOT 2 8 90.52 C3 C9 90.52
TOP 8 2 90.52 C9 C3 90.52
BOT 3 4 95.89 C4 C5 95.89
TOP 4 3 95.89 C5 C4 95.89
BOT 3 5 93.49 C4 C6 93.49
TOP 5 3 93.49 C6 C4 93.49
BOT 3 6 93.12 C4 C7 93.12
TOP 6 3 93.12 C7 C4 93.12
BOT 3 7 90.61 C4 C8 90.61
TOP 7 3 90.61 C8 C4 90.61
BOT 3 8 92.42 C4 C9 92.42
TOP 8 3 92.42 C9 C4 92.42
BOT 4 5 94.44 C5 C6 94.44
TOP 5 4 94.44 C6 C5 94.44
BOT 4 6 90.41 C5 C7 90.41
TOP 6 4 90.41 C7 C5 90.41
BOT 4 7 91.67 C5 C8 91.67
TOP 7 4 91.67 C8 C5 91.67
BOT 4 8 92.13 C5 C9 92.13
TOP 8 4 92.13 C9 C5 92.13
BOT 5 6 92.24 C6 C7 92.24
TOP 6 5 92.24 C7 C6 92.24
BOT 5 7 95.48 C6 C8 95.48
TOP 7 5 95.48 C8 C6 95.48
BOT 5 8 93.43 C6 C9 93.43
TOP 8 5 93.43 C9 C6 93.43
BOT 6 7 89.40 C7 C8 89.40
TOP 7 6 89.40 C8 C7 89.40
BOT 6 8 89.72 C7 C9 89.72
TOP 8 6 89.72 C9 C7 89.72
BOT 7 8 90.19 C8 C9 90.19
TOP 8 7 90.19 C9 C8 90.19
AVG 0 C1 * 94.04
AVG 1 C2 * 93.45
AVG 2 C3 * 93.15
AVG 3 C4 * 93.75
AVG 4 C5 * 93.90
AVG 5 C6 * 92.91
AVG 6 C7 * 89.99
AVG 7 C8 * 90.54
AVG 8 C9 * 91.38
TOT TOT * 92.57
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAAAACTGAAACCGGCAGCAATAATAAT---AATACCACA--------
C2 ATGAAAGCTGAAACCGGCAGCAATAATAAT---AATACCACA--------
C3 ATGAAAGCTGAAACCGGCAGCAATAATAAT---AATACCACAGTG-----
C4 ATGAAAACAGAAACCGGCAGCAATAATAATAACAATAATACTACT-----
C5 ATGAAAACTGAAACCGGCAGCAATAATAATCATAATAATACCATC-----
C6 ATGAAAACCGAAACCGGCAGCAATAAC------AACAATAATAACAATAC
C7 ATGAAAACTGAAACCGGCAGCAATAACAAC---AATAATACC--------
C8 ATGAAAACTGAAACTGGTAGCAATAACAACATTAATAATAATAATAACAC
C9 ATGAAAGCTGAAACCGGCAGCAATAACAACAATAATATTAATACC-----
******.* ***** ** ******** ** * *.
C1 -GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
C2 -GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
C3 -GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
C4 -GGCGGCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
C5 -GTC---AATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
C6 CGTCAGCAAAATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
C7 -GGCAGGAAAATGGATTTCGATATGTATCCAAGCCTTTCGGGCAAGCAAC
C8 CGTCAGCAAAATGGACTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
C9 -GTCAGCAAAATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
* * **:***** ***************** .***************
C1 AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA
C2 AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTTTGCCA
C3 AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA
C4 AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA
C5 AGGATCCCGTTCGCGAGGTCGTTATGAAATATATCGATTACTTTCTGCCA
C6 AGGACCCTGTTCGCGAAGTTGTTATGAAATACATTGATTACTTTCTGCCA
C7 AGGATCCCGTTCGCGAAGTAGTTATGAAATATATCGATTACTTTCTGCCA
C8 AGGATCCCGTTCGCGAAGTTGTTATGAAATATATCGATTACTTTCTGCCA
C9 AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTTTGCCA
**** ** ********.** *********** ** ********* *****
C1 GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
C2 GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
C3 GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
C4 GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
C5 GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
C6 GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC
C7 GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC
C8 GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC
C9 GATGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCGAGCAGGC
**************:***************** ***********.*****
C1 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C2 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C3 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C4 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C5 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C6 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C7 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C8 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
C9 AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
**************************************************
C1 AAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
C2 AAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
C3 AAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
C4 AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
C5 AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
C6 AAGTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTG
C7 AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
C8 AAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAACAAGCTG
C9 AAGTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTG
**** **.**.********.**************.***************
C1 GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCA
C2 GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
C3 GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
C4 GAGCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGACACTGCA
C5 GAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACACTGCA
C6 GAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
C7 GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
C8 GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
C9 GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
***** *******.******************.***********.*****
C1 GCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACGCCCGCCA
C2 GCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCA
C3 GCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCA
C4 GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACGCCCGCCA
C5 GCAGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACGCCCGCCA
C6 GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCA
C7 GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCA
C8 GCAGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACGCCAGCCA
C9 GCAGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACGCCCGCCA
**** *****:******* **. * *****.** ***********.****
C1 TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG
C2 TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG
C3 TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG
C4 TTCAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCG
C5 TTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGCTGCCGCG
C6 TCCAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCG
C7 TCCAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGCTGCCGCG
C8 TTCAAGCGGCGCCG---GCGGCAACG---------------ACTGCCGCG
C9 TTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCG
* **.*****.*** **** .... .********
C1 GGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGA-----------
C2 GGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA-----------
C3 GGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA-----------
C4 GGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGGTTGCGGT
C5 GGTCAGGCAGTTCAG---------CAGCAGCAGGCC------GCTGGAGG
C6 GGTCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT-----------
C7 GGTCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGGTGGCGGT
C8 GGTCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA-----------
C9 GGTCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA-----------
********** **. *** :* . **
C1 -GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
C2 -GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
C3 -GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
C4 AGCGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
C5 AGCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGCGGTAC
C6 -GCGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCGGTGATCC
C7 GGCGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCGGTGGTCC
C8 -ACGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCGGTGGTCC
C9 -------GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCAGTGGCGC
*****..*.** * ******** **.** **.**.* *. *
C1 CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG
C2 CCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAG
C3 CCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAG
C4 CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG
C5 CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG
C6 CAACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGCTGTCGAG
C7 CCACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAG
C8 CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGCAGTCGAG
C9 CCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCAAG
*.**** ********* ***** *********** .*******:***.**
C1 TCAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
C2 ACAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
C3 ACAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
C4 TCA---GCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACTTC
C5 TCA---GCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
C6 TCAGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG---GTGACGTC
C7 CTGTCAGCGGCAGCGGCGGAGCAG------------CAGCAGGTGGCGTC
C8 TCAGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAGGTGACGTC
C9 TCA---GCGGTGGCGGTGGAGCAGCAG------------CAGGTGACGTC
. * ** . *** .****** ***.* **
C1 A---------------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCCA
C2 AGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCA
C3 AGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCA
C4 AGCA------------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCAA
C5 A---------------------GCAGCGGCGGCAGCAGTGGTCACAGCCA
C6 A---------------------GCAGCGGCAACAGCGGTAACCACGACCA
C7 G---------------------GCAGCGGCTGGAGCGGCAACCACGACCA
C8 A---------------------GCAGCGGCAACAGCGGTAACCACAACCA
C9 A---------------------------GCAGCAGCGGTACCCACAGCAA
. ** . * *.* . *** .*.*
C1 ATGGTCCCATGTCC------------------------------------
C2 ATGGTCCCATGTCC------------------------------------
C3 ATGGTCCCATGTCC------------------------------------
C4 ACGGTCCCATGTCC------------------------------------
C5 ATGGTCCCATGTCC------------------------------------
C6 ACGGTCCCATGTCC------------------------------------
C7 ACGGCCCCATGTCC------------------------------------
C8 ATGGTCCCATGTCC------------------------------------
C9 ACGGTCCCATGTCC------------------------------------
* ** *********
C1 ---
C2 ---
C3 ---
C4 ---
C5 ---
C6 ---
C7 ---
C8 ---
C9 ---
>C1
ATGAAAACTGAAACCGGCAGCAATAATAAT---AATACCACA--------
-GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA
GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCA
GCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACGCCCGCCA
TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG
GGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGA-----------
-GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG
TCAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
A---------------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCCA
ATGGTCCCATGTCC------------------------------------
---
>C2
ATGAAAGCTGAAACCGGCAGCAATAATAAT---AATACCACA--------
-GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTTTGCCA
GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
GCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCA
TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG
GGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA-----------
-GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
CCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAG
ACAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
AGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCA
ATGGTCCCATGTCC------------------------------------
---
>C3
ATGAAAGCTGAAACCGGCAGCAATAATAAT---AATACCACAGTG-----
-GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA
GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
GCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCA
TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG
GGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA-----------
-GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
CCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAG
ACAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
AGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCA
ATGGTCCCATGTCC------------------------------------
---
>C4
ATGAAAACAGAAACCGGCAGCAATAATAATAACAATAATACTACT-----
-GGCGGCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA
GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGACACTGCA
GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACGCCCGCCA
TTCAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCG
GGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGGTTGCGGT
AGCGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC
CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG
TCA---GCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACTTC
AGCA------------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCAA
ACGGTCCCATGTCC------------------------------------
---
>C5
ATGAAAACTGAAACCGGCAGCAATAATAATCATAATAATACCATC-----
-GTC---AATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAGGTCGTTATGAAATATATCGATTACTTTCTGCCA
GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACACTGCA
GCAGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACGCCCGCCA
TTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGCTGCCGCG
GGTCAGGCAGTTCAG---------CAGCAGCAGGCC------GCTGGAGG
AGCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGCGGTAC
CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG
TCA---GCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC
A---------------------GCAGCGGCGGCAGCAGTGGTCACAGCCA
ATGGTCCCATGTCC------------------------------------
---
>C6
ATGAAAACCGAAACCGGCAGCAATAAC------AACAATAATAACAATAC
CGTCAGCAAAATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGACCCTGTTCGCGAAGTTGTTATGAAATACATTGATTACTTTCTGCCA
GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCA
TCCAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCG
GGTCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT-----------
-GCGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCGGTGATCC
CAACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGCTGTCGAG
TCAGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG---GTGACGTC
A---------------------GCAGCGGCAACAGCGGTAACCACGACCA
ACGGTCCCATGTCC------------------------------------
---
>C7
ATGAAAACTGAAACCGGCAGCAATAACAAC---AATAATACC--------
-GGCAGGAAAATGGATTTCGATATGTATCCAAGCCTTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAAGTAGTTATGAAATATATCGATTACTTTCTGCCA
GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCA
TCCAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGCTGCCGCG
GGTCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGGTGGCGGT
GGCGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCGGTGGTCC
CCACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAG
CTGTCAGCGGCAGCGGCGGAGCAG------------CAGCAGGTGGCGTC
G---------------------GCAGCGGCTGGAGCGGCAACCACGACCA
ACGGCCCCATGTCC------------------------------------
---
>C8
ATGAAAACTGAAACTGGTAGCAATAACAACATTAATAATAATAATAACAC
CGTCAGCAAAATGGACTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAAGTTGTTATGAAATATATCGATTACTTTCTGCCA
GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAACAAGCTG
GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
GCAGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACGCCAGCCA
TTCAAGCGGCGCCG---GCGGCAACG---------------ACTGCCGCG
GGTCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA-----------
-ACGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCGGTGGTCC
CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGCAGTCGAG
TCAGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAGGTGACGTC
A---------------------GCAGCGGCAACAGCGGTAACCACAACCA
ATGGTCCCATGTCC------------------------------------
---
>C9
ATGAAAGCTGAAACCGGCAGCAATAACAACAATAATATTAATACC-----
-GTCAGCAAAATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC
AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTTTGCCA
GATGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCGAGCAGGC
AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG
AAGTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTG
GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA
GCAGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACGCCCGCCA
TTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCG
GGTCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA-----------
-------GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCAGTGGCGC
CCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCAAG
TCA---GCGGTGGCGGTGGAGCAGCAG------------CAGGTGACGTC
A---------------------------GCAGCAGCGGTACCCACAGCAA
ACGGTCCCATGTCC------------------------------------
---
>C1
MKTETGSNNNoNTToooVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPoAVQSVVAPAAA
GQAVQoooQQAAGooooAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
SAAVSVEQQooVQQVTSoooooAAAAAASVVTANGPMS
>C2
MKAETGSNNNoNTToooVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPoAVQSVVAPAAA
GQAVQoooQQSAGooooAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
TAAVSVEQQooVQQVTSAAAAAAAAAAASVVTANGPMS
>C3
MKAETGSNNNoNTTVooVVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPoAVQSVVAPAAA
GQAVQoooQQSAGooooAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
TAAVSVEQQooVQQVTSAAAAAAAAAAASVVTANGPMS
>C4
MKTETGSNNNNNNTTooGGNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAAVQSAVAPAAA
GQAVQoooQQAAGAVAVAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
SoAVSVEQQooVQQVTSAooooAAAAAAAAVTANGPMS
>C5
MKTETGSNNNHNNTIooVoNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPoAVQSAVAPAAA
GQAVQoooQQQAooAGGAVAVTGVATSPASAAVPTSIPNGSAENGSSAVE
SoAVSVEQQooVQQVTSoooooooAAAAAVVTANGPMS
>C6
MKTETGSNNooNNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPoAVQSAVAPAAA
GQAVQGGQQQTAGooooAVAVTGVATSPASAVIPTIIPNGSAENGGSAVE
SAAVSVEQQQQQQoVTSoooooooAAATAVTTTNGPMS
>C7
MKTETGSNNNoNNToooGRKMDFDMYPSLSGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPoAVQSAVASAAA
GQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVPTIIPNGSAENGGSAVE
LSAAAAEQooooQQVASoooooooAAAGAATTTNGPMS
>C8
MKTETGSNNNINNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMEKINKL
ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPoAAToooooTAA
GQAVQGGQQQTAGooooTVAVTGLATSPASAVVPTSIPNGSAENGGSAVE
SVVVSVEQQQQQQQVTSoooooooAAATAVTTTNGPMS
>C9
MKAETGSNNNNNINTooVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
ELENNILKSNIPQETLQQLQMQLQVAAPPATPAIQAAPoAVQSAVAoAAA
GQAAQGGoQVAAGooooooAVTGVATSPASAVAPTTIPNGSAENGGSAVK
SoAVAVEQQooooQVTSoooooooooAAAVPTANGPMS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 9 taxa and 753 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479519161
Setting output file names to "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1289770895
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 2933161341
Seed = 1960822931
Swapseed = 1479519161
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 51 unique site patterns
Division 2 has 51 unique site patterns
Division 3 has 97 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2780.064365 -- -24.309708
Chain 2 -- -2778.351643 -- -24.309708
Chain 3 -- -2828.639035 -- -24.309708
Chain 4 -- -2744.809409 -- -24.309708
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2832.617773 -- -24.309708
Chain 2 -- -2782.479901 -- -24.309708
Chain 3 -- -2777.295090 -- -24.309708
Chain 4 -- -2812.574933 -- -24.309708
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2780.064] (-2778.352) (-2828.639) (-2744.809) * [-2832.618] (-2782.480) (-2777.295) (-2812.575)
500 -- (-2083.645) (-2079.065) (-2085.442) [-2082.352] * (-2098.719) [-2063.724] (-2070.852) (-2089.449) -- 0:00:00
1000 -- (-2051.597) [-2041.970] (-2057.738) (-2065.953) * (-2069.797) (-2052.253) (-2060.737) [-2056.967] -- 0:16:39
1500 -- (-2036.200) [-2027.910] (-2051.422) (-2049.379) * (-2064.444) [-2032.915] (-2036.124) (-2040.487) -- 0:11:05
2000 -- (-2029.104) (-2021.103) [-2035.268] (-2048.957) * (-2049.759) (-2038.129) [-2031.243] (-2027.161) -- 0:08:19
2500 -- (-2034.277) [-2015.981] (-2022.729) (-2034.895) * (-2030.349) (-2017.859) [-2017.664] (-2033.827) -- 0:06:39
3000 -- (-2024.106) (-2030.655) (-2025.446) [-2014.598] * (-2024.990) [-2012.722] (-2019.029) (-2022.452) -- 0:11:04
3500 -- (-2020.710) [-2024.955] (-2035.088) (-2011.786) * (-2022.535) (-2018.889) (-2028.513) [-2020.213] -- 0:09:29
4000 -- (-2018.104) [-2015.337] (-2030.571) (-2010.174) * (-2025.334) [-2017.127] (-2021.357) (-2030.138) -- 0:08:18
4500 -- (-2025.729) (-2015.992) [-2011.296] (-2017.158) * [-2016.472] (-2021.435) (-2019.500) (-2023.343) -- 0:07:22
5000 -- (-2022.462) (-2016.871) [-2013.884] (-2017.323) * [-2021.680] (-2021.036) (-2015.103) (-2026.512) -- 0:09:57
Average standard deviation of split frequencies: 0.073330
5500 -- (-2019.685) (-2020.988) [-2012.010] (-2018.113) * (-2020.847) [-2024.609] (-2014.291) (-2014.780) -- 0:09:02
6000 -- (-2020.874) (-2019.915) (-2013.164) [-2020.655] * [-2025.458] (-2020.907) (-2025.523) (-2020.755) -- 0:08:17
6500 -- (-2020.569) (-2023.246) [-2017.195] (-2027.953) * (-2014.948) (-2017.539) [-2012.461] (-2016.069) -- 0:07:38
7000 -- [-2019.449] (-2029.334) (-2020.428) (-2011.866) * [-2020.392] (-2017.908) (-2019.104) (-2032.887) -- 0:07:05
7500 -- (-2023.936) [-2022.710] (-2018.506) (-2017.013) * (-2028.183) (-2020.846) [-2009.291] (-2025.476) -- 0:08:49
8000 -- (-2018.375) [-2014.322] (-2017.368) (-2032.840) * (-2021.949) [-2017.330] (-2023.269) (-2016.502) -- 0:08:16
8500 -- (-2017.387) [-2010.928] (-2019.287) (-2034.964) * (-2018.867) [-2012.045] (-2017.422) (-2023.348) -- 0:07:46
9000 -- (-2021.087) [-2013.024] (-2013.237) (-2025.900) * (-2023.058) (-2016.902) [-2014.031] (-2019.024) -- 0:07:20
9500 -- (-2020.296) [-2014.225] (-2014.578) (-2035.403) * (-2015.702) [-2022.224] (-2017.581) (-2018.157) -- 0:08:41
10000 -- [-2016.100] (-2014.781) (-2018.933) (-2027.269) * [-2022.169] (-2023.161) (-2021.756) (-2023.286) -- 0:08:15
Average standard deviation of split frequencies: 0.044194
10500 -- [-2015.849] (-2020.976) (-2022.903) (-2029.705) * (-2024.044) [-2011.545] (-2026.172) (-2016.676) -- 0:07:51
11000 -- (-2025.653) [-2014.235] (-2022.317) (-2023.405) * (-2025.801) [-2017.647] (-2019.372) (-2014.653) -- 0:07:29
11500 -- (-2022.121) (-2019.319) [-2014.767] (-2024.119) * [-2019.742] (-2022.706) (-2012.807) (-2019.884) -- 0:08:35
12000 -- [-2016.825] (-2028.308) (-2015.896) (-2016.767) * (-2029.327) (-2019.229) [-2019.815] (-2015.998) -- 0:08:14
12500 -- [-2016.525] (-2019.499) (-2020.087) (-2028.549) * (-2019.173) (-2021.737) (-2019.319) [-2012.589] -- 0:07:54
13000 -- [-2012.776] (-2016.410) (-2017.905) (-2015.806) * (-2019.284) [-2023.460] (-2020.538) (-2026.320) -- 0:07:35
13500 -- [-2021.173] (-2022.603) (-2018.265) (-2018.915) * (-2021.987) (-2029.882) [-2015.031] (-2028.174) -- 0:07:18
14000 -- (-2016.634) [-2017.022] (-2018.921) (-2020.520) * (-2019.291) (-2019.167) (-2012.737) [-2017.674] -- 0:08:13
14500 -- (-2017.632) (-2035.105) (-2021.432) [-2014.103] * [-2018.815] (-2020.666) (-2025.895) (-2020.717) -- 0:07:55
15000 -- (-2013.979) [-2019.485] (-2016.784) (-2024.056) * (-2023.856) [-2022.696] (-2024.203) (-2019.418) -- 0:07:39
Average standard deviation of split frequencies: 0.034373
15500 -- (-2023.265) [-2018.399] (-2024.372) (-2018.264) * (-2028.328) [-2014.665] (-2015.094) (-2014.623) -- 0:07:24
16000 -- (-2021.921) (-2014.627) (-2018.192) [-2018.459] * (-2014.855) (-2013.381) (-2026.002) [-2020.104] -- 0:08:12
16500 -- (-2016.787) (-2020.375) (-2021.163) [-2014.448] * (-2022.646) (-2015.114) (-2027.467) [-2013.724] -- 0:07:56
17000 -- (-2025.253) (-2020.254) [-2018.637] (-2027.369) * [-2018.788] (-2023.818) (-2038.494) (-2029.615) -- 0:07:42
17500 -- [-2020.789] (-2019.633) (-2011.425) (-2025.907) * (-2022.550) [-2011.616] (-2021.875) (-2013.232) -- 0:07:29
18000 -- (-2030.548) [-2019.484] (-2021.878) (-2026.148) * (-2019.428) (-2014.139) [-2020.267] (-2023.596) -- 0:07:16
18500 -- (-2021.510) (-2020.424) [-2011.955] (-2023.519) * (-2015.379) (-2020.143) [-2025.221] (-2016.621) -- 0:07:57
19000 -- [-2017.659] (-2021.317) (-2020.030) (-2019.984) * (-2014.800) (-2019.512) (-2013.671) [-2020.153] -- 0:07:44
19500 -- [-2018.619] (-2016.889) (-2013.208) (-2015.233) * [-2017.396] (-2014.137) (-2025.403) (-2025.134) -- 0:07:32
20000 -- (-2023.542) [-2019.052] (-2019.633) (-2034.278) * (-2022.800) (-2015.611) [-2020.419] (-2018.003) -- 0:07:21
Average standard deviation of split frequencies: 0.031934
20500 -- (-2031.344) (-2021.874) [-2016.938] (-2023.268) * [-2011.170] (-2016.346) (-2020.592) (-2018.753) -- 0:07:57
21000 -- (-2022.552) (-2020.151) [-2019.766] (-2014.373) * (-2027.891) [-2016.185] (-2018.109) (-2018.184) -- 0:07:46
21500 -- [-2023.612] (-2028.709) (-2025.044) (-2028.792) * (-2023.215) [-2017.349] (-2017.962) (-2018.625) -- 0:07:35
22000 -- (-2022.925) [-2021.221] (-2019.466) (-2020.252) * (-2014.120) (-2024.534) [-2019.101] (-2016.912) -- 0:07:24
22500 -- [-2014.451] (-2022.099) (-2017.556) (-2016.845) * (-2021.364) (-2015.064) (-2022.927) [-2012.644] -- 0:07:57
23000 -- [-2018.837] (-2016.769) (-2014.547) (-2013.025) * (-2020.241) [-2012.026] (-2019.363) (-2019.438) -- 0:07:47
23500 -- (-2017.576) (-2017.260) (-2019.602) [-2019.190] * [-2022.603] (-2016.746) (-2023.964) (-2021.837) -- 0:07:37
24000 -- (-2022.607) (-2024.346) [-2017.212] (-2035.191) * [-2017.945] (-2024.929) (-2021.650) (-2024.346) -- 0:07:27
24500 -- [-2022.461] (-2017.614) (-2016.785) (-2020.970) * [-2010.909] (-2013.523) (-2018.995) (-2022.101) -- 0:07:17
25000 -- [-2015.174] (-2031.384) (-2022.780) (-2023.295) * (-2013.507) [-2024.939] (-2026.624) (-2017.036) -- 0:07:48
Average standard deviation of split frequencies: 0.049213
25500 -- (-2018.654) (-2022.996) [-2014.770] (-2024.931) * [-2017.567] (-2027.033) (-2022.092) (-2018.814) -- 0:07:38
26000 -- (-2026.855) [-2022.107] (-2019.504) (-2022.931) * (-2016.499) (-2018.253) (-2017.232) [-2013.273] -- 0:07:29
26500 -- (-2018.992) [-2020.755] (-2017.316) (-2025.863) * [-2016.470] (-2020.272) (-2019.002) (-2023.444) -- 0:07:20
27000 -- (-2015.555) (-2021.966) [-2018.699] (-2023.402) * [-2027.607] (-2021.556) (-2021.718) (-2021.814) -- 0:07:48
27500 -- (-2024.310) (-2031.876) [-2016.489] (-2019.014) * [-2024.998] (-2015.022) (-2015.984) (-2027.297) -- 0:07:39
28000 -- (-2022.971) [-2019.270] (-2021.870) (-2018.919) * (-2011.479) (-2022.937) [-2013.612] (-2022.186) -- 0:07:31
28500 -- (-2029.306) [-2017.879] (-2010.855) (-2018.770) * (-2019.575) [-2019.036] (-2020.374) (-2032.137) -- 0:07:23
29000 -- (-2019.719) (-2023.521) (-2012.154) [-2013.769] * (-2016.062) (-2023.326) [-2016.545] (-2024.720) -- 0:07:48
29500 -- [-2016.738] (-2026.331) (-2024.117) (-2019.122) * (-2015.286) (-2023.432) [-2013.722] (-2022.673) -- 0:07:40
30000 -- [-2012.596] (-2016.376) (-2030.768) (-2011.190) * (-2018.372) (-2017.530) [-2019.326] (-2013.429) -- 0:07:32
Average standard deviation of split frequencies: 0.035136
30500 -- [-2016.333] (-2017.052) (-2015.311) (-2017.080) * (-2020.508) [-2018.647] (-2022.983) (-2021.538) -- 0:07:25
31000 -- (-2015.691) (-2017.054) [-2015.088] (-2022.110) * (-2016.366) (-2021.950) (-2022.892) [-2022.558] -- 0:07:17
31500 -- (-2014.768) (-2017.390) [-2020.361] (-2020.050) * (-2013.348) (-2021.008) (-2022.785) [-2019.453] -- 0:07:41
32000 -- (-2012.712) [-2010.471] (-2025.889) (-2018.516) * [-2018.345] (-2021.210) (-2026.540) (-2022.187) -- 0:07:33
32500 -- (-2019.166) (-2015.278) (-2027.464) [-2016.725] * (-2015.892) (-2018.291) [-2013.778] (-2018.545) -- 0:07:26
33000 -- [-2018.669] (-2022.444) (-2020.096) (-2017.867) * [-2018.482] (-2021.276) (-2020.920) (-2026.772) -- 0:07:19
33500 -- (-2018.171) (-2023.066) (-2020.326) [-2027.965] * (-2023.631) [-2022.621] (-2026.571) (-2013.816) -- 0:07:41
34000 -- (-2018.576) (-2023.943) [-2019.497] (-2017.933) * [-2017.467] (-2024.215) (-2009.413) (-2017.009) -- 0:07:34
34500 -- (-2015.323) (-2016.787) [-2019.293] (-2018.603) * (-2019.282) [-2018.232] (-2015.836) (-2015.830) -- 0:07:27
35000 -- (-2026.307) (-2026.970) [-2015.644] (-2020.213) * (-2030.297) (-2023.172) (-2022.134) [-2021.025] -- 0:07:21
Average standard deviation of split frequencies: 0.030218
35500 -- (-2014.870) (-2019.546) (-2027.655) [-2018.820] * (-2020.605) (-2015.572) (-2025.004) [-2025.638] -- 0:07:41
36000 -- (-2012.972) (-2019.230) (-2019.624) [-2021.134] * (-2023.419) (-2016.850) (-2013.139) [-2024.043] -- 0:07:35
36500 -- (-2018.482) (-2026.813) (-2020.838) [-2014.691] * (-2014.117) (-2015.235) [-2015.660] (-2023.043) -- 0:07:28
37000 -- (-2024.370) (-2025.195) [-2017.833] (-2016.813) * (-2026.894) (-2016.541) [-2012.740] (-2022.192) -- 0:07:22
37500 -- (-2024.606) (-2020.775) [-2024.062] (-2026.184) * (-2017.727) (-2019.398) [-2017.127] (-2016.957) -- 0:07:42
38000 -- (-2015.734) (-2018.062) [-2017.529] (-2018.702) * (-2016.636) (-2018.819) (-2031.738) [-2017.037] -- 0:07:35
38500 -- (-2016.036) (-2018.172) [-2016.248] (-2024.192) * [-2018.033] (-2018.877) (-2024.110) (-2015.359) -- 0:07:29
39000 -- (-2021.840) [-2016.049] (-2023.881) (-2022.543) * (-2013.576) (-2025.431) (-2029.034) [-2017.702] -- 0:07:23
39500 -- (-2018.375) (-2013.568) [-2013.413] (-2026.600) * (-2012.754) (-2020.031) (-2015.635) [-2016.225] -- 0:07:42
40000 -- [-2023.214] (-2021.404) (-2016.472) (-2032.124) * (-2024.068) [-2023.673] (-2018.736) (-2013.639) -- 0:07:36
Average standard deviation of split frequencies: 0.024150
40500 -- (-2022.832) (-2022.690) [-2013.481] (-2016.239) * [-2015.674] (-2020.676) (-2022.134) (-2017.803) -- 0:07:30
41000 -- (-2022.459) (-2021.833) [-2018.435] (-2025.727) * [-2012.888] (-2015.263) (-2016.576) (-2023.062) -- 0:07:24
41500 -- (-2021.191) (-2019.266) [-2014.776] (-2027.276) * (-2012.640) [-2015.833] (-2016.882) (-2022.803) -- 0:07:18
42000 -- (-2023.541) (-2016.327) [-2018.824] (-2017.136) * (-2022.821) [-2013.061] (-2024.410) (-2024.137) -- 0:07:36
42500 -- (-2019.034) (-2023.880) (-2018.414) [-2013.943] * (-2020.165) (-2016.311) [-2015.932] (-2020.857) -- 0:07:30
43000 -- (-2011.991) [-2021.081] (-2018.129) (-2015.601) * (-2019.209) (-2023.404) [-2016.491] (-2015.023) -- 0:07:25
43500 -- (-2019.657) [-2016.877] (-2022.455) (-2021.352) * (-2027.567) [-2013.644] (-2020.257) (-2022.531) -- 0:07:19
44000 -- (-2016.772) [-2014.534] (-2018.347) (-2021.056) * [-2019.293] (-2009.573) (-2025.227) (-2020.617) -- 0:07:36
44500 -- (-2012.916) (-2020.720) (-2017.150) [-2017.672] * (-2019.423) [-2014.659] (-2019.998) (-2028.152) -- 0:07:30
45000 -- [-2010.960] (-2018.676) (-2014.839) (-2023.263) * (-2017.912) (-2023.758) (-2028.157) [-2017.851] -- 0:07:25
Average standard deviation of split frequencies: 0.027591
45500 -- [-2020.872] (-2018.238) (-2019.929) (-2023.276) * (-2013.208) [-2019.271] (-2031.932) (-2020.689) -- 0:07:20
46000 -- (-2040.158) [-2023.738] (-2019.394) (-2016.120) * (-2015.940) [-2011.271] (-2022.528) (-2028.046) -- 0:07:15
46500 -- (-2026.422) [-2015.569] (-2015.839) (-2014.912) * (-2016.471) (-2020.129) [-2020.807] (-2018.283) -- 0:07:31
47000 -- (-2020.124) (-2020.729) (-2016.902) [-2016.292] * (-2020.877) [-2018.986] (-2027.088) (-2019.782) -- 0:07:26
47500 -- (-2021.350) (-2015.336) [-2020.422] (-2020.683) * (-2020.308) (-2028.923) [-2017.726] (-2017.692) -- 0:07:21
48000 -- [-2013.267] (-2017.684) (-2028.643) (-2021.547) * [-2014.761] (-2024.120) (-2021.524) (-2019.695) -- 0:07:16
48500 -- (-2021.450) [-2011.490] (-2022.260) (-2026.473) * [-2017.019] (-2021.142) (-2025.616) (-2017.376) -- 0:07:31
49000 -- (-2018.578) (-2014.591) [-2018.839] (-2021.911) * (-2023.493) (-2021.659) (-2020.598) [-2021.342] -- 0:07:26
49500 -- [-2016.381] (-2018.245) (-2021.689) (-2015.286) * (-2028.822) (-2024.973) (-2010.912) [-2012.683] -- 0:07:21
50000 -- (-2023.998) (-2015.801) [-2021.153] (-2015.192) * (-2022.852) (-2014.987) [-2014.434] (-2021.047) -- 0:07:17
Average standard deviation of split frequencies: 0.023618
50500 -- [-2017.738] (-2018.445) (-2018.973) (-2021.958) * (-2025.708) (-2018.626) (-2014.518) [-2020.314] -- 0:07:31
51000 -- (-2017.322) (-2026.169) (-2023.182) [-2014.913] * (-2020.085) (-2012.456) (-2017.240) [-2017.558] -- 0:07:26
51500 -- (-2026.915) (-2016.265) (-2024.458) [-2018.774] * (-2020.628) (-2016.751) (-2015.416) [-2021.303] -- 0:07:22
52000 -- (-2020.354) [-2012.918] (-2021.076) (-2022.004) * (-2020.493) [-2015.682] (-2022.979) (-2023.673) -- 0:07:17
52500 -- (-2020.929) (-2026.788) (-2019.424) [-2020.339] * (-2025.620) [-2016.594] (-2024.884) (-2021.285) -- 0:07:13
53000 -- (-2020.845) [-2020.780] (-2017.188) (-2020.404) * (-2020.418) (-2025.865) (-2018.604) [-2014.202] -- 0:07:26
53500 -- (-2023.022) (-2015.975) [-2016.486] (-2016.601) * (-2032.577) [-2018.904] (-2019.541) (-2019.225) -- 0:07:22
54000 -- (-2021.804) (-2022.577) [-2014.462] (-2019.985) * (-2021.309) (-2021.436) (-2017.113) [-2008.293] -- 0:07:17
54500 -- (-2029.749) [-2020.669] (-2026.178) (-2015.378) * (-2025.449) (-2018.123) (-2017.544) [-2017.173] -- 0:07:13
55000 -- (-2014.216) (-2012.777) (-2023.154) [-2012.644] * (-2015.831) (-2023.273) [-2014.506] (-2019.779) -- 0:07:26
Average standard deviation of split frequencies: 0.026549
55500 -- (-2021.490) (-2019.817) (-2026.138) [-2012.194] * (-2024.221) [-2016.832] (-2014.971) (-2023.478) -- 0:07:22
56000 -- (-2014.946) (-2022.178) (-2019.199) [-2009.721] * [-2017.978] (-2014.670) (-2027.126) (-2023.729) -- 0:07:18
56500 -- [-2014.923] (-2021.616) (-2024.292) (-2017.946) * (-2020.520) [-2015.479] (-2022.064) (-2021.402) -- 0:07:14
57000 -- (-2024.534) [-2016.893] (-2025.625) (-2019.392) * (-2018.300) [-2012.269] (-2022.953) (-2020.987) -- 0:07:26
57500 -- (-2019.650) [-2015.599] (-2031.656) (-2021.269) * (-2028.287) (-2017.035) [-2019.116] (-2017.064) -- 0:07:22
58000 -- (-2020.252) (-2021.627) (-2012.131) [-2014.623] * [-2017.947] (-2015.816) (-2020.518) (-2014.218) -- 0:07:18
58500 -- (-2015.737) [-2011.451] (-2030.369) (-2013.460) * (-2021.648) [-2015.133] (-2019.202) (-2016.173) -- 0:07:14
59000 -- (-2023.646) [-2014.544] (-2031.377) (-2021.735) * (-2025.043) [-2015.101] (-2014.700) (-2018.897) -- 0:07:10
59500 -- (-2022.802) (-2020.789) [-2016.026] (-2024.309) * (-2024.436) [-2014.941] (-2018.727) (-2019.808) -- 0:07:22
60000 -- [-2015.586] (-2023.811) (-2014.399) (-2026.185) * (-2022.503) (-2017.037) [-2012.138] (-2031.373) -- 0:07:18
Average standard deviation of split frequencies: 0.021369
60500 -- [-2019.211] (-2020.441) (-2017.659) (-2015.084) * (-2014.193) (-2021.475) [-2014.086] (-2027.560) -- 0:07:14
61000 -- (-2019.534) [-2019.401] (-2017.472) (-2025.717) * [-2019.322] (-2017.794) (-2014.326) (-2019.411) -- 0:07:26
61500 -- (-2018.261) (-2019.031) (-2018.891) [-2015.993] * [-2024.750] (-2024.869) (-2021.444) (-2026.409) -- 0:07:22
62000 -- (-2024.366) (-2023.727) [-2014.963] (-2021.073) * (-2022.597) (-2013.373) [-2016.205] (-2025.512) -- 0:07:18
62500 -- [-2016.155] (-2026.772) (-2023.534) (-2013.859) * (-2020.790) (-2020.731) [-2014.857] (-2024.636) -- 0:07:15
63000 -- [-2022.203] (-2027.883) (-2023.487) (-2021.570) * [-2019.565] (-2031.479) (-2021.586) (-2020.816) -- 0:07:26
63500 -- [-2018.310] (-2010.754) (-2013.786) (-2019.225) * [-2016.965] (-2012.385) (-2020.711) (-2020.929) -- 0:07:22
64000 -- [-2015.933] (-2025.374) (-2024.527) (-2015.704) * (-2015.688) (-2011.555) (-2018.167) [-2019.878] -- 0:07:18
64500 -- [-2017.015] (-2016.713) (-2022.196) (-2018.011) * [-2017.865] (-2013.101) (-2026.022) (-2020.224) -- 0:07:15
65000 -- (-2018.597) [-2017.389] (-2018.551) (-2020.787) * [-2021.250] (-2025.806) (-2018.315) (-2015.710) -- 0:07:25
Average standard deviation of split frequencies: 0.025237
65500 -- [-2014.147] (-2013.694) (-2014.261) (-2029.515) * (-2018.947) [-2021.501] (-2017.465) (-2022.306) -- 0:07:22
66000 -- [-2013.799] (-2017.095) (-2015.625) (-2022.073) * [-2022.788] (-2026.458) (-2021.699) (-2026.552) -- 0:07:18
66500 -- (-2022.797) (-2019.884) (-2020.308) [-2017.922] * (-2014.629) [-2016.754] (-2014.850) (-2014.072) -- 0:07:15
67000 -- (-2023.472) (-2020.234) [-2024.397] (-2014.405) * [-2021.608] (-2018.921) (-2017.491) (-2018.811) -- 0:07:11
67500 -- (-2020.108) [-2015.681] (-2017.832) (-2021.313) * (-2018.797) (-2016.531) (-2020.082) [-2020.609] -- 0:07:22
68000 -- (-2015.491) (-2026.578) [-2020.385] (-2017.210) * [-2017.396] (-2013.215) (-2020.747) (-2017.045) -- 0:07:18
68500 -- (-2016.479) [-2017.507] (-2021.649) (-2022.186) * (-2027.319) (-2016.786) (-2017.520) [-2014.166] -- 0:07:15
69000 -- (-2028.570) (-2021.710) (-2019.009) [-2014.455] * (-2019.172) (-2017.858) (-2015.414) [-2014.897] -- 0:07:11
69500 -- (-2016.486) [-2025.672] (-2017.869) (-2019.222) * (-2020.432) [-2014.266] (-2017.155) (-2022.044) -- 0:07:21
70000 -- (-2028.495) (-2025.344) (-2016.624) [-2017.403] * [-2016.914] (-2023.184) (-2024.261) (-2032.729) -- 0:07:18
Average standard deviation of split frequencies: 0.026207
70500 -- (-2024.814) (-2029.942) (-2020.212) [-2016.552] * (-2017.073) (-2022.644) [-2015.385] (-2023.822) -- 0:07:15
71000 -- [-2011.487] (-2018.846) (-2024.231) (-2017.804) * [-2015.599] (-2026.197) (-2017.730) (-2018.025) -- 0:07:24
71500 -- (-2026.328) [-2017.438] (-2022.803) (-2020.210) * [-2013.680] (-2018.150) (-2025.922) (-2016.214) -- 0:07:21
72000 -- (-2042.339) (-2018.768) (-2022.150) [-2020.139] * (-2022.878) (-2026.548) [-2018.847] (-2014.290) -- 0:07:18
72500 -- (-2026.858) (-2015.117) [-2025.437] (-2024.022) * (-2034.862) (-2027.069) (-2013.384) [-2017.388] -- 0:07:14
73000 -- [-2015.721] (-2019.495) (-2018.618) (-2022.898) * (-2024.001) [-2024.327] (-2016.274) (-2029.649) -- 0:07:24
73500 -- (-2034.802) (-2023.568) [-2028.139] (-2018.953) * (-2024.930) (-2024.496) (-2017.990) [-2015.494] -- 0:07:21
74000 -- (-2018.543) (-2017.827) (-2014.425) [-2015.976] * (-2021.547) (-2033.034) (-2020.018) [-2015.762] -- 0:07:17
74500 -- (-2026.132) [-2017.934] (-2021.280) (-2015.978) * (-2021.766) (-2034.537) (-2020.033) [-2012.826] -- 0:07:14
75000 -- (-2017.153) (-2014.201) [-2012.707] (-2017.087) * (-2017.431) [-2018.005] (-2017.097) (-2022.032) -- 0:07:11
Average standard deviation of split frequencies: 0.020823
75500 -- (-2015.153) [-2011.281] (-2017.144) (-2020.357) * (-2024.807) (-2024.210) [-2013.802] (-2020.671) -- 0:07:20
76000 -- [-2013.483] (-2012.106) (-2021.537) (-2020.368) * [-2014.930] (-2020.033) (-2022.522) (-2023.373) -- 0:07:17
76500 -- (-2019.353) [-2019.891] (-2025.815) (-2017.817) * (-2021.666) (-2020.599) [-2013.002] (-2027.781) -- 0:07:14
77000 -- (-2019.888) [-2025.552] (-2022.166) (-2020.408) * [-2012.452] (-2021.228) (-2014.698) (-2026.954) -- 0:07:11
77500 -- (-2016.023) (-2024.891) (-2030.936) [-2021.753] * (-2013.442) [-2016.717] (-2018.252) (-2016.943) -- 0:07:20
78000 -- (-2016.083) [-2019.018] (-2023.950) (-2016.101) * (-2017.937) (-2024.370) [-2017.134] (-2020.035) -- 0:07:17
78500 -- [-2020.443] (-2020.214) (-2027.496) (-2018.302) * (-2011.443) (-2017.724) [-2016.367] (-2019.611) -- 0:07:14
79000 -- [-2015.629] (-2018.239) (-2032.147) (-2024.378) * (-2033.749) (-2024.401) (-2016.747) [-2021.421] -- 0:07:11
79500 -- (-2014.953) [-2017.883] (-2023.553) (-2014.067) * (-2030.851) (-2010.106) (-2019.531) [-2014.558] -- 0:07:19
80000 -- (-2014.287) [-2022.945] (-2021.722) (-2024.761) * (-2036.046) (-2015.385) [-2017.742] (-2024.581) -- 0:07:17
Average standard deviation of split frequencies: 0.019619
80500 -- [-2012.274] (-2023.415) (-2022.190) (-2019.587) * [-2015.959] (-2013.977) (-2029.172) (-2019.491) -- 0:07:14
81000 -- (-2015.892) (-2018.319) (-2026.027) [-2025.750] * [-2016.024] (-2015.040) (-2022.954) (-2027.165) -- 0:07:11
81500 -- (-2016.579) (-2022.709) [-2018.881] (-2017.144) * (-2018.502) (-2017.053) (-2019.453) [-2021.583] -- 0:07:19
82000 -- [-2021.833] (-2022.732) (-2014.337) (-2016.695) * [-2018.378] (-2022.410) (-2022.248) (-2017.146) -- 0:07:16
82500 -- (-2020.520) [-2020.286] (-2013.141) (-2020.274) * (-2029.024) (-2025.353) [-2015.947] (-2017.969) -- 0:07:13
83000 -- (-2021.311) (-2016.522) (-2020.595) [-2011.157] * (-2018.627) [-2013.329] (-2023.053) (-2025.949) -- 0:07:10
83500 -- (-2021.302) (-2023.946) (-2017.776) [-2015.197] * (-2015.524) [-2015.474] (-2027.140) (-2018.464) -- 0:07:08
84000 -- (-2019.246) [-2018.256] (-2018.578) (-2015.448) * (-2017.222) (-2023.072) [-2015.781] (-2019.471) -- 0:07:16
84500 -- (-2024.219) (-2018.556) (-2019.254) [-2022.233] * (-2028.745) (-2023.146) [-2027.558] (-2013.011) -- 0:07:13
85000 -- (-2022.768) (-2015.499) (-2023.015) [-2010.808] * (-2028.596) (-2019.997) (-2024.340) [-2018.373] -- 0:07:10
Average standard deviation of split frequencies: 0.020099
85500 -- (-2023.840) [-2020.495] (-2018.234) (-2013.709) * (-2021.028) [-2015.067] (-2022.874) (-2025.782) -- 0:07:07
86000 -- [-2020.691] (-2030.062) (-2018.844) (-2012.037) * (-2018.395) [-2016.343] (-2017.515) (-2026.695) -- 0:07:15
86500 -- (-2025.323) (-2022.189) [-2011.821] (-2022.969) * (-2021.766) (-2025.233) [-2021.207] (-2023.014) -- 0:07:12
87000 -- (-2019.678) (-2032.136) [-2017.425] (-2016.274) * [-2021.132] (-2014.761) (-2019.965) (-2026.703) -- 0:07:10
87500 -- (-2023.503) (-2022.676) (-2015.543) [-2011.927] * (-2022.127) (-2026.217) [-2021.208] (-2024.022) -- 0:07:07
88000 -- (-2026.129) (-2024.014) (-2021.757) [-2018.569] * (-2023.525) (-2016.401) (-2024.074) [-2018.359] -- 0:07:15
88500 -- (-2023.300) (-2020.768) [-2011.996] (-2016.575) * (-2028.081) [-2014.366] (-2021.205) (-2023.129) -- 0:07:12
89000 -- (-2020.095) [-2019.742] (-2017.750) (-2014.789) * (-2015.063) (-2023.837) [-2016.798] (-2021.245) -- 0:07:09
89500 -- (-2028.687) (-2012.664) [-2018.702] (-2021.312) * (-2019.738) [-2016.938] (-2024.649) (-2015.157) -- 0:07:07
90000 -- [-2019.665] (-2025.360) (-2014.260) (-2017.449) * (-2018.094) (-2024.888) (-2015.307) [-2016.615] -- 0:07:14
Average standard deviation of split frequencies: 0.023026
90500 -- [-2023.842] (-2020.877) (-2015.748) (-2017.887) * (-2018.421) (-2016.676) [-2018.455] (-2016.082) -- 0:07:12
91000 -- (-2025.474) (-2029.518) [-2015.432] (-2015.354) * [-2028.364] (-2019.446) (-2015.735) (-2017.396) -- 0:07:09
91500 -- (-2021.540) (-2018.605) (-2023.924) [-2017.766] * (-2023.791) (-2024.206) [-2016.003] (-2014.504) -- 0:07:06
92000 -- (-2021.117) [-2017.847] (-2027.871) (-2012.206) * (-2017.379) (-2018.590) (-2023.985) [-2017.780] -- 0:07:14
92500 -- [-2027.996] (-2016.913) (-2014.338) (-2026.417) * (-2014.893) (-2016.491) [-2019.787] (-2020.560) -- 0:07:11
93000 -- (-2019.721) (-2027.853) [-2019.285] (-2024.611) * (-2022.353) (-2014.765) (-2022.936) [-2021.430] -- 0:07:09
93500 -- (-2017.471) (-2023.352) [-2016.987] (-2014.452) * (-2024.909) (-2019.391) [-2022.482] (-2020.361) -- 0:07:06
94000 -- (-2015.222) [-2014.047] (-2017.830) (-2018.049) * (-2017.295) (-2016.344) (-2017.610) [-2013.752] -- 0:07:04
94500 -- (-2021.102) (-2015.472) [-2020.905] (-2016.101) * (-2023.001) [-2024.826] (-2018.334) (-2024.917) -- 0:07:11
95000 -- (-2016.917) (-2020.355) (-2020.149) [-2017.578] * (-2021.989) (-2018.770) (-2017.655) [-2026.665] -- 0:07:08
Average standard deviation of split frequencies: 0.017888
95500 -- [-2019.949] (-2024.840) (-2014.518) (-2018.881) * [-2014.292] (-2014.473) (-2023.726) (-2021.724) -- 0:07:06
96000 -- (-2024.863) (-2018.871) (-2026.224) [-2015.151] * (-2012.472) (-2013.017) [-2024.172] (-2021.174) -- 0:07:03
96500 -- [-2023.434] (-2025.822) (-2023.659) (-2016.684) * (-2022.471) [-2013.406] (-2014.099) (-2020.945) -- 0:07:10
97000 -- (-2016.077) (-2026.182) [-2014.758] (-2023.937) * (-2027.058) [-2023.108] (-2015.361) (-2015.082) -- 0:07:08
97500 -- (-2018.095) (-2018.273) [-2018.041] (-2018.478) * (-2016.881) [-2020.562] (-2018.758) (-2018.298) -- 0:07:05
98000 -- (-2016.190) (-2022.484) [-2012.197] (-2023.280) * (-2031.108) (-2017.208) [-2017.807] (-2023.303) -- 0:07:03
98500 -- (-2025.852) (-2027.737) [-2017.404] (-2030.610) * (-2022.041) (-2038.952) (-2016.780) [-2020.560] -- 0:07:10
99000 -- (-2021.434) (-2025.388) (-2010.568) [-2022.253] * (-2019.090) (-2032.083) [-2010.633] (-2023.960) -- 0:07:07
99500 -- [-2018.304] (-2027.909) (-2019.949) (-2023.879) * (-2023.050) (-2020.640) (-2016.151) [-2012.309] -- 0:07:05
100000 -- (-2019.891) (-2014.625) [-2021.652] (-2022.610) * [-2015.885] (-2027.517) (-2021.829) (-2017.805) -- 0:07:03
Average standard deviation of split frequencies: 0.017880
100500 -- (-2027.287) (-2018.167) [-2023.688] (-2016.234) * (-2018.884) (-2017.787) [-2021.211] (-2020.115) -- 0:07:00
101000 -- (-2027.021) [-2014.227] (-2022.162) (-2018.227) * [-2010.871] (-2021.886) (-2014.484) (-2012.666) -- 0:07:07
101500 -- (-2018.469) (-2018.095) (-2021.526) [-2021.260] * (-2018.422) (-2027.042) (-2019.242) [-2019.636] -- 0:07:04
102000 -- (-2023.853) (-2026.319) (-2019.540) [-2016.373] * (-2017.240) (-2014.657) (-2021.308) [-2015.089] -- 0:07:02
102500 -- (-2021.895) [-2015.814] (-2018.732) (-2019.348) * [-2017.219] (-2021.045) (-2023.725) (-2018.748) -- 0:07:00
103000 -- (-2020.170) (-2023.018) (-2020.242) [-2019.648] * (-2021.585) [-2016.725] (-2029.086) (-2022.488) -- 0:07:06
103500 -- (-2017.266) (-2018.232) [-2024.391] (-2026.183) * (-2019.173) (-2019.202) (-2027.904) [-2014.419] -- 0:07:04
104000 -- [-2020.526] (-2021.653) (-2019.329) (-2012.671) * (-2021.828) (-2017.923) (-2029.166) [-2011.509] -- 0:07:02
104500 -- (-2015.089) (-2013.963) [-2019.022] (-2020.638) * (-2021.036) (-2018.169) [-2025.135] (-2013.501) -- 0:06:59
105000 -- (-2016.555) (-2012.239) (-2012.483) [-2020.009] * (-2016.699) (-2018.294) (-2024.300) [-2021.725] -- 0:07:06
Average standard deviation of split frequencies: 0.013342
105500 -- [-2016.774] (-2018.684) (-2014.898) (-2011.811) * (-2020.726) (-2031.153) (-2015.019) [-2018.690] -- 0:07:03
106000 -- (-2016.686) (-2017.911) [-2016.143] (-2016.708) * (-2019.532) (-2024.449) [-2016.982] (-2014.512) -- 0:07:01
106500 -- (-2023.236) (-2015.595) [-2017.054] (-2012.697) * (-2010.365) (-2027.239) [-2017.330] (-2024.575) -- 0:06:59
107000 -- (-2017.016) (-2019.509) [-2010.854] (-2013.606) * (-2024.531) (-2020.677) (-2027.360) [-2018.521] -- 0:07:05
107500 -- [-2015.599] (-2012.226) (-2015.231) (-2016.150) * [-2025.811] (-2017.071) (-2018.962) (-2028.822) -- 0:07:03
108000 -- (-2020.627) [-2012.849] (-2015.951) (-2019.641) * (-2029.605) (-2022.637) [-2020.803] (-2021.420) -- 0:07:01
108500 -- (-2021.853) (-2037.088) (-2019.746) [-2019.787] * (-2023.841) [-2011.144] (-2020.177) (-2018.565) -- 0:06:59
109000 -- (-2023.794) [-2013.750] (-2022.531) (-2033.784) * (-2016.817) (-2016.634) (-2017.272) [-2019.832] -- 0:07:05
109500 -- (-2022.305) (-2014.826) [-2020.739] (-2026.391) * [-2013.670] (-2013.485) (-2022.548) (-2019.018) -- 0:07:02
110000 -- [-2015.713] (-2023.605) (-2025.914) (-2025.251) * (-2015.178) [-2022.954] (-2022.463) (-2016.720) -- 0:07:00
Average standard deviation of split frequencies: 0.010294
110500 -- (-2011.363) (-2018.216) (-2037.792) [-2017.874] * (-2012.206) (-2015.475) [-2017.091] (-2025.248) -- 0:06:58
111000 -- (-2015.075) [-2018.477] (-2018.646) (-2014.826) * (-2012.653) (-2022.635) [-2021.172] (-2014.878) -- 0:06:56
111500 -- [-2014.432] (-2014.726) (-2028.681) (-2012.103) * (-2015.886) [-2016.447] (-2019.312) (-2014.457) -- 0:07:02
112000 -- (-2022.854) [-2014.942] (-2020.922) (-2014.909) * (-2017.226) (-2015.598) [-2015.552] (-2021.412) -- 0:07:00
112500 -- [-2018.751] (-2028.685) (-2016.634) (-2013.341) * (-2026.210) [-2012.073] (-2021.882) (-2013.379) -- 0:06:58
113000 -- [-2020.618] (-2023.959) (-2017.929) (-2024.083) * (-2020.214) [-2028.608] (-2019.211) (-2019.158) -- 0:06:56
113500 -- (-2023.042) (-2011.577) (-2015.874) [-2020.150] * (-2020.292) (-2017.115) (-2017.550) [-2020.923] -- 0:07:01
114000 -- [-2018.613] (-2017.429) (-2022.596) (-2020.942) * (-2021.359) [-2016.959] (-2012.086) (-2018.063) -- 0:06:59
114500 -- (-2023.435) [-2021.554] (-2024.829) (-2026.594) * (-2026.761) [-2016.519] (-2024.033) (-2015.957) -- 0:06:57
115000 -- (-2027.955) [-2015.032] (-2014.582) (-2031.905) * (-2018.282) (-2018.009) [-2013.112] (-2013.504) -- 0:06:55
Average standard deviation of split frequencies: 0.009821
115500 -- (-2019.197) (-2016.356) [-2015.736] (-2030.773) * (-2017.824) (-2018.828) [-2022.360] (-2013.869) -- 0:07:01
116000 -- (-2017.265) (-2023.264) (-2014.773) [-2034.288] * (-2015.356) (-2019.142) [-2017.428] (-2014.575) -- 0:06:59
116500 -- [-2020.297] (-2021.642) (-2015.504) (-2011.906) * (-2014.008) [-2018.825] (-2014.881) (-2020.063) -- 0:06:57
117000 -- (-2020.361) (-2019.291) (-2024.435) [-2014.993] * (-2019.022) (-2021.097) [-2024.077] (-2013.170) -- 0:06:55
117500 -- (-2017.894) (-2017.989) (-2024.149) [-2020.021] * (-2019.490) [-2015.986] (-2016.956) (-2029.514) -- 0:07:00
118000 -- (-2016.876) (-2017.535) (-2023.193) [-2009.836] * (-2017.797) (-2024.362) (-2014.572) [-2018.666] -- 0:06:58
118500 -- (-2027.745) (-2023.865) [-2012.922] (-2017.419) * [-2019.773] (-2019.213) (-2023.183) (-2012.664) -- 0:06:56
119000 -- (-2025.113) (-2020.803) (-2026.147) [-2014.022] * (-2017.044) (-2014.375) [-2014.303] (-2019.019) -- 0:06:54
119500 -- [-2019.520] (-2015.384) (-2015.762) (-2016.876) * (-2014.257) (-2020.705) [-2017.699] (-2017.452) -- 0:06:59
120000 -- [-2017.052] (-2013.857) (-2014.502) (-2019.336) * [-2011.921] (-2022.668) (-2015.553) (-2015.680) -- 0:06:58
Average standard deviation of split frequencies: 0.012430
120500 -- (-2024.729) [-2014.275] (-2016.146) (-2021.286) * (-2015.836) [-2019.662] (-2022.748) (-2018.783) -- 0:06:56
121000 -- (-2019.872) (-2024.524) (-2019.252) [-2010.331] * (-2021.766) [-2016.537] (-2018.890) (-2017.966) -- 0:06:54
121500 -- (-2018.167) (-2028.448) [-2016.954] (-2012.663) * (-2023.003) [-2014.504] (-2024.568) (-2020.528) -- 0:06:52
122000 -- (-2025.964) (-2027.692) [-2017.755] (-2029.451) * (-2020.901) [-2018.332] (-2012.413) (-2021.231) -- 0:06:57
122500 -- (-2013.427) [-2021.738] (-2022.259) (-2020.945) * (-2016.035) [-2019.983] (-2017.194) (-2015.962) -- 0:06:55
123000 -- (-2022.254) (-2026.929) [-2017.448] (-2017.135) * (-2025.239) [-2013.613] (-2021.929) (-2013.592) -- 0:06:53
123500 -- (-2014.965) (-2016.662) (-2028.040) [-2016.123] * [-2013.176] (-2017.506) (-2015.078) (-2020.671) -- 0:06:51
124000 -- (-2018.454) (-2023.704) (-2024.208) [-2014.178] * (-2019.487) (-2017.208) [-2014.398] (-2016.069) -- 0:06:56
124500 -- (-2017.451) [-2017.376] (-2022.563) (-2016.147) * (-2020.435) [-2018.572] (-2020.082) (-2021.960) -- 0:06:54
125000 -- (-2015.900) (-2033.029) [-2017.375] (-2024.486) * [-2015.241] (-2029.815) (-2012.478) (-2018.775) -- 0:06:53
Average standard deviation of split frequencies: 0.013605
125500 -- [-2021.348] (-2026.177) (-2022.352) (-2020.615) * (-2028.679) (-2035.124) [-2012.650] (-2030.007) -- 0:06:51
126000 -- (-2020.818) [-2017.798] (-2017.936) (-2020.743) * (-2028.428) (-2027.538) (-2016.662) [-2018.418] -- 0:06:56
126500 -- (-2019.418) (-2029.245) (-2020.189) [-2015.858] * (-2024.578) (-2013.767) [-2015.771] (-2032.507) -- 0:06:54
127000 -- [-2020.654] (-2016.691) (-2023.299) (-2017.861) * (-2012.995) [-2015.835] (-2016.232) (-2021.411) -- 0:06:52
127500 -- (-2020.066) [-2021.640] (-2018.585) (-2016.189) * (-2022.238) (-2017.780) (-2019.617) [-2026.187] -- 0:06:50
128000 -- (-2030.259) (-2012.785) (-2013.832) [-2013.118] * (-2020.196) [-2016.249] (-2019.672) (-2029.917) -- 0:06:55
128500 -- (-2025.591) [-2017.126] (-2021.125) (-2016.060) * (-2019.170) (-2021.054) (-2014.831) [-2016.403] -- 0:06:53
129000 -- (-2022.122) (-2018.942) [-2018.927] (-2022.653) * [-2020.539] (-2016.998) (-2024.449) (-2014.727) -- 0:06:51
129500 -- (-2020.245) [-2011.424] (-2034.928) (-2016.222) * [-2019.434] (-2020.644) (-2031.501) (-2023.145) -- 0:06:50
130000 -- (-2015.742) (-2016.832) (-2014.312) [-2016.949] * (-2018.688) [-2016.806] (-2034.013) (-2020.803) -- 0:06:48
Average standard deviation of split frequencies: 0.010522
130500 -- (-2017.401) (-2025.785) (-2022.478) [-2016.336] * (-2021.751) (-2023.005) (-2020.072) [-2014.411] -- 0:06:53
131000 -- [-2014.586] (-2020.885) (-2027.661) (-2015.250) * (-2019.151) (-2022.913) (-2025.377) [-2009.727] -- 0:06:51
131500 -- (-2023.136) (-2018.376) (-2014.388) [-2018.441] * (-2020.820) (-2023.645) (-2019.367) [-2022.308] -- 0:06:49
132000 -- (-2021.549) [-2015.003] (-2022.546) (-2017.385) * (-2027.251) [-2012.720] (-2023.770) (-2015.312) -- 0:06:47
132500 -- (-2016.623) (-2023.587) [-2012.334] (-2017.817) * (-2021.006) (-2026.293) (-2024.518) [-2011.660] -- 0:06:52
133000 -- (-2017.277) (-2028.798) [-2015.539] (-2016.805) * [-2016.026] (-2021.104) (-2015.217) (-2017.686) -- 0:06:50
133500 -- (-2021.444) [-2014.638] (-2022.599) (-2024.554) * (-2028.724) (-2023.246) (-2015.605) [-2017.906] -- 0:06:48
134000 -- [-2015.017] (-2020.171) (-2016.638) (-2023.870) * (-2021.076) (-2015.718) [-2018.756] (-2021.126) -- 0:06:47
134500 -- (-2024.118) [-2016.103] (-2012.831) (-2012.732) * [-2010.585] (-2012.479) (-2017.970) (-2020.745) -- 0:06:51
135000 -- (-2030.526) [-2013.934] (-2017.606) (-2020.793) * (-2018.721) (-2018.738) (-2020.290) [-2022.919] -- 0:06:50
Average standard deviation of split frequencies: 0.009453
135500 -- (-2027.326) (-2024.469) (-2017.432) [-2018.799] * [-2019.077] (-2018.742) (-2018.339) (-2016.919) -- 0:06:48
136000 -- [-2014.356] (-2029.773) (-2020.339) (-2016.365) * [-2016.762] (-2024.567) (-2024.476) (-2019.755) -- 0:06:46
136500 -- [-2016.308] (-2031.045) (-2021.448) (-2023.952) * (-2020.701) (-2023.208) (-2015.050) [-2018.130] -- 0:06:51
137000 -- [-2019.443] (-2013.126) (-2014.761) (-2020.525) * [-2021.755] (-2024.270) (-2021.505) (-2022.262) -- 0:06:49
137500 -- (-2033.440) (-2012.991) [-2016.632] (-2021.039) * (-2018.132) [-2025.442] (-2022.147) (-2015.224) -- 0:06:47
138000 -- (-2021.232) [-2022.056] (-2025.392) (-2016.539) * (-2022.582) (-2024.219) (-2017.212) [-2018.698] -- 0:06:46
138500 -- (-2026.489) (-2019.063) [-2018.272] (-2014.868) * [-2016.361] (-2018.596) (-2021.725) (-2027.195) -- 0:06:44
139000 -- [-2015.973] (-2018.822) (-2015.835) (-2021.940) * (-2019.549) (-2021.289) [-2017.121] (-2020.049) -- 0:06:48
139500 -- (-2030.215) (-2015.043) [-2012.908] (-2026.252) * [-2012.516] (-2018.355) (-2019.117) (-2023.656) -- 0:06:47
140000 -- (-2034.564) [-2014.178] (-2025.023) (-2028.155) * (-2020.083) (-2019.722) [-2017.738] (-2026.058) -- 0:06:45
Average standard deviation of split frequencies: 0.013405
140500 -- [-2020.450] (-2017.451) (-2017.908) (-2020.693) * (-2028.480) (-2019.604) [-2017.630] (-2016.401) -- 0:06:43
141000 -- (-2021.071) [-2015.520] (-2031.959) (-2029.126) * (-2030.227) (-2029.780) (-2019.039) [-2018.115] -- 0:06:48
141500 -- (-2018.304) (-2016.532) (-2018.239) [-2020.098] * (-2021.431) [-2021.969] (-2021.350) (-2025.356) -- 0:06:46
142000 -- [-2017.247] (-2028.670) (-2024.942) (-2021.267) * (-2020.390) (-2038.075) [-2015.404] (-2018.347) -- 0:06:44
142500 -- [-2017.299] (-2016.974) (-2020.631) (-2020.069) * (-2015.265) [-2013.923] (-2016.595) (-2024.715) -- 0:06:43
143000 -- [-2017.467] (-2020.276) (-2015.225) (-2022.369) * (-2021.875) [-2012.388] (-2024.200) (-2020.957) -- 0:06:47
143500 -- (-2015.085) (-2018.141) [-2018.489] (-2023.072) * [-2019.652] (-2013.370) (-2023.283) (-2021.972) -- 0:06:45
144000 -- (-2021.218) (-2012.335) [-2012.645] (-2021.866) * (-2012.615) (-2019.228) (-2020.202) [-2015.344] -- 0:06:44
144500 -- (-2016.019) (-2020.622) [-2018.445] (-2011.275) * [-2013.703] (-2021.247) (-2015.565) (-2018.687) -- 0:06:42
145000 -- (-2015.408) (-2013.270) (-2012.671) [-2016.355] * [-2017.695] (-2017.296) (-2022.917) (-2022.882) -- 0:06:46
Average standard deviation of split frequencies: 0.011570
145500 -- (-2017.297) [-2011.745] (-2023.648) (-2018.781) * [-2015.272] (-2020.391) (-2023.903) (-2022.315) -- 0:06:45
146000 -- (-2015.140) [-2011.464] (-2021.936) (-2018.834) * (-2017.404) [-2018.181] (-2027.131) (-2016.407) -- 0:06:43
146500 -- (-2020.695) (-2019.806) [-2018.234] (-2016.702) * (-2022.371) (-2027.984) (-2025.251) [-2009.337] -- 0:06:41
147000 -- (-2017.370) (-2021.307) [-2018.389] (-2012.137) * [-2015.930] (-2015.237) (-2017.770) (-2021.414) -- 0:06:46
147500 -- [-2011.730] (-2019.285) (-2018.714) (-2012.638) * [-2019.298] (-2026.043) (-2010.432) (-2023.281) -- 0:06:44
148000 -- (-2017.309) (-2027.842) [-2018.173] (-2020.978) * (-2020.729) (-2023.290) [-2016.245] (-2019.634) -- 0:06:42
148500 -- [-2016.023] (-2021.399) (-2019.689) (-2016.928) * [-2023.922] (-2015.147) (-2014.174) (-2012.062) -- 0:06:41
149000 -- (-2021.890) [-2023.881] (-2021.746) (-2025.759) * (-2027.595) [-2024.478] (-2019.354) (-2021.877) -- 0:06:45
149500 -- (-2018.575) [-2013.289] (-2020.290) (-2038.704) * [-2018.466] (-2021.724) (-2016.413) (-2029.394) -- 0:06:43
150000 -- (-2014.822) (-2012.507) [-2012.077] (-2016.753) * (-2010.527) [-2021.498] (-2020.270) (-2020.412) -- 0:06:42
Average standard deviation of split frequencies: 0.014340
150500 -- (-2021.213) (-2014.180) [-2012.512] (-2020.599) * (-2015.146) (-2021.864) (-2021.968) [-2011.399] -- 0:06:40
151000 -- (-2014.596) (-2016.795) (-2019.396) [-2018.456] * (-2013.484) [-2018.365] (-2013.597) (-2021.179) -- 0:06:39
151500 -- (-2024.660) (-2016.244) [-2018.937] (-2015.651) * (-2011.599) (-2014.838) [-2021.460] (-2032.897) -- 0:06:43
152000 -- (-2024.974) (-2026.622) [-2012.931] (-2015.570) * [-2019.091] (-2017.919) (-2017.130) (-2030.515) -- 0:06:41
152500 -- (-2022.494) (-2014.383) [-2017.902] (-2016.246) * (-2015.221) (-2026.024) [-2012.495] (-2023.478) -- 0:06:40
153000 -- (-2018.301) (-2021.084) [-2015.241] (-2014.391) * (-2022.568) (-2028.811) [-2018.923] (-2009.840) -- 0:06:38
153500 -- (-2027.886) (-2021.888) (-2025.574) [-2019.791] * [-2013.249] (-2021.135) (-2023.721) (-2015.267) -- 0:06:42
154000 -- (-2017.355) (-2025.375) (-2012.977) [-2020.217] * [-2014.010] (-2021.298) (-2019.931) (-2017.035) -- 0:06:41
154500 -- (-2013.024) [-2015.935] (-2019.365) (-2024.187) * (-2024.857) [-2014.473] (-2034.753) (-2015.034) -- 0:06:39
155000 -- (-2014.143) (-2030.192) (-2013.332) [-2019.158] * (-2015.022) [-2014.896] (-2020.425) (-2018.243) -- 0:06:37
Average standard deviation of split frequencies: 0.012591
155500 -- (-2019.398) [-2018.699] (-2014.098) (-2019.884) * (-2029.463) (-2013.073) [-2019.196] (-2012.533) -- 0:06:41
156000 -- (-2020.685) (-2018.942) [-2016.271] (-2022.396) * (-2016.409) (-2016.858) (-2013.180) [-2016.491] -- 0:06:40
156500 -- (-2014.241) (-2013.636) [-2019.689] (-2022.157) * [-2013.640] (-2030.151) (-2026.276) (-2015.945) -- 0:06:38
157000 -- (-2019.926) (-2014.929) (-2026.575) [-2025.450] * (-2018.189) [-2016.074] (-2022.550) (-2016.685) -- 0:06:37
157500 -- (-2019.206) (-2028.257) (-2015.418) [-2015.923] * [-2017.908] (-2018.658) (-2026.841) (-2018.410) -- 0:06:35
158000 -- (-2013.952) [-2017.645] (-2019.315) (-2012.490) * [-2016.518] (-2015.009) (-2017.554) (-2025.704) -- 0:06:39
158500 -- (-2014.385) (-2015.237) (-2020.365) [-2011.907] * (-2022.712) (-2018.828) (-2029.841) [-2014.708] -- 0:06:38
159000 -- (-2016.463) (-2022.506) [-2025.955] (-2026.144) * (-2020.586) [-2022.772] (-2024.833) (-2014.542) -- 0:06:36
159500 -- [-2010.873] (-2016.898) (-2026.787) (-2020.228) * (-2024.400) [-2014.319] (-2033.807) (-2028.328) -- 0:06:35
160000 -- (-2023.575) (-2022.072) (-2026.433) [-2012.635] * [-2022.248] (-2030.664) (-2023.579) (-2014.236) -- 0:06:39
Average standard deviation of split frequencies: 0.012959
160500 -- (-2012.821) (-2021.086) (-2017.827) [-2020.286] * (-2015.959) (-2022.164) [-2017.892] (-2026.922) -- 0:06:37
161000 -- [-2016.187] (-2027.836) (-2019.809) (-2012.684) * (-2008.111) (-2023.085) (-2020.045) [-2016.479] -- 0:06:36
161500 -- [-2015.808] (-2027.138) (-2023.605) (-2021.406) * (-2019.894) (-2035.798) (-2018.870) [-2019.919] -- 0:06:34
162000 -- (-2022.073) (-2027.751) [-2018.064] (-2018.360) * [-2024.904] (-2017.210) (-2014.582) (-2019.168) -- 0:06:38
162500 -- (-2017.424) (-2024.724) (-2023.063) [-2016.871] * (-2024.852) (-2024.017) (-2021.078) [-2013.644] -- 0:06:36
163000 -- (-2013.842) (-2026.945) (-2021.835) [-2012.398] * (-2024.833) (-2022.283) (-2015.740) [-2022.446] -- 0:06:35
163500 -- (-2017.111) (-2027.242) [-2019.114] (-2018.460) * [-2017.749] (-2025.993) (-2028.806) (-2019.988) -- 0:06:33
164000 -- [-2012.806] (-2023.580) (-2019.698) (-2019.739) * [-2016.872] (-2017.882) (-2021.970) (-2019.509) -- 0:06:37
164500 -- [-2013.184] (-2019.494) (-2023.235) (-2016.020) * (-2019.088) (-2023.990) [-2014.788] (-2022.546) -- 0:06:36
165000 -- (-2016.930) (-2015.707) [-2022.909] (-2022.935) * (-2012.601) [-2013.183] (-2021.009) (-2010.865) -- 0:06:34
Average standard deviation of split frequencies: 0.017512
165500 -- [-2019.948] (-2020.155) (-2023.425) (-2023.986) * [-2015.110] (-2015.133) (-2020.354) (-2026.465) -- 0:06:33
166000 -- (-2023.516) [-2026.276] (-2028.260) (-2026.535) * [-2014.344] (-2020.591) (-2020.837) (-2015.177) -- 0:06:36
166500 -- (-2021.825) (-2027.230) [-2016.890] (-2015.904) * [-2020.216] (-2023.200) (-2012.043) (-2019.912) -- 0:06:35
167000 -- [-2015.920] (-2025.353) (-2021.973) (-2019.373) * (-2025.774) (-2021.261) [-2016.676] (-2021.116) -- 0:06:34
167500 -- (-2018.882) (-2016.204) (-2020.707) [-2015.861] * (-2017.490) (-2016.960) [-2011.801] (-2025.919) -- 0:06:32
168000 -- (-2019.145) [-2014.453] (-2014.909) (-2019.609) * (-2013.371) [-2014.159] (-2021.602) (-2022.289) -- 0:06:31
168500 -- [-2014.407] (-2017.468) (-2017.492) (-2015.993) * (-2022.293) [-2012.093] (-2017.253) (-2017.688) -- 0:06:34
169000 -- (-2011.913) (-2014.818) (-2016.454) [-2021.119] * [-2014.199] (-2014.373) (-2028.697) (-2019.109) -- 0:06:33
169500 -- (-2021.829) (-2016.473) (-2018.688) [-2017.066] * [-2018.341] (-2031.482) (-2026.875) (-2026.639) -- 0:06:31
170000 -- (-2027.083) (-2019.941) (-2019.484) [-2014.608] * (-2021.968) [-2016.661] (-2022.900) (-2023.023) -- 0:06:30
Average standard deviation of split frequencies: 0.015882
170500 -- (-2018.919) [-2023.907] (-2022.601) (-2021.971) * (-2021.491) (-2015.861) [-2017.657] (-2020.701) -- 0:06:34
171000 -- (-2025.655) (-2023.369) (-2023.295) [-2016.249] * (-2018.252) (-2014.245) (-2021.242) [-2017.802] -- 0:06:32
171500 -- [-2012.965] (-2035.264) (-2022.493) (-2025.288) * [-2018.700] (-2022.886) (-2019.340) (-2020.900) -- 0:06:31
172000 -- (-2013.848) (-2025.550) [-2018.002] (-2026.868) * (-2021.156) (-2016.047) (-2012.942) [-2015.132] -- 0:06:29
172500 -- (-2015.620) [-2017.956] (-2024.507) (-2016.869) * (-2024.749) (-2016.568) [-2017.344] (-2023.351) -- 0:06:33
173000 -- (-2019.062) (-2017.915) [-2017.672] (-2018.962) * (-2024.910) (-2025.728) [-2021.746] (-2020.755) -- 0:06:31
173500 -- (-2023.336) (-2028.770) [-2014.194] (-2024.437) * [-2024.307] (-2023.730) (-2018.971) (-2017.998) -- 0:06:30
174000 -- [-2015.220] (-2017.564) (-2031.099) (-2018.275) * (-2012.829) [-2017.475] (-2017.905) (-2026.819) -- 0:06:29
174500 -- (-2030.102) [-2019.005] (-2017.633) (-2015.334) * [-2015.432] (-2026.959) (-2023.815) (-2033.733) -- 0:06:32
175000 -- (-2016.647) [-2017.435] (-2022.449) (-2027.929) * (-2014.521) (-2017.710) (-2018.167) [-2019.007] -- 0:06:31
Average standard deviation of split frequencies: 0.016071
175500 -- (-2023.305) [-2018.458] (-2019.913) (-2015.855) * (-2014.680) (-2029.794) (-2016.271) [-2020.352] -- 0:06:29
176000 -- (-2029.571) (-2015.611) [-2017.379] (-2023.099) * (-2017.680) (-2018.857) [-2021.936] (-2025.167) -- 0:06:28
176500 -- (-2026.506) [-2014.203] (-2014.148) (-2026.786) * (-2018.091) [-2015.679] (-2015.629) (-2015.823) -- 0:06:31
177000 -- (-2019.873) [-2016.800] (-2019.245) (-2017.958) * (-2015.114) (-2018.364) [-2021.924] (-2029.642) -- 0:06:30
177500 -- (-2036.722) [-2020.555] (-2017.708) (-2022.997) * (-2024.956) (-2027.280) [-2023.016] (-2022.430) -- 0:06:29
178000 -- [-2020.311] (-2025.744) (-2022.359) (-2018.012) * [-2023.581] (-2023.883) (-2023.663) (-2020.154) -- 0:06:27
178500 -- (-2033.367) (-2016.890) [-2016.653] (-2027.794) * (-2023.035) (-2024.322) (-2020.399) [-2023.058] -- 0:06:26
179000 -- (-2026.669) (-2021.543) [-2021.884] (-2020.340) * (-2025.024) (-2013.756) [-2019.244] (-2017.307) -- 0:06:29
179500 -- (-2022.677) (-2025.300) (-2021.778) [-2018.407] * (-2037.558) (-2012.383) [-2018.109] (-2016.588) -- 0:06:28
180000 -- (-2016.908) (-2022.371) (-2022.323) [-2015.816] * (-2023.161) (-2010.729) (-2028.141) [-2016.513] -- 0:06:27
Average standard deviation of split frequencies: 0.013046
180500 -- (-2019.765) (-2026.036) [-2011.652] (-2015.759) * (-2029.908) [-2009.778] (-2024.322) (-2014.363) -- 0:06:25
181000 -- (-2022.495) (-2021.420) [-2015.097] (-2015.891) * (-2020.433) (-2015.118) (-2022.966) [-2015.548] -- 0:06:29
181500 -- (-2022.180) (-2015.294) (-2018.108) [-2019.622] * (-2014.264) [-2014.963] (-2014.686) (-2028.116) -- 0:06:27
182000 -- (-2017.306) [-2018.084] (-2024.273) (-2019.297) * (-2020.222) (-2016.181) [-2017.961] (-2022.782) -- 0:06:26
182500 -- (-2020.676) (-2018.366) (-2020.607) [-2021.100] * (-2017.652) (-2017.340) (-2013.551) [-2017.584] -- 0:06:25
183000 -- (-2020.158) (-2025.416) (-2016.610) [-2018.446] * (-2024.071) (-2018.684) (-2027.999) [-2013.574] -- 0:06:28
183500 -- (-2022.444) (-2023.979) [-2015.895] (-2019.861) * [-2013.400] (-2010.947) (-2023.813) (-2021.209) -- 0:06:27
184000 -- (-2018.616) (-2014.443) [-2024.074] (-2018.001) * (-2017.876) [-2022.584] (-2038.191) (-2015.781) -- 0:06:25
184500 -- (-2023.208) (-2018.825) [-2023.384] (-2015.830) * [-2019.612] (-2017.596) (-2017.987) (-2025.721) -- 0:06:24
185000 -- (-2017.146) [-2017.342] (-2021.259) (-2014.242) * [-2012.081] (-2019.338) (-2016.517) (-2014.743) -- 0:06:27
Average standard deviation of split frequencies: 0.012461
185500 -- (-2022.419) [-2019.482] (-2015.899) (-2020.007) * (-2016.791) [-2018.838] (-2014.968) (-2021.219) -- 0:06:26
186000 -- (-2026.449) (-2022.558) [-2014.425] (-2020.233) * [-2021.655] (-2015.537) (-2019.944) (-2019.106) -- 0:06:25
186500 -- (-2022.157) (-2026.463) [-2015.240] (-2017.635) * (-2018.991) (-2017.415) [-2016.200] (-2018.586) -- 0:06:23
187000 -- (-2028.602) (-2015.693) [-2020.197] (-2014.739) * (-2025.232) [-2021.196] (-2014.826) (-2020.030) -- 0:06:22
187500 -- (-2024.727) (-2022.279) (-2023.003) [-2014.913] * (-2017.714) (-2023.158) (-2022.871) [-2020.625] -- 0:06:25
188000 -- [-2023.003] (-2028.822) (-2019.085) (-2022.164) * (-2018.428) (-2011.503) [-2019.070] (-2016.598) -- 0:06:24
188500 -- (-2027.561) (-2016.303) (-2015.686) [-2022.240] * [-2022.943] (-2022.841) (-2022.953) (-2018.245) -- 0:06:23
189000 -- (-2018.678) [-2018.896] (-2018.732) (-2021.699) * [-2012.792] (-2027.648) (-2017.659) (-2023.093) -- 0:06:26
189500 -- (-2022.958) (-2020.693) [-2014.632] (-2023.152) * (-2016.918) [-2014.661] (-2023.111) (-2028.519) -- 0:06:24
190000 -- (-2023.432) [-2018.883] (-2021.674) (-2016.740) * (-2015.651) [-2017.109] (-2023.000) (-2018.571) -- 0:06:23
Average standard deviation of split frequencies: 0.010508
190500 -- (-2020.990) [-2018.350] (-2019.352) (-2018.120) * (-2018.642) [-2014.400] (-2030.085) (-2014.501) -- 0:06:22
191000 -- (-2024.583) (-2016.926) [-2020.021] (-2014.942) * [-2017.659] (-2016.207) (-2024.092) (-2016.914) -- 0:06:25
191500 -- (-2031.006) [-2012.603] (-2011.944) (-2025.546) * (-2021.765) [-2016.713] (-2025.310) (-2017.063) -- 0:06:24
192000 -- (-2015.024) (-2017.858) (-2017.148) [-2011.064] * (-2030.666) (-2024.506) (-2013.540) [-2019.177] -- 0:06:22
192500 -- (-2015.428) (-2019.500) [-2023.126] (-2015.772) * (-2023.333) (-2026.880) [-2018.052] (-2023.976) -- 0:06:21
193000 -- (-2016.304) (-2017.893) [-2016.190] (-2019.382) * (-2025.341) [-2022.460] (-2021.228) (-2023.995) -- 0:06:20
193500 -- (-2032.729) (-2020.523) (-2027.786) [-2018.694] * [-2017.799] (-2021.469) (-2017.382) (-2027.926) -- 0:06:23
194000 -- (-2027.158) (-2020.357) (-2016.420) [-2020.243] * [-2016.144] (-2018.854) (-2019.455) (-2016.289) -- 0:06:22
194500 -- (-2020.554) (-2022.153) (-2017.723) [-2018.314] * (-2018.524) (-2018.529) (-2010.751) [-2013.867] -- 0:06:21
195000 -- [-2022.166] (-2017.325) (-2016.785) (-2011.201) * [-2012.954] (-2025.729) (-2018.053) (-2026.288) -- 0:06:19
Average standard deviation of split frequencies: 0.009019
195500 -- (-2016.427) (-2024.105) [-2022.983] (-2019.918) * (-2021.045) [-2024.980] (-2020.471) (-2015.630) -- 0:06:22
196000 -- (-2022.167) (-2030.943) (-2013.104) [-2018.012] * [-2023.022] (-2020.340) (-2024.726) (-2016.738) -- 0:06:21
196500 -- (-2024.376) (-2032.037) [-2022.093] (-2020.546) * [-2016.649] (-2023.189) (-2021.195) (-2018.406) -- 0:06:20
197000 -- [-2016.614] (-2027.614) (-2016.469) (-2017.529) * (-2016.701) (-2022.978) (-2018.060) [-2015.771] -- 0:06:19
197500 -- (-2022.716) [-2012.374] (-2019.961) (-2020.585) * (-2019.459) (-2035.148) (-2024.520) [-2012.464] -- 0:06:21
198000 -- (-2014.155) [-2015.444] (-2017.205) (-2025.261) * (-2020.731) [-2018.171] (-2014.269) (-2015.858) -- 0:06:20
198500 -- [-2017.116] (-2023.791) (-2020.865) (-2017.245) * (-2019.523) [-2012.832] (-2025.608) (-2016.670) -- 0:06:19
199000 -- (-2011.091) (-2013.648) (-2027.632) [-2014.240] * (-2027.102) (-2016.924) (-2014.381) [-2015.035] -- 0:06:18
199500 -- [-2014.738] (-2019.714) (-2026.090) (-2014.138) * (-2027.847) (-2024.619) (-2026.995) [-2016.357] -- 0:06:17
200000 -- (-2019.709) (-2025.075) (-2019.499) [-2011.179] * (-2021.406) (-2029.899) (-2020.935) [-2013.506] -- 0:06:20
Average standard deviation of split frequencies: 0.010376
200500 -- (-2019.286) (-2018.404) (-2018.048) [-2019.364] * (-2024.773) (-2018.841) (-2026.107) [-2013.488] -- 0:06:18
201000 -- (-2021.405) (-2026.660) [-2013.929] (-2016.443) * (-2015.718) (-2026.056) (-2026.955) [-2017.040] -- 0:06:17
201500 -- (-2017.960) [-2014.664] (-2020.026) (-2014.304) * [-2014.592] (-2022.297) (-2028.383) (-2013.076) -- 0:06:16
202000 -- (-2021.603) (-2021.700) (-2017.817) [-2019.325] * (-2027.372) (-2021.266) (-2028.120) [-2015.107] -- 0:06:19
202500 -- (-2034.786) [-2026.605] (-2016.199) (-2021.908) * [-2022.044] (-2016.689) (-2024.004) (-2020.106) -- 0:06:18
203000 -- (-2027.091) (-2022.191) [-2015.996] (-2022.207) * (-2024.248) [-2021.322] (-2017.385) (-2024.665) -- 0:06:16
203500 -- (-2021.896) [-2017.849] (-2018.014) (-2027.579) * (-2026.712) (-2014.875) [-2013.592] (-2017.521) -- 0:06:15
204000 -- (-2020.435) (-2025.596) [-2017.629] (-2018.764) * (-2020.663) (-2031.279) [-2012.933] (-2017.224) -- 0:06:18
204500 -- (-2019.366) [-2015.934] (-2017.966) (-2019.517) * (-2011.496) (-2019.668) (-2015.207) [-2017.763] -- 0:06:17
205000 -- (-2015.148) (-2017.265) [-2014.886] (-2029.394) * (-2015.520) [-2015.519] (-2013.282) (-2020.566) -- 0:06:16
Average standard deviation of split frequencies: 0.012205
205500 -- [-2009.705] (-2023.649) (-2018.550) (-2017.657) * (-2024.060) (-2012.093) (-2014.178) [-2020.706] -- 0:06:15
206000 -- (-2019.168) [-2013.463] (-2018.993) (-2027.762) * (-2017.042) (-2022.936) (-2019.312) [-2018.383] -- 0:06:13
206500 -- [-2017.767] (-2020.416) (-2029.400) (-2022.024) * (-2012.873) (-2012.099) [-2015.406] (-2021.231) -- 0:06:16
207000 -- (-2016.457) [-2019.756] (-2014.643) (-2023.533) * (-2024.694) (-2026.760) [-2023.382] (-2020.665) -- 0:06:15
207500 -- (-2018.798) [-2016.277] (-2014.935) (-2022.210) * (-2016.165) [-2020.898] (-2019.035) (-2016.161) -- 0:06:14
208000 -- (-2032.075) (-2017.674) [-2015.912] (-2017.855) * (-2019.804) [-2023.782] (-2018.058) (-2018.163) -- 0:06:13
208500 -- (-2022.448) (-2016.540) (-2012.845) [-2016.886] * [-2016.105] (-2019.074) (-2023.007) (-2022.615) -- 0:06:15
209000 -- (-2026.239) [-2011.796] (-2013.053) (-2021.132) * (-2012.466) (-2017.944) [-2017.521] (-2017.737) -- 0:06:14
209500 -- (-2015.091) [-2015.871] (-2021.079) (-2016.886) * (-2024.938) (-2023.358) [-2018.403] (-2019.023) -- 0:06:13
210000 -- (-2014.609) (-2024.352) [-2010.110] (-2028.999) * (-2021.331) (-2024.904) (-2025.425) [-2016.527] -- 0:06:12
Average standard deviation of split frequencies: 0.012680
210500 -- [-2011.248] (-2016.155) (-2012.029) (-2022.588) * (-2031.841) (-2018.803) [-2019.538] (-2013.558) -- 0:06:11
211000 -- (-2018.829) (-2016.714) [-2012.941] (-2020.435) * (-2029.346) (-2016.319) [-2015.336] (-2015.630) -- 0:06:13
211500 -- (-2021.807) [-2013.330] (-2019.450) (-2014.925) * (-2020.798) (-2020.920) (-2020.971) [-2017.875] -- 0:06:12
212000 -- (-2017.325) (-2010.586) (-2026.916) [-2020.344] * (-2019.662) [-2018.963] (-2019.859) (-2018.478) -- 0:06:11
212500 -- (-2018.524) (-2017.092) [-2019.828] (-2022.719) * (-2019.711) (-2026.242) (-2025.196) [-2020.552] -- 0:06:10
213000 -- (-2021.239) (-2019.183) (-2018.236) [-2016.470] * [-2024.169] (-2026.087) (-2022.065) (-2014.513) -- 0:06:13
213500 -- (-2017.591) (-2016.351) (-2019.667) [-2016.321] * [-2013.283] (-2026.840) (-2020.461) (-2018.792) -- 0:06:12
214000 -- (-2029.025) (-2019.192) [-2016.369] (-2020.746) * [-2011.673] (-2021.344) (-2015.356) (-2027.629) -- 0:06:10
214500 -- (-2017.437) [-2012.964] (-2019.266) (-2026.265) * (-2023.213) (-2019.809) (-2019.355) [-2019.729] -- 0:06:09
215000 -- (-2020.655) [-2018.092] (-2020.567) (-2013.448) * (-2022.255) [-2022.706] (-2023.262) (-2016.504) -- 0:06:12
Average standard deviation of split frequencies: 0.012003
215500 -- (-2014.834) (-2027.338) (-2019.608) [-2018.308] * [-2016.567] (-2012.287) (-2019.825) (-2025.137) -- 0:06:11
216000 -- (-2019.932) [-2014.528] (-2026.521) (-2021.024) * (-2021.634) [-2013.593] (-2021.486) (-2029.143) -- 0:06:10
216500 -- (-2021.710) (-2024.048) [-2019.845] (-2022.395) * (-2025.118) [-2014.943] (-2024.858) (-2018.265) -- 0:06:09
217000 -- (-2022.279) (-2019.046) [-2022.095] (-2019.799) * [-2013.206] (-2019.273) (-2015.741) (-2023.069) -- 0:06:08
217500 -- (-2026.201) (-2013.747) [-2014.361] (-2015.412) * [-2017.429] (-2023.623) (-2011.952) (-2022.177) -- 0:06:10
218000 -- (-2020.914) [-2019.245] (-2014.637) (-2025.665) * (-2020.117) (-2027.938) [-2016.419] (-2022.624) -- 0:06:09
218500 -- [-2015.735] (-2025.238) (-2021.650) (-2024.826) * (-2018.306) (-2018.753) [-2014.766] (-2017.632) -- 0:06:08
219000 -- (-2026.539) (-2024.436) [-2017.584] (-2028.484) * (-2021.296) [-2019.922] (-2027.209) (-2017.727) -- 0:06:07
219500 -- (-2021.183) (-2028.476) [-2023.985] (-2024.930) * (-2015.630) [-2015.843] (-2013.742) (-2014.311) -- 0:06:09
220000 -- (-2015.834) [-2027.483] (-2019.464) (-2024.442) * (-2015.850) (-2018.050) [-2020.309] (-2019.297) -- 0:06:08
Average standard deviation of split frequencies: 0.012284
220500 -- (-2021.325) (-2033.207) (-2019.564) [-2014.757] * (-2022.563) (-2018.232) [-2012.849] (-2018.914) -- 0:06:07
221000 -- (-2024.074) (-2028.969) (-2018.556) [-2023.417] * (-2015.694) [-2018.696] (-2026.243) (-2012.406) -- 0:06:06
221500 -- [-2017.870] (-2028.136) (-2022.224) (-2025.206) * [-2018.291] (-2024.855) (-2011.374) (-2026.783) -- 0:06:09
222000 -- (-2021.584) (-2018.820) (-2026.428) [-2017.978] * [-2017.348] (-2021.276) (-2013.225) (-2029.727) -- 0:06:07
222500 -- [-2017.247] (-2023.701) (-2019.427) (-2018.990) * (-2021.901) (-2020.602) (-2019.805) [-2024.017] -- 0:06:06
223000 -- [-2021.164] (-2030.264) (-2020.023) (-2021.487) * [-2019.512] (-2016.493) (-2015.835) (-2019.766) -- 0:06:05
223500 -- (-2019.633) (-2018.818) (-2020.302) [-2015.715] * (-2019.354) [-2014.426] (-2022.830) (-2016.043) -- 0:06:04
224000 -- [-2020.606] (-2016.625) (-2024.794) (-2023.445) * [-2019.058] (-2022.232) (-2026.454) (-2021.292) -- 0:06:07
224500 -- [-2017.773] (-2024.374) (-2017.747) (-2019.496) * (-2020.186) (-2024.472) (-2021.148) [-2014.171] -- 0:06:06
225000 -- (-2019.272) [-2017.398] (-2015.254) (-2019.580) * (-2015.249) (-2028.168) [-2015.407] (-2017.737) -- 0:06:05
Average standard deviation of split frequencies: 0.011298
225500 -- (-2018.342) (-2015.255) [-2019.355] (-2024.400) * (-2026.192) (-2027.712) [-2022.990] (-2026.103) -- 0:06:04
226000 -- (-2015.232) [-2015.335] (-2019.782) (-2015.020) * (-2016.635) [-2020.178] (-2019.712) (-2021.307) -- 0:06:06
226500 -- (-2023.487) (-2023.574) [-2020.098] (-2017.775) * (-2019.191) (-2014.782) [-2018.231] (-2022.262) -- 0:06:05
227000 -- (-2027.253) (-2033.173) (-2026.516) [-2016.095] * (-2021.022) (-2013.298) [-2017.599] (-2025.185) -- 0:06:04
227500 -- (-2017.965) (-2022.064) [-2016.098] (-2024.680) * (-2024.417) (-2015.571) [-2021.091] (-2024.036) -- 0:06:03
228000 -- (-2021.860) (-2023.173) [-2022.418] (-2019.263) * (-2014.562) (-2020.839) (-2023.505) [-2016.502] -- 0:06:02
228500 -- (-2018.783) (-2017.642) [-2019.926] (-2016.695) * (-2021.565) [-2022.106] (-2025.015) (-2016.088) -- 0:06:04
229000 -- (-2022.070) [-2023.552] (-2024.408) (-2021.523) * (-2018.030) (-2022.311) (-2025.488) [-2015.667] -- 0:06:03
229500 -- (-2015.359) [-2015.484] (-2017.717) (-2026.536) * (-2019.939) (-2021.210) [-2016.221] (-2014.884) -- 0:06:02
230000 -- (-2013.456) [-2022.299] (-2017.053) (-2020.823) * [-2026.821] (-2016.918) (-2020.754) (-2018.845) -- 0:06:01
Average standard deviation of split frequencies: 0.012262
230500 -- [-2021.351] (-2014.830) (-2019.814) (-2027.424) * [-2016.040] (-2018.422) (-2014.401) (-2022.618) -- 0:06:03
231000 -- (-2029.051) (-2026.812) [-2011.355] (-2023.004) * [-2014.438] (-2017.540) (-2019.584) (-2032.481) -- 0:06:02
231500 -- (-2028.119) [-2023.256] (-2019.539) (-2019.496) * [-2025.479] (-2017.526) (-2033.241) (-2015.318) -- 0:06:01
232000 -- (-2026.349) [-2017.541] (-2022.135) (-2018.880) * [-2016.746] (-2016.498) (-2026.870) (-2018.304) -- 0:06:00
232500 -- (-2028.685) (-2024.284) [-2014.874] (-2020.229) * [-2021.059] (-2019.131) (-2021.356) (-2014.869) -- 0:06:03
233000 -- (-2015.147) (-2025.045) (-2016.261) [-2011.457] * [-2011.880] (-2020.909) (-2016.374) (-2019.318) -- 0:06:02
233500 -- (-2019.497) (-2020.454) (-2023.258) [-2017.299] * [-2015.353] (-2018.481) (-2031.453) (-2021.493) -- 0:06:01
234000 -- (-2020.761) [-2024.205] (-2020.765) (-2017.199) * (-2019.472) (-2019.422) [-2022.509] (-2020.981) -- 0:06:00
234500 -- (-2018.875) [-2021.321] (-2020.751) (-2018.214) * (-2019.138) [-2012.717] (-2024.226) (-2018.418) -- 0:05:59
235000 -- [-2016.320] (-2018.525) (-2018.858) (-2021.082) * [-2011.721] (-2024.277) (-2022.248) (-2022.960) -- 0:06:01
Average standard deviation of split frequencies: 0.013317
235500 -- [-2014.276] (-2015.272) (-2015.813) (-2026.806) * [-2016.245] (-2017.692) (-2019.103) (-2017.808) -- 0:06:00
236000 -- (-2018.917) (-2021.994) [-2016.075] (-2021.163) * (-2028.393) (-2022.761) [-2023.597] (-2015.084) -- 0:05:59
236500 -- [-2011.889] (-2026.771) (-2016.568) (-2028.141) * (-2021.356) (-2017.731) (-2023.816) [-2017.990] -- 0:05:58
237000 -- (-2014.973) (-2021.306) [-2012.030] (-2023.536) * (-2016.049) (-2019.838) (-2015.893) [-2022.562] -- 0:06:00
237500 -- (-2016.129) (-2018.533) [-2016.611] (-2024.260) * (-2018.026) (-2022.037) [-2023.249] (-2027.458) -- 0:05:59
238000 -- (-2012.725) (-2017.445) [-2021.543] (-2019.662) * [-2016.492] (-2029.131) (-2021.938) (-2017.052) -- 0:05:58
238500 -- (-2019.951) (-2016.864) [-2020.639] (-2021.688) * (-2020.955) (-2027.506) [-2017.088] (-2016.400) -- 0:05:57
239000 -- (-2018.993) [-2020.041] (-2015.721) (-2027.098) * (-2025.211) (-2026.132) (-2015.047) [-2018.365] -- 0:05:59
239500 -- (-2036.085) (-2021.762) [-2018.151] (-2014.902) * (-2034.769) (-2026.768) [-2018.675] (-2016.232) -- 0:05:58
240000 -- (-2020.777) (-2012.389) (-2012.885) [-2020.147] * (-2029.489) (-2024.135) (-2016.784) [-2015.856] -- 0:05:57
Average standard deviation of split frequencies: 0.015507
240500 -- (-2018.779) (-2020.197) (-2017.295) [-2013.872] * [-2021.346] (-2019.547) (-2014.785) (-2021.544) -- 0:05:56
241000 -- (-2025.427) (-2013.285) (-2022.193) [-2017.035] * (-2020.243) [-2017.892] (-2023.670) (-2024.684) -- 0:05:59
241500 -- (-2021.953) [-2014.060] (-2019.875) (-2024.120) * (-2027.539) (-2017.744) (-2020.055) [-2025.754] -- 0:05:58
242000 -- (-2020.942) [-2013.038] (-2027.855) (-2019.355) * (-2031.609) (-2018.432) (-2016.420) [-2020.794] -- 0:05:57
242500 -- (-2020.188) [-2014.935] (-2015.606) (-2018.159) * (-2011.501) (-2021.115) [-2023.218] (-2027.412) -- 0:05:56
243000 -- (-2017.324) (-2023.442) [-2012.664] (-2022.010) * (-2019.622) (-2016.052) [-2016.227] (-2019.514) -- 0:05:55
243500 -- (-2024.578) (-2019.959) [-2013.960] (-2017.769) * (-2018.990) (-2018.484) (-2015.457) [-2014.952] -- 0:05:57
244000 -- (-2018.012) (-2026.575) [-2017.918] (-2018.314) * (-2022.554) (-2020.691) (-2019.517) [-2022.892] -- 0:05:56
244500 -- [-2014.987] (-2021.594) (-2019.335) (-2011.689) * [-2022.105] (-2018.975) (-2015.680) (-2029.629) -- 0:05:55
245000 -- (-2018.177) (-2018.343) (-2018.551) [-2018.321] * (-2033.057) (-2015.755) (-2025.876) [-2019.668] -- 0:05:57
Average standard deviation of split frequencies: 0.014532
245500 -- (-2017.409) (-2026.272) (-2026.143) [-2017.225] * (-2021.251) (-2018.953) (-2013.283) [-2021.697] -- 0:05:56
246000 -- [-2012.845] (-2021.681) (-2019.200) (-2018.400) * (-2028.251) (-2014.383) [-2016.723] (-2027.685) -- 0:05:55
246500 -- [-2021.235] (-2030.099) (-2030.622) (-2017.623) * (-2017.879) (-2022.458) [-2022.524] (-2025.524) -- 0:05:54
247000 -- (-2018.734) (-2014.805) (-2025.391) [-2021.538] * (-2028.681) (-2013.164) [-2021.719] (-2027.579) -- 0:05:53
247500 -- (-2015.885) [-2018.513] (-2026.252) (-2018.381) * (-2018.427) [-2010.745] (-2020.837) (-2019.625) -- 0:05:55
248000 -- [-2015.779] (-2022.136) (-2019.533) (-2017.167) * [-2018.511] (-2018.378) (-2017.652) (-2017.144) -- 0:05:54
248500 -- (-2017.704) (-2013.067) (-2032.044) [-2015.426] * (-2022.132) (-2019.852) (-2016.604) [-2022.768] -- 0:05:53
249000 -- (-2024.263) (-2011.333) (-2023.340) [-2019.472] * (-2014.816) (-2023.083) [-2016.629] (-2024.780) -- 0:05:52
249500 -- (-2018.892) (-2021.081) (-2023.662) [-2020.643] * [-2014.331] (-2021.825) (-2022.930) (-2021.430) -- 0:05:54
250000 -- (-2018.653) (-2017.104) [-2017.235] (-2012.694) * (-2025.523) (-2013.526) [-2019.173] (-2019.541) -- 0:05:54
Average standard deviation of split frequencies: 0.015828
250500 -- (-2018.538) [-2018.072] (-2021.810) (-2012.228) * (-2015.644) [-2013.926] (-2016.830) (-2018.632) -- 0:05:53
251000 -- (-2016.576) [-2014.387] (-2021.064) (-2026.139) * (-2022.048) (-2021.260) (-2015.312) [-2016.978] -- 0:05:52
251500 -- [-2016.882] (-2020.085) (-2020.232) (-2023.064) * (-2013.054) [-2017.752] (-2012.295) (-2025.805) -- 0:05:54
252000 -- (-2026.897) [-2015.489] (-2013.585) (-2021.417) * (-2015.355) [-2018.184] (-2029.874) (-2020.646) -- 0:05:53
252500 -- (-2017.144) (-2018.683) [-2017.561] (-2020.239) * (-2015.642) (-2016.552) (-2027.890) [-2016.427] -- 0:05:52
253000 -- (-2013.009) [-2015.928] (-2028.732) (-2027.316) * (-2016.477) (-2022.219) (-2023.745) [-2019.187] -- 0:05:51
253500 -- [-2017.380] (-2019.807) (-2014.551) (-2017.702) * (-2012.617) [-2015.233] (-2016.393) (-2022.391) -- 0:05:50
254000 -- [-2010.208] (-2023.595) (-2016.869) (-2025.169) * (-2017.240) (-2014.061) (-2026.974) [-2019.197] -- 0:05:52
254500 -- (-2020.879) (-2021.068) (-2018.001) [-2018.767] * (-2018.948) [-2017.611] (-2017.655) (-2025.403) -- 0:05:51
255000 -- [-2017.880] (-2018.247) (-2026.270) (-2017.170) * (-2020.492) [-2016.729] (-2019.471) (-2024.346) -- 0:05:50
Average standard deviation of split frequencies: 0.016266
255500 -- (-2025.171) [-2013.145] (-2018.478) (-2020.101) * (-2018.511) [-2014.439] (-2016.594) (-2019.650) -- 0:05:49
256000 -- (-2023.117) (-2014.083) (-2017.050) [-2014.712] * (-2013.388) [-2018.363] (-2017.950) (-2028.896) -- 0:05:51
256500 -- (-2029.726) (-2015.556) [-2016.838] (-2020.703) * (-2016.541) [-2021.642] (-2018.156) (-2030.286) -- 0:05:50
257000 -- [-2020.902] (-2017.173) (-2013.821) (-2019.425) * [-2026.759] (-2015.038) (-2026.361) (-2015.431) -- 0:05:49
257500 -- (-2022.652) (-2025.288) (-2025.037) [-2015.459] * (-2017.111) [-2018.802] (-2019.206) (-2014.609) -- 0:05:48
258000 -- (-2020.052) (-2021.293) (-2020.267) [-2018.810] * (-2018.388) (-2021.248) (-2025.429) [-2020.540] -- 0:05:50
258500 -- (-2021.947) (-2020.738) (-2019.922) [-2016.552] * (-2018.300) (-2022.252) (-2020.056) [-2017.969] -- 0:05:49
259000 -- (-2019.103) (-2022.560) [-2018.191] (-2015.266) * (-2023.010) (-2015.380) (-2020.611) [-2014.603] -- 0:05:49
259500 -- (-2013.737) (-2029.062) (-2026.169) [-2016.511] * [-2028.478] (-2023.274) (-2029.487) (-2022.769) -- 0:05:48
260000 -- (-2015.128) (-2012.870) [-2010.709] (-2020.037) * (-2023.448) (-2022.844) (-2024.419) [-2019.970] -- 0:05:47
Average standard deviation of split frequencies: 0.016276
260500 -- (-2022.345) (-2016.967) [-2014.690] (-2021.085) * (-2019.418) [-2018.041] (-2013.364) (-2021.298) -- 0:05:49
261000 -- (-2020.609) (-2019.451) [-2018.701] (-2018.250) * (-2016.732) [-2015.430] (-2020.868) (-2020.115) -- 0:05:48
261500 -- (-2014.767) [-2015.751] (-2021.466) (-2021.532) * (-2023.191) (-2015.119) [-2022.154] (-2020.831) -- 0:05:47
262000 -- (-2018.890) (-2014.970) [-2020.205] (-2019.247) * (-2026.995) (-2015.793) (-2030.764) [-2020.318] -- 0:05:46
262500 -- (-2018.601) (-2019.663) (-2017.473) [-2015.314] * [-2017.130] (-2015.182) (-2022.610) (-2014.630) -- 0:05:48
263000 -- (-2019.626) [-2017.467] (-2016.824) (-2022.201) * (-2025.430) (-2025.752) [-2017.810] (-2015.122) -- 0:05:47
263500 -- [-2012.642] (-2018.459) (-2020.144) (-2012.334) * (-2023.508) (-2024.916) (-2022.678) [-2016.186] -- 0:05:46
264000 -- [-2021.016] (-2013.588) (-2020.228) (-2015.767) * (-2024.489) [-2018.734] (-2021.370) (-2015.496) -- 0:05:45
264500 -- (-2017.808) (-2019.802) (-2017.746) [-2016.766] * (-2021.992) (-2016.773) (-2024.346) [-2011.304] -- 0:05:47
265000 -- [-2014.994] (-2019.481) (-2024.242) (-2015.101) * (-2016.741) (-2017.928) [-2022.311] (-2019.767) -- 0:05:46
Average standard deviation of split frequencies: 0.016393
265500 -- (-2026.285) (-2021.548) (-2012.614) [-2019.364] * (-2020.281) (-2015.871) [-2027.437] (-2024.965) -- 0:05:45
266000 -- (-2022.863) (-2040.744) [-2014.614] (-2021.037) * (-2023.327) (-2015.372) [-2014.760] (-2030.784) -- 0:05:44
266500 -- [-2015.518] (-2024.910) (-2024.899) (-2017.404) * [-2020.481] (-2024.879) (-2015.834) (-2034.012) -- 0:05:44
267000 -- (-2025.466) [-2020.071] (-2019.074) (-2020.005) * (-2016.845) [-2013.914] (-2020.265) (-2020.185) -- 0:05:45
267500 -- (-2020.135) [-2010.135] (-2024.921) (-2027.464) * (-2014.433) (-2027.768) (-2023.201) [-2016.025] -- 0:05:45
268000 -- [-2016.526] (-2018.741) (-2019.245) (-2017.476) * [-2017.136] (-2018.045) (-2016.437) (-2028.354) -- 0:05:44
268500 -- (-2013.764) (-2021.979) [-2019.079] (-2016.227) * (-2013.301) [-2018.098] (-2016.526) (-2025.474) -- 0:05:43
269000 -- (-2015.443) (-2019.149) [-2013.688] (-2024.750) * (-2027.308) (-2015.442) [-2018.230] (-2017.657) -- 0:05:45
269500 -- (-2024.550) (-2016.729) [-2019.843] (-2015.956) * (-2025.045) (-2010.635) [-2010.871] (-2021.206) -- 0:05:44
270000 -- (-2030.443) [-2016.236] (-2015.829) (-2028.807) * [-2016.879] (-2014.426) (-2021.339) (-2013.361) -- 0:05:43
Average standard deviation of split frequencies: 0.016400
270500 -- (-2018.871) (-2017.296) [-2017.725] (-2023.284) * [-2013.963] (-2015.066) (-2023.561) (-2018.298) -- 0:05:42
271000 -- [-2017.171] (-2025.615) (-2020.309) (-2033.019) * (-2018.742) (-2015.617) (-2020.944) [-2011.259] -- 0:05:44
271500 -- [-2020.624] (-2023.294) (-2016.653) (-2033.786) * (-2022.947) (-2015.516) (-2016.452) [-2021.738] -- 0:05:43
272000 -- (-2013.743) (-2026.371) [-2014.889] (-2028.195) * [-2013.803] (-2021.490) (-2024.149) (-2015.806) -- 0:05:42
272500 -- (-2020.392) [-2023.254] (-2017.146) (-2027.020) * (-2021.309) (-2016.201) (-2017.540) [-2014.306] -- 0:05:41
273000 -- [-2014.825] (-2018.915) (-2028.225) (-2032.797) * (-2035.537) (-2021.527) (-2021.970) [-2019.005] -- 0:05:43
273500 -- [-2015.438] (-2022.382) (-2017.011) (-2016.150) * (-2033.953) (-2022.070) (-2020.662) [-2021.338] -- 0:05:42
274000 -- (-2029.663) (-2021.261) [-2018.926] (-2021.922) * (-2026.012) (-2025.622) (-2012.588) [-2020.813] -- 0:05:41
274500 -- (-2027.690) [-2014.852] (-2021.622) (-2021.608) * (-2029.316) (-2018.243) (-2026.164) [-2010.747] -- 0:05:40
275000 -- (-2026.528) (-2029.502) [-2019.675] (-2016.065) * (-2022.072) [-2014.748] (-2018.801) (-2014.169) -- 0:05:40
Average standard deviation of split frequencies: 0.017080
275500 -- (-2028.488) [-2015.934] (-2019.938) (-2017.168) * (-2018.458) (-2020.855) [-2018.790] (-2017.993) -- 0:05:41
276000 -- (-2023.387) [-2014.650] (-2014.730) (-2019.675) * (-2025.108) (-2019.569) (-2016.021) [-2012.931] -- 0:05:41
276500 -- (-2029.519) (-2014.359) (-2024.879) [-2012.128] * (-2025.201) [-2014.706] (-2020.732) (-2018.432) -- 0:05:40
277000 -- (-2023.472) [-2015.154] (-2017.904) (-2021.092) * [-2014.734] (-2015.732) (-2021.536) (-2022.757) -- 0:05:39
277500 -- (-2031.661) (-2018.775) (-2022.847) [-2024.955] * (-2021.620) (-2018.682) [-2011.752] (-2015.128) -- 0:05:41
278000 -- (-2030.106) [-2013.989] (-2016.941) (-2015.809) * (-2016.363) (-2015.198) (-2020.527) [-2015.969] -- 0:05:40
278500 -- (-2024.267) (-2021.088) (-2023.122) [-2023.557] * (-2022.946) [-2015.009] (-2017.717) (-2028.014) -- 0:05:39
279000 -- (-2013.230) [-2013.602] (-2022.222) (-2018.527) * (-2018.308) (-2014.569) [-2014.397] (-2023.549) -- 0:05:38
279500 -- (-2024.988) (-2017.934) (-2020.796) [-2013.310] * (-2030.261) (-2019.627) [-2016.163] (-2018.830) -- 0:05:40
280000 -- (-2022.481) (-2018.761) (-2026.483) [-2014.153] * (-2015.053) (-2024.028) (-2019.468) [-2018.081] -- 0:05:39
Average standard deviation of split frequencies: 0.017776
280500 -- (-2022.946) [-2015.938] (-2018.821) (-2013.647) * [-2013.074] (-2021.455) (-2022.148) (-2018.290) -- 0:05:38
281000 -- [-2019.175] (-2020.187) (-2017.241) (-2026.876) * (-2010.258) [-2014.573] (-2016.898) (-2025.999) -- 0:05:37
281500 -- [-2012.555] (-2014.592) (-2020.864) (-2023.606) * (-2011.992) (-2015.686) (-2020.781) [-2019.349] -- 0:05:39
282000 -- (-2014.433) (-2016.322) (-2017.398) [-2014.105] * (-2016.451) (-2020.785) (-2021.387) [-2013.670] -- 0:05:38
282500 -- (-2020.059) (-2020.910) (-2018.043) [-2018.220] * (-2010.371) [-2016.037] (-2014.423) (-2016.813) -- 0:05:37
283000 -- [-2017.287] (-2014.130) (-2016.699) (-2024.728) * (-2010.927) (-2016.759) [-2019.929] (-2019.376) -- 0:05:36
283500 -- (-2020.467) (-2017.868) [-2018.813] (-2015.343) * [-2014.233] (-2016.767) (-2016.993) (-2024.890) -- 0:05:38
284000 -- (-2017.683) [-2016.370] (-2019.157) (-2019.773) * (-2015.996) (-2019.436) [-2011.766] (-2025.536) -- 0:05:37
284500 -- (-2021.577) (-2024.171) [-2018.625] (-2022.427) * (-2013.336) (-2023.667) (-2018.969) [-2014.616] -- 0:05:37
285000 -- (-2022.689) [-2021.093] (-2017.551) (-2030.161) * [-2015.876] (-2028.689) (-2022.993) (-2023.036) -- 0:05:36
Average standard deviation of split frequencies: 0.015521
285500 -- (-2021.683) (-2020.176) [-2020.264] (-2029.775) * (-2015.836) (-2027.415) (-2026.935) [-2017.425] -- 0:05:37
286000 -- (-2019.190) (-2014.348) (-2016.651) [-2021.263] * [-2015.910] (-2023.275) (-2021.583) (-2021.620) -- 0:05:37
286500 -- (-2022.628) [-2014.308] (-2016.724) (-2025.523) * (-2024.181) (-2019.532) [-2015.682] (-2021.221) -- 0:05:36
287000 -- (-2032.444) (-2016.096) [-2009.770] (-2027.083) * (-2017.870) (-2018.884) [-2015.226] (-2011.063) -- 0:05:35
287500 -- [-2020.958] (-2030.507) (-2020.972) (-2017.590) * [-2015.813] (-2017.698) (-2024.178) (-2024.265) -- 0:05:37
288000 -- [-2016.579] (-2022.220) (-2032.452) (-2016.011) * [-2022.364] (-2017.629) (-2013.810) (-2020.014) -- 0:05:36
288500 -- (-2012.138) (-2018.882) (-2022.484) [-2015.785] * (-2017.863) (-2023.470) [-2015.066] (-2021.174) -- 0:05:35
289000 -- (-2025.154) (-2018.579) [-2013.256] (-2014.696) * (-2015.337) (-2025.935) (-2013.417) [-2019.306] -- 0:05:34
289500 -- [-2014.326] (-2021.458) (-2020.406) (-2013.612) * (-2020.142) [-2017.762] (-2020.898) (-2018.162) -- 0:05:33
290000 -- [-2021.046] (-2018.402) (-2017.784) (-2015.927) * [-2020.247] (-2023.843) (-2019.093) (-2025.667) -- 0:05:35
Average standard deviation of split frequencies: 0.015948
290500 -- [-2020.920] (-2014.175) (-2027.144) (-2014.649) * (-2013.581) (-2015.746) (-2022.278) [-2020.858] -- 0:05:34
291000 -- [-2016.777] (-2017.470) (-2016.290) (-2020.005) * (-2018.868) (-2020.154) (-2017.494) [-2018.717] -- 0:05:33
291500 -- (-2016.900) (-2015.679) (-2016.964) [-2023.456] * (-2020.705) (-2013.279) [-2016.570] (-2018.700) -- 0:05:32
292000 -- [-2014.542] (-2017.025) (-2032.050) (-2016.277) * (-2020.366) [-2017.687] (-2015.033) (-2020.047) -- 0:05:34
292500 -- (-2016.507) (-2016.875) [-2017.528] (-2027.904) * (-2016.901) (-2017.764) (-2016.042) [-2012.265] -- 0:05:33
293000 -- (-2031.882) (-2035.585) [-2013.872] (-2020.577) * (-2020.806) (-2014.214) (-2014.389) [-2013.529] -- 0:05:32
293500 -- (-2022.001) [-2020.391] (-2021.210) (-2026.693) * (-2016.434) (-2012.631) [-2014.862] (-2019.973) -- 0:05:32
294000 -- (-2021.865) (-2016.193) (-2020.752) [-2015.821] * [-2014.226] (-2015.543) (-2022.667) (-2025.251) -- 0:05:33
294500 -- (-2010.333) (-2023.502) [-2017.673] (-2016.939) * (-2022.533) (-2018.585) [-2024.574] (-2028.555) -- 0:05:32
295000 -- (-2013.616) (-2018.621) (-2017.756) [-2020.486] * (-2020.908) (-2017.548) [-2016.603] (-2020.228) -- 0:05:32
Average standard deviation of split frequencies: 0.015130
295500 -- (-2014.638) (-2023.906) [-2017.127] (-2019.578) * [-2015.678] (-2025.516) (-2018.712) (-2024.318) -- 0:05:31
296000 -- (-2020.941) [-2018.589] (-2018.404) (-2022.088) * (-2017.477) (-2022.532) (-2027.192) [-2021.035] -- 0:05:30
296500 -- [-2014.054] (-2023.060) (-2017.549) (-2019.359) * (-2026.382) (-2016.502) (-2021.451) [-2013.470] -- 0:05:32
297000 -- (-2020.571) [-2017.051] (-2017.445) (-2021.427) * (-2020.964) [-2013.220] (-2020.129) (-2023.737) -- 0:05:31
297500 -- (-2028.508) (-2017.107) (-2017.186) [-2011.402] * (-2019.065) [-2018.860] (-2021.520) (-2017.713) -- 0:05:30
298000 -- (-2025.323) (-2013.283) (-2011.610) [-2021.391] * (-2015.532) [-2024.276] (-2014.782) (-2020.940) -- 0:05:29
298500 -- (-2023.986) (-2018.912) [-2021.837] (-2018.418) * (-2028.276) (-2022.037) [-2012.931] (-2023.865) -- 0:05:31
299000 -- (-2020.541) [-2013.301] (-2026.345) (-2018.785) * (-2025.763) [-2013.947] (-2021.364) (-2015.345) -- 0:05:30
299500 -- (-2018.657) [-2024.806] (-2019.387) (-2025.370) * (-2030.919) (-2013.584) [-2015.572] (-2020.573) -- 0:05:29
300000 -- [-2022.475] (-2023.623) (-2023.483) (-2021.062) * (-2020.131) [-2014.910] (-2020.266) (-2023.550) -- 0:05:29
Average standard deviation of split frequencies: 0.013146
300500 -- (-2019.209) [-2013.658] (-2024.985) (-2016.343) * (-2015.142) [-2014.834] (-2012.751) (-2024.682) -- 0:05:30
301000 -- [-2020.762] (-2020.911) (-2031.300) (-2030.528) * (-2019.988) [-2011.134] (-2014.622) (-2027.326) -- 0:05:29
301500 -- (-2018.892) [-2022.667] (-2029.797) (-2016.807) * (-2017.158) (-2016.904) [-2017.338] (-2017.429) -- 0:05:28
302000 -- (-2020.668) [-2019.446] (-2017.524) (-2025.331) * (-2018.987) (-2016.715) (-2017.800) [-2013.306] -- 0:05:28
302500 -- (-2012.471) [-2022.395] (-2019.698) (-2022.237) * (-2013.004) [-2020.345] (-2028.056) (-2018.903) -- 0:05:29
303000 -- (-2027.166) (-2026.859) (-2014.975) [-2023.483] * (-2019.026) (-2022.917) (-2024.599) [-2011.390] -- 0:05:28
303500 -- (-2022.191) (-2016.337) (-2019.342) [-2022.112] * (-2020.413) (-2014.840) (-2023.548) [-2015.954] -- 0:05:28
304000 -- (-2026.185) [-2019.701] (-2019.029) (-2019.364) * (-2026.276) [-2014.671] (-2013.210) (-2021.156) -- 0:05:27
304500 -- (-2020.635) [-2017.710] (-2024.389) (-2023.976) * (-2015.528) (-2021.108) [-2014.432] (-2016.566) -- 0:05:26
305000 -- [-2021.036] (-2017.315) (-2019.387) (-2018.073) * (-2025.501) [-2014.016] (-2015.285) (-2016.440) -- 0:05:28
Average standard deviation of split frequencies: 0.013509
305500 -- [-2016.766] (-2016.555) (-2015.952) (-2020.234) * (-2019.684) (-2017.971) (-2020.314) [-2017.114] -- 0:05:27
306000 -- (-2018.565) (-2026.475) [-2018.740] (-2020.817) * (-2025.723) (-2016.046) [-2015.954] (-2018.492) -- 0:05:26
306500 -- [-2021.371] (-2020.659) (-2022.831) (-2021.150) * (-2016.352) [-2015.011] (-2018.088) (-2014.167) -- 0:05:25
307000 -- [-2033.579] (-2020.748) (-2018.650) (-2032.416) * (-2017.528) (-2024.257) (-2017.723) [-2020.306] -- 0:05:27
307500 -- [-2019.367] (-2015.151) (-2016.589) (-2032.656) * (-2024.106) [-2012.667] (-2018.147) (-2016.179) -- 0:05:26
308000 -- (-2025.382) (-2020.310) [-2014.854] (-2017.838) * [-2022.952] (-2014.626) (-2014.810) (-2026.646) -- 0:05:25
308500 -- (-2029.207) [-2019.492] (-2017.148) (-2015.612) * (-2024.411) (-2012.957) (-2015.071) [-2018.635] -- 0:05:25
309000 -- (-2029.547) (-2023.597) (-2017.450) [-2022.483] * (-2015.287) [-2014.001] (-2014.405) (-2020.265) -- 0:05:26
309500 -- (-2019.306) [-2018.507] (-2028.477) (-2018.431) * (-2023.943) (-2018.655) (-2018.001) [-2017.300] -- 0:05:25
310000 -- (-2018.328) [-2027.630] (-2027.502) (-2019.141) * [-2014.865] (-2024.762) (-2018.631) (-2012.917) -- 0:05:24
Average standard deviation of split frequencies: 0.013190
310500 -- (-2025.255) [-2014.986] (-2024.853) (-2015.438) * [-2017.161] (-2015.514) (-2018.225) (-2028.158) -- 0:05:24
311000 -- [-2013.087] (-2018.059) (-2021.869) (-2016.700) * (-2019.364) (-2021.895) [-2018.404] (-2022.954) -- 0:05:25
311500 -- (-2024.584) (-2030.751) (-2010.629) [-2019.839] * (-2032.639) (-2017.810) (-2016.626) [-2016.334] -- 0:05:24
312000 -- (-2018.805) (-2029.773) [-2016.471] (-2020.524) * (-2015.482) [-2022.814] (-2022.680) (-2015.857) -- 0:05:24
312500 -- [-2016.031] (-2022.349) (-2016.048) (-2019.066) * (-2022.790) (-2018.269) (-2023.582) [-2018.940] -- 0:05:23
313000 -- (-2021.497) (-2022.332) [-2010.479] (-2017.034) * (-2017.483) [-2012.849] (-2022.108) (-2019.721) -- 0:05:22
313500 -- (-2014.713) (-2021.673) [-2018.661] (-2029.067) * (-2027.017) (-2017.523) [-2020.630] (-2018.644) -- 0:05:24
314000 -- (-2021.664) (-2022.129) (-2016.816) [-2025.687] * [-2023.961] (-2018.539) (-2023.874) (-2019.857) -- 0:05:23
314500 -- (-2019.128) (-2027.825) (-2019.174) [-2022.395] * (-2015.510) (-2030.410) (-2022.045) [-2013.846] -- 0:05:22
315000 -- (-2021.306) [-2022.639] (-2023.113) (-2014.613) * (-2017.666) [-2015.301] (-2022.365) (-2019.446) -- 0:05:21
Average standard deviation of split frequencies: 0.014115
315500 -- [-2016.091] (-2016.752) (-2016.744) (-2016.874) * [-2012.786] (-2021.403) (-2024.149) (-2022.334) -- 0:05:23
316000 -- [-2024.970] (-2016.252) (-2017.973) (-2015.742) * [-2024.635] (-2021.502) (-2015.019) (-2021.072) -- 0:05:22
316500 -- (-2022.000) (-2020.196) [-2021.960] (-2017.745) * [-2017.383] (-2018.858) (-2027.403) (-2030.636) -- 0:05:21
317000 -- [-2024.137] (-2029.487) (-2015.363) (-2027.433) * (-2025.012) (-2019.309) [-2021.695] (-2023.529) -- 0:05:21
317500 -- (-2025.044) [-2012.473] (-2031.675) (-2021.392) * (-2027.769) (-2015.361) (-2022.012) [-2010.098] -- 0:05:20
318000 -- [-2021.155] (-2015.339) (-2021.190) (-2024.532) * (-2013.173) (-2021.349) [-2012.862] (-2024.634) -- 0:05:21
318500 -- (-2026.596) [-2013.951] (-2020.988) (-2023.881) * (-2022.479) [-2018.000] (-2025.481) (-2015.932) -- 0:05:20
319000 -- [-2021.696] (-2015.065) (-2021.039) (-2016.593) * (-2023.264) (-2025.737) [-2021.295] (-2012.815) -- 0:05:20
319500 -- (-2018.002) (-2013.593) [-2024.786] (-2019.790) * [-2015.875] (-2015.715) (-2017.946) (-2023.620) -- 0:05:19
320000 -- (-2019.849) (-2019.006) [-2015.904] (-2025.665) * (-2014.537) [-2016.389] (-2020.538) (-2014.975) -- 0:05:20
Average standard deviation of split frequencies: 0.013457
320500 -- (-2028.508) (-2018.496) [-2024.661] (-2015.084) * (-2015.301) (-2027.621) (-2019.845) [-2024.419] -- 0:05:20
321000 -- (-2026.907) [-2019.857] (-2025.694) (-2024.390) * [-2017.160] (-2017.217) (-2017.862) (-2020.572) -- 0:05:19
321500 -- (-2025.668) (-2021.136) [-2015.143] (-2017.014) * (-2019.999) (-2015.531) [-2010.895] (-2023.265) -- 0:05:18
322000 -- (-2027.605) (-2028.736) [-2021.486] (-2016.948) * (-2025.572) [-2016.040] (-2019.418) (-2022.904) -- 0:05:20
322500 -- (-2023.267) [-2026.204] (-2016.899) (-2019.676) * (-2027.470) [-2017.823] (-2029.398) (-2030.348) -- 0:05:19
323000 -- [-2020.790] (-2019.343) (-2022.652) (-2030.564) * [-2021.948] (-2017.185) (-2021.723) (-2017.708) -- 0:05:18
323500 -- [-2014.469] (-2018.871) (-2024.049) (-2017.456) * (-2023.529) [-2013.459] (-2018.999) (-2014.969) -- 0:05:17
324000 -- (-2024.014) (-2018.246) [-2013.687] (-2018.351) * (-2015.428) [-2023.641] (-2016.528) (-2020.217) -- 0:05:17
324500 -- (-2022.337) [-2021.396] (-2018.323) (-2024.000) * (-2013.987) (-2021.062) [-2018.806] (-2019.831) -- 0:05:18
325000 -- (-2027.684) (-2015.431) [-2022.727] (-2019.819) * (-2022.430) (-2019.480) (-2023.205) [-2023.462] -- 0:05:17
Average standard deviation of split frequencies: 0.014571
325500 -- [-2021.161] (-2015.741) (-2023.289) (-2020.724) * (-2018.464) (-2019.668) [-2012.018] (-2022.046) -- 0:05:17
326000 -- (-2019.735) (-2017.023) (-2014.995) [-2021.603] * [-2018.517] (-2016.798) (-2019.326) (-2018.677) -- 0:05:16
326500 -- (-2018.677) (-2020.168) [-2015.550] (-2030.551) * (-2016.775) [-2014.422] (-2015.058) (-2011.808) -- 0:05:17
327000 -- (-2022.771) [-2011.597] (-2023.701) (-2024.043) * (-2014.375) [-2012.069] (-2019.182) (-2019.857) -- 0:05:16
327500 -- [-2016.341] (-2015.899) (-2012.411) (-2022.967) * (-2016.218) (-2022.997) [-2019.952] (-2012.852) -- 0:05:16
328000 -- [-2020.498] (-2017.148) (-2018.895) (-2021.347) * (-2020.908) [-2021.122] (-2026.921) (-2023.034) -- 0:05:15
328500 -- (-2013.189) (-2028.132) [-2017.544] (-2019.191) * (-2015.753) (-2022.162) (-2032.145) [-2021.656] -- 0:05:16
329000 -- (-2013.232) (-2016.331) [-2023.197] (-2015.529) * [-2025.302] (-2023.073) (-2027.632) (-2016.870) -- 0:05:16
329500 -- [-2015.420] (-2029.867) (-2019.320) (-2025.364) * (-2030.767) [-2021.081] (-2036.529) (-2015.575) -- 0:05:15
330000 -- [-2019.181] (-2018.445) (-2015.519) (-2014.637) * (-2020.773) [-2014.166] (-2021.778) (-2020.217) -- 0:05:14
Average standard deviation of split frequencies: 0.014476
330500 -- (-2024.648) (-2022.459) (-2022.789) [-2015.959] * (-2016.955) [-2012.706] (-2023.304) (-2028.306) -- 0:05:13
331000 -- (-2019.945) (-2022.486) (-2026.783) [-2019.231] * (-2020.640) (-2019.177) (-2017.761) [-2019.691] -- 0:05:15
331500 -- (-2022.067) [-2024.709] (-2021.610) (-2017.133) * (-2020.515) [-2012.382] (-2015.907) (-2024.685) -- 0:05:14
332000 -- (-2020.026) (-2017.968) (-2024.791) [-2019.299] * [-2011.513] (-2020.192) (-2019.250) (-2027.260) -- 0:05:13
332500 -- (-2023.056) (-2021.780) (-2027.884) [-2021.188] * (-2026.728) (-2015.429) (-2018.436) [-2013.028] -- 0:05:13
333000 -- (-2020.770) (-2026.884) (-2023.075) [-2021.585] * (-2026.981) (-2028.119) (-2018.377) [-2013.360] -- 0:05:14
333500 -- (-2014.455) [-2018.982] (-2019.624) (-2022.524) * (-2013.882) (-2019.748) (-2028.971) [-2015.112] -- 0:05:13
334000 -- [-2010.883] (-2017.350) (-2020.831) (-2021.612) * (-2024.090) (-2017.671) (-2013.776) [-2016.914] -- 0:05:13
334500 -- (-2016.148) (-2018.018) (-2019.013) [-2018.187] * [-2016.802] (-2019.384) (-2016.014) (-2018.791) -- 0:05:12
335000 -- [-2014.576] (-2025.186) (-2023.241) (-2019.055) * (-2021.357) (-2019.908) (-2016.567) [-2018.397] -- 0:05:13
Average standard deviation of split frequencies: 0.013598
335500 -- (-2021.803) (-2023.800) [-2024.397] (-2021.686) * (-2019.340) (-2024.875) (-2021.260) [-2018.610] -- 0:05:12
336000 -- (-2018.082) [-2013.466] (-2024.316) (-2017.229) * (-2022.885) [-2013.153] (-2022.937) (-2015.570) -- 0:05:12
336500 -- (-2020.550) (-2018.459) [-2021.041] (-2017.142) * [-2012.961] (-2017.104) (-2023.205) (-2019.578) -- 0:05:11
337000 -- (-2024.520) (-2019.086) (-2037.603) [-2022.422] * (-2028.193) [-2016.260] (-2026.054) (-2019.499) -- 0:05:10
337500 -- [-2026.757] (-2015.064) (-2028.151) (-2029.468) * (-2021.556) [-2013.836] (-2018.499) (-2014.204) -- 0:05:12
338000 -- [-2027.681] (-2022.018) (-2023.769) (-2016.501) * [-2017.305] (-2019.225) (-2020.434) (-2029.155) -- 0:05:11
338500 -- [-2018.086] (-2029.301) (-2020.794) (-2024.845) * (-2012.638) [-2011.644] (-2017.449) (-2020.149) -- 0:05:10
339000 -- [-2015.923] (-2015.965) (-2026.717) (-2015.479) * [-2012.045] (-2020.144) (-2015.388) (-2024.993) -- 0:05:10
339500 -- (-2016.452) (-2021.445) [-2024.392] (-2017.185) * (-2022.455) (-2018.984) (-2025.004) [-2022.420] -- 0:05:11
340000 -- [-2018.818] (-2017.651) (-2019.293) (-2020.449) * (-2024.279) [-2014.260] (-2016.919) (-2014.038) -- 0:05:10
Average standard deviation of split frequencies: 0.014051
340500 -- (-2023.056) [-2014.162] (-2014.263) (-2021.943) * (-2017.567) (-2021.971) (-2020.784) [-2015.005] -- 0:05:09
341000 -- (-2015.980) [-2019.650] (-2028.783) (-2013.499) * [-2023.752] (-2023.962) (-2025.457) (-2016.023) -- 0:05:09
341500 -- [-2014.774] (-2024.071) (-2022.847) (-2031.873) * (-2020.047) [-2021.732] (-2020.394) (-2020.099) -- 0:05:10
342000 -- [-2022.388] (-2031.215) (-2014.747) (-2017.632) * (-2024.624) (-2022.282) (-2015.903) [-2019.512] -- 0:05:09
342500 -- [-2012.722] (-2023.969) (-2013.909) (-2015.769) * (-2028.043) (-2021.703) (-2015.465) [-2019.603] -- 0:05:09
343000 -- (-2022.788) (-2021.631) [-2026.168] (-2027.132) * (-2019.572) (-2022.893) [-2014.322] (-2015.004) -- 0:05:08
343500 -- (-2027.850) (-2020.370) [-2019.668] (-2023.539) * (-2022.230) [-2013.656] (-2014.045) (-2013.581) -- 0:05:09
344000 -- (-2020.967) [-2016.349] (-2026.172) (-2022.580) * [-2018.241] (-2013.881) (-2018.590) (-2011.430) -- 0:05:08
344500 -- [-2021.895] (-2018.036) (-2023.505) (-2025.816) * (-2019.912) [-2009.577] (-2017.654) (-2014.863) -- 0:05:08
345000 -- [-2012.991] (-2020.613) (-2017.393) (-2029.484) * (-2024.507) (-2012.627) [-2014.509] (-2017.002) -- 0:05:07
Average standard deviation of split frequencies: 0.014463
345500 -- (-2016.669) [-2020.950] (-2030.228) (-2027.497) * [-2019.377] (-2019.083) (-2018.337) (-2018.799) -- 0:05:08
346000 -- [-2018.457] (-2009.109) (-2020.993) (-2019.886) * (-2024.922) [-2015.402] (-2018.379) (-2016.391) -- 0:05:08
346500 -- (-2026.046) (-2018.646) (-2024.737) [-2015.355] * (-2021.530) (-2015.596) (-2022.034) [-2013.583] -- 0:05:07
347000 -- [-2020.420] (-2023.029) (-2024.167) (-2028.080) * (-2024.034) (-2023.574) (-2011.908) [-2014.234] -- 0:05:06
347500 -- (-2016.449) (-2024.028) (-2019.478) [-2014.965] * (-2024.220) (-2023.224) [-2016.583] (-2015.393) -- 0:05:07
348000 -- (-2015.313) [-2016.878] (-2023.790) (-2018.416) * (-2022.087) (-2022.377) (-2015.958) [-2017.803] -- 0:05:07
348500 -- (-2017.656) (-2016.198) (-2021.054) [-2024.066] * (-2015.568) (-2021.710) [-2012.602] (-2014.893) -- 0:05:06
349000 -- (-2019.120) (-2022.040) (-2020.074) [-2016.179] * [-2019.264] (-2017.621) (-2021.271) (-2015.238) -- 0:05:05
349500 -- (-2026.387) [-2013.395] (-2017.835) (-2017.261) * (-2026.852) [-2015.683] (-2023.745) (-2026.238) -- 0:05:05
350000 -- (-2026.452) [-2017.036] (-2014.249) (-2017.320) * [-2017.204] (-2013.998) (-2026.902) (-2024.350) -- 0:05:06
Average standard deviation of split frequencies: 0.013960
350500 -- (-2016.052) (-2019.181) [-2009.437] (-2021.352) * [-2017.309] (-2015.138) (-2024.610) (-2017.685) -- 0:05:05
351000 -- [-2016.065] (-2019.448) (-2015.788) (-2026.631) * [-2025.636] (-2019.586) (-2028.223) (-2024.135) -- 0:05:05
351500 -- [-2019.333] (-2020.322) (-2009.734) (-2010.151) * (-2026.972) [-2020.959] (-2016.861) (-2014.288) -- 0:05:04
352000 -- (-2020.709) (-2020.267) (-2025.878) [-2015.823] * (-2021.058) (-2023.896) [-2015.521] (-2015.785) -- 0:05:05
352500 -- (-2021.737) (-2022.842) (-2020.774) [-2019.449] * [-2019.668] (-2024.970) (-2018.248) (-2018.984) -- 0:05:04
353000 -- (-2030.224) (-2015.350) (-2018.417) [-2016.094] * (-2019.480) (-2017.026) [-2015.323] (-2025.332) -- 0:05:04
353500 -- [-2017.536] (-2016.803) (-2028.463) (-2021.843) * [-2021.255] (-2022.900) (-2013.338) (-2029.575) -- 0:05:03
354000 -- (-2015.016) (-2017.278) [-2018.494] (-2021.140) * (-2014.790) [-2012.599] (-2017.284) (-2021.268) -- 0:05:04
354500 -- (-2017.788) [-2015.892] (-2016.793) (-2019.159) * (-2024.423) [-2016.810] (-2017.869) (-2025.154) -- 0:05:04
355000 -- (-2015.427) (-2021.654) (-2018.249) [-2019.308] * [-2021.589] (-2017.926) (-2020.728) (-2019.805) -- 0:05:03
Average standard deviation of split frequencies: 0.012019
355500 -- (-2018.721) [-2016.968] (-2014.864) (-2019.190) * (-2021.235) (-2014.722) (-2017.033) [-2015.127] -- 0:05:02
356000 -- (-2023.163) (-2021.060) (-2021.610) [-2025.312] * (-2031.705) [-2018.038] (-2015.236) (-2021.845) -- 0:05:02
356500 -- [-2017.775] (-2023.570) (-2024.663) (-2019.231) * (-2016.680) [-2021.708] (-2025.596) (-2020.370) -- 0:05:03
357000 -- (-2026.582) (-2016.792) (-2017.908) [-2012.282] * (-2020.816) [-2017.884] (-2025.618) (-2025.785) -- 0:05:02
357500 -- [-2017.512] (-2015.278) (-2029.183) (-2014.809) * (-2026.064) (-2014.504) (-2030.692) [-2021.767] -- 0:05:01
358000 -- (-2017.828) (-2020.822) (-2023.919) [-2019.193] * (-2017.804) (-2025.403) [-2020.280] (-2029.507) -- 0:05:01
358500 -- (-2025.072) (-2016.714) [-2017.685] (-2020.476) * (-2015.959) (-2016.202) (-2015.488) [-2015.253] -- 0:05:02
359000 -- [-2015.607] (-2019.719) (-2020.228) (-2020.404) * (-2023.499) [-2015.416] (-2034.010) (-2022.404) -- 0:05:01
359500 -- (-2019.156) (-2014.160) [-2014.355] (-2027.504) * (-2017.549) [-2020.424] (-2025.562) (-2020.847) -- 0:05:01
360000 -- (-2019.736) (-2011.757) [-2018.152] (-2022.827) * [-2017.815] (-2019.076) (-2020.749) (-2014.499) -- 0:05:00
Average standard deviation of split frequencies: 0.011462
360500 -- (-2026.235) [-2013.287] (-2023.474) (-2020.807) * (-2015.585) [-2019.673] (-2018.439) (-2033.349) -- 0:05:01
361000 -- (-2022.516) [-2012.165] (-2026.781) (-2017.143) * (-2022.284) [-2012.843] (-2022.750) (-2016.703) -- 0:05:00
361500 -- [-2019.822] (-2023.314) (-2015.150) (-2016.894) * (-2021.141) [-2013.521] (-2017.886) (-2013.912) -- 0:05:00
362000 -- (-2015.523) [-2021.388] (-2014.466) (-2011.591) * (-2023.468) [-2019.937] (-2022.398) (-2025.498) -- 0:04:59
362500 -- (-2013.414) [-2017.455] (-2020.747) (-2015.719) * (-2014.696) (-2022.811) [-2018.076] (-2021.589) -- 0:04:58
363000 -- [-2015.917] (-2020.434) (-2023.591) (-2021.068) * (-2031.740) (-2017.229) (-2018.540) [-2018.974] -- 0:05:00
363500 -- (-2017.332) (-2012.286) [-2017.013] (-2018.631) * (-2019.823) (-2029.238) [-2011.758] (-2019.663) -- 0:04:59
364000 -- (-2012.335) [-2025.909] (-2023.619) (-2023.879) * (-2025.473) (-2020.402) [-2010.562] (-2024.156) -- 0:04:58
364500 -- [-2022.671] (-2019.665) (-2018.846) (-2014.375) * (-2018.974) (-2020.669) [-2010.271] (-2018.203) -- 0:04:58
365000 -- (-2027.641) (-2021.737) (-2017.798) [-2012.087] * (-2017.211) (-2015.443) [-2016.589] (-2021.891) -- 0:04:59
Average standard deviation of split frequencies: 0.011889
365500 -- (-2016.389) (-2019.916) (-2021.179) [-2015.323] * [-2010.949] (-2031.857) (-2015.633) (-2016.461) -- 0:04:58
366000 -- (-2018.111) (-2017.351) (-2016.085) [-2016.685] * (-2020.067) [-2020.575] (-2018.975) (-2017.366) -- 0:04:57
366500 -- (-2021.528) (-2019.148) [-2017.525] (-2021.006) * (-2020.352) [-2021.984] (-2015.263) (-2020.115) -- 0:04:57
367000 -- (-2019.662) [-2013.503] (-2015.938) (-2022.396) * (-2026.881) [-2015.991] (-2018.375) (-2015.339) -- 0:04:56
367500 -- (-2018.646) (-2015.800) (-2013.129) [-2009.131] * (-2022.404) (-2020.346) [-2021.365] (-2023.553) -- 0:04:57
368000 -- (-2015.142) [-2023.167] (-2021.909) (-2018.782) * (-2026.680) (-2025.883) (-2020.146) [-2021.360] -- 0:04:57
368500 -- [-2019.018] (-2018.494) (-2024.186) (-2031.267) * (-2025.337) (-2023.083) [-2016.963] (-2022.158) -- 0:04:56
369000 -- [-2017.742] (-2023.117) (-2021.348) (-2018.519) * (-2022.931) (-2012.462) (-2015.168) [-2022.965] -- 0:04:55
369500 -- (-2016.846) (-2021.805) [-2013.996] (-2023.781) * (-2023.195) (-2017.570) [-2015.515] (-2018.665) -- 0:04:56
370000 -- (-2024.707) (-2025.049) (-2020.215) [-2017.768] * (-2022.725) [-2015.004] (-2023.775) (-2023.556) -- 0:04:56
Average standard deviation of split frequencies: 0.012718
370500 -- (-2021.448) (-2027.480) (-2014.617) [-2021.291] * [-2019.653] (-2019.905) (-2023.223) (-2020.813) -- 0:04:55
371000 -- (-2014.355) (-2020.020) (-2028.132) [-2013.259] * [-2014.932] (-2016.604) (-2028.915) (-2022.211) -- 0:04:55
371500 -- (-2017.162) (-2018.351) (-2016.486) [-2009.856] * (-2010.295) (-2017.698) (-2028.618) [-2025.391] -- 0:04:56
372000 -- (-2018.134) (-2031.833) (-2015.736) [-2018.539] * (-2016.970) [-2017.654] (-2018.485) (-2029.027) -- 0:04:55
372500 -- (-2020.154) (-2018.137) [-2017.819] (-2018.612) * [-2013.042] (-2027.916) (-2021.017) (-2017.308) -- 0:04:54
373000 -- (-2014.843) (-2015.394) [-2018.328] (-2023.321) * [-2018.415] (-2025.045) (-2018.471) (-2014.280) -- 0:04:54
373500 -- (-2014.851) (-2015.863) (-2027.791) [-2013.522] * (-2016.522) [-2020.565] (-2017.825) (-2022.015) -- 0:04:53
374000 -- [-2019.960] (-2023.533) (-2022.916) (-2019.343) * (-2014.007) [-2017.739] (-2013.749) (-2027.027) -- 0:04:54
374500 -- (-2019.929) (-2014.657) [-2011.938] (-2018.518) * [-2024.807] (-2019.888) (-2034.365) (-2027.535) -- 0:04:53
375000 -- (-2022.273) [-2015.416] (-2015.389) (-2016.334) * (-2019.137) (-2022.773) [-2016.945] (-2023.063) -- 0:04:53
Average standard deviation of split frequencies: 0.011091
375500 -- (-2023.287) (-2019.685) (-2024.691) [-2017.448] * [-2019.930] (-2023.658) (-2014.243) (-2021.922) -- 0:04:52
376000 -- (-2037.084) (-2024.840) [-2013.951] (-2028.141) * [-2015.238] (-2024.679) (-2015.354) (-2022.494) -- 0:04:53
376500 -- (-2032.783) (-2023.441) (-2020.722) [-2021.986] * (-2023.535) (-2036.274) [-2011.546] (-2040.170) -- 0:04:53
377000 -- (-2016.131) (-2032.008) [-2019.871] (-2013.153) * (-2025.460) (-2024.010) [-2016.148] (-2020.130) -- 0:04:52
377500 -- [-2016.223] (-2025.491) (-2022.343) (-2016.560) * (-2028.660) (-2026.239) [-2018.601] (-2020.503) -- 0:04:51
378000 -- (-2012.663) (-2020.415) [-2021.542] (-2015.568) * (-2027.638) [-2028.067] (-2020.209) (-2021.915) -- 0:04:52
378500 -- [-2012.317] (-2018.317) (-2020.504) (-2016.863) * (-2025.079) (-2029.105) (-2023.086) [-2018.508] -- 0:04:52
379000 -- (-2025.536) [-2022.681] (-2015.280) (-2017.410) * (-2021.861) (-2027.236) [-2021.127] (-2032.965) -- 0:04:51
379500 -- (-2014.875) [-2024.188] (-2025.361) (-2021.063) * (-2018.534) (-2016.729) [-2017.859] (-2037.145) -- 0:04:51
380000 -- (-2022.469) (-2018.024) [-2020.529] (-2026.163) * (-2035.756) [-2017.665] (-2017.428) (-2026.618) -- 0:04:50
Average standard deviation of split frequencies: 0.012098
380500 -- (-2016.206) [-2016.976] (-2017.072) (-2022.302) * (-2023.711) [-2013.503] (-2020.549) (-2026.330) -- 0:04:51
381000 -- (-2017.481) [-2020.749] (-2019.692) (-2021.412) * (-2012.572) (-2017.119) [-2016.357] (-2019.277) -- 0:04:50
381500 -- (-2012.041) (-2017.834) (-2018.783) [-2019.872] * [-2014.762] (-2021.734) (-2017.341) (-2024.753) -- 0:04:50
382000 -- [-2016.443] (-2028.926) (-2011.702) (-2033.329) * (-2017.426) (-2024.929) (-2012.190) [-2023.877] -- 0:04:49
382500 -- [-2019.326] (-2027.979) (-2029.775) (-2020.864) * (-2017.582) (-2012.754) (-2031.774) [-2011.451] -- 0:04:50
383000 -- (-2022.034) [-2019.106] (-2015.062) (-2021.208) * (-2024.013) (-2017.617) (-2023.154) [-2013.564] -- 0:04:49
383500 -- (-2024.368) (-2031.145) [-2017.329] (-2013.645) * (-2020.873) [-2017.810] (-2021.274) (-2012.763) -- 0:04:49
384000 -- (-2022.606) [-2020.586] (-2014.663) (-2020.634) * (-2025.323) [-2015.704] (-2019.156) (-2016.041) -- 0:04:48
384500 -- [-2013.579] (-2020.237) (-2011.928) (-2015.879) * (-2019.434) (-2016.120) (-2021.179) [-2020.097] -- 0:04:49
385000 -- (-2030.410) (-2014.223) [-2013.716] (-2016.667) * (-2020.924) (-2019.886) (-2025.318) [-2015.154] -- 0:04:49
Average standard deviation of split frequencies: 0.012682
385500 -- [-2014.246] (-2024.028) (-2021.555) (-2026.752) * (-2019.285) (-2023.296) [-2019.766] (-2020.720) -- 0:04:48
386000 -- [-2018.235] (-2021.597) (-2018.940) (-2026.973) * (-2028.092) (-2012.424) (-2022.721) [-2023.301] -- 0:04:47
386500 -- (-2015.786) (-2018.787) [-2012.938] (-2022.228) * (-2024.036) (-2014.357) [-2014.195] (-2017.057) -- 0:04:47
387000 -- (-2021.695) [-2019.272] (-2018.395) (-2019.637) * (-2021.759) (-2026.251) (-2028.792) [-2017.191] -- 0:04:48
387500 -- (-2017.746) [-2019.133] (-2024.577) (-2014.142) * (-2025.628) (-2024.154) (-2014.839) [-2011.003] -- 0:04:47
388000 -- [-2017.278] (-2021.566) (-2020.191) (-2018.952) * (-2020.105) (-2029.289) [-2015.749] (-2016.605) -- 0:04:47
388500 -- [-2017.373] (-2018.120) (-2025.808) (-2011.865) * (-2027.956) (-2029.272) [-2022.994] (-2019.444) -- 0:04:46
389000 -- (-2030.887) (-2022.891) [-2017.890] (-2021.539) * (-2018.293) (-2022.037) (-2017.159) [-2017.399] -- 0:04:47
389500 -- (-2018.109) [-2021.734] (-2020.271) (-2017.622) * (-2016.942) (-2024.977) [-2017.832] (-2021.078) -- 0:04:46
390000 -- (-2019.212) (-2018.719) [-2015.999] (-2021.930) * [-2020.410] (-2021.251) (-2026.412) (-2019.751) -- 0:04:46
Average standard deviation of split frequencies: 0.012716
390500 -- [-2017.634] (-2010.424) (-2019.379) (-2016.163) * (-2018.629) (-2022.288) (-2030.950) [-2012.721] -- 0:04:45
391000 -- (-2029.529) [-2017.852] (-2021.073) (-2016.432) * (-2025.637) (-2017.529) (-2026.921) [-2015.148] -- 0:04:46
391500 -- (-2017.684) [-2018.708] (-2011.893) (-2013.725) * (-2024.826) (-2019.096) [-2016.709] (-2021.421) -- 0:04:45
392000 -- (-2022.449) (-2017.931) (-2013.014) [-2015.310] * (-2016.848) (-2023.426) [-2008.129] (-2022.053) -- 0:04:45
392500 -- (-2019.718) [-2017.365] (-2023.978) (-2008.468) * (-2027.429) (-2027.838) (-2016.175) [-2016.808] -- 0:04:44
393000 -- [-2012.486] (-2019.252) (-2023.716) (-2016.508) * (-2020.991) [-2015.184] (-2016.052) (-2024.430) -- 0:04:44
393500 -- (-2018.333) (-2022.506) (-2027.379) [-2014.109] * [-2022.240] (-2029.838) (-2021.590) (-2022.130) -- 0:04:45
394000 -- (-2017.243) (-2018.273) (-2026.530) [-2016.012] * [-2015.466] (-2022.664) (-2025.179) (-2020.434) -- 0:04:44
394500 -- [-2015.132] (-2017.788) (-2034.622) (-2023.094) * [-2014.378] (-2020.473) (-2017.238) (-2012.128) -- 0:04:43
395000 -- (-2011.488) (-2021.675) (-2019.564) [-2019.671] * (-2018.796) (-2019.017) (-2021.057) [-2017.888] -- 0:04:43
Average standard deviation of split frequencies: 0.011996
395500 -- [-2022.085] (-2019.478) (-2017.861) (-2023.205) * (-2016.138) [-2020.431] (-2014.142) (-2024.976) -- 0:04:44
396000 -- (-2026.813) (-2020.778) [-2012.158] (-2027.073) * (-2012.414) [-2022.660] (-2019.084) (-2018.637) -- 0:04:43
396500 -- (-2024.602) [-2021.632] (-2017.264) (-2037.506) * (-2011.879) [-2024.501] (-2017.753) (-2019.861) -- 0:04:43
397000 -- (-2022.767) [-2021.173] (-2025.631) (-2021.292) * (-2015.886) (-2022.654) [-2009.671] (-2018.878) -- 0:04:42
397500 -- (-2029.132) (-2020.942) (-2020.428) [-2024.194] * (-2017.352) (-2027.474) [-2018.163] (-2014.552) -- 0:04:41
398000 -- (-2020.639) (-2020.014) [-2015.454] (-2018.315) * (-2014.202) [-2019.830] (-2031.067) (-2022.286) -- 0:04:42
398500 -- (-2022.087) (-2029.797) (-2018.630) [-2029.383] * [-2016.823] (-2021.873) (-2023.903) (-2016.809) -- 0:04:42
399000 -- (-2025.092) (-2016.141) [-2025.282] (-2022.193) * [-2022.339] (-2017.366) (-2020.779) (-2021.265) -- 0:04:41
399500 -- [-2017.808] (-2023.377) (-2017.555) (-2020.112) * [-2016.767] (-2023.860) (-2017.094) (-2020.280) -- 0:04:41
400000 -- (-2019.880) (-2020.257) [-2017.197] (-2025.655) * [-2024.198] (-2029.544) (-2024.920) (-2019.282) -- 0:04:42
Average standard deviation of split frequencies: 0.011494
400500 -- [-2016.740] (-2027.017) (-2019.736) (-2015.275) * (-2018.536) [-2014.164] (-2019.051) (-2017.280) -- 0:04:41
401000 -- (-2013.725) (-2027.222) [-2010.244] (-2022.970) * [-2014.999] (-2023.750) (-2018.401) (-2019.495) -- 0:04:40
401500 -- [-2018.133] (-2020.819) (-2020.579) (-2020.873) * [-2017.518] (-2023.165) (-2018.114) (-2012.100) -- 0:04:40
402000 -- (-2024.245) [-2025.970] (-2009.719) (-2012.551) * [-2016.259] (-2021.189) (-2019.067) (-2015.944) -- 0:04:39
402500 -- (-2022.325) (-2025.041) (-2015.789) [-2014.796] * (-2022.796) (-2027.031) (-2013.482) [-2021.345] -- 0:04:40
403000 -- (-2013.543) (-2022.464) (-2011.950) [-2020.891] * (-2024.830) [-2022.910] (-2018.279) (-2019.024) -- 0:04:39
403500 -- [-2018.846] (-2013.563) (-2024.821) (-2017.262) * [-2024.068] (-2027.812) (-2016.372) (-2026.677) -- 0:04:39
404000 -- (-2021.427) (-2019.508) (-2027.894) [-2024.172] * (-2013.804) (-2018.767) (-2021.631) [-2015.570] -- 0:04:38
404500 -- (-2018.433) (-2017.536) [-2022.503] (-2025.147) * [-2013.046] (-2025.238) (-2013.046) (-2018.046) -- 0:04:39
405000 -- (-2012.726) (-2021.921) (-2027.219) [-2017.660] * (-2016.178) (-2015.589) [-2017.766] (-2025.402) -- 0:04:39
Average standard deviation of split frequencies: 0.010271
405500 -- [-2016.524] (-2016.254) (-2021.933) (-2015.171) * (-2023.040) [-2010.691] (-2015.186) (-2014.639) -- 0:04:38
406000 -- (-2028.332) [-2012.614] (-2021.692) (-2023.641) * (-2026.279) [-2012.813] (-2016.803) (-2014.330) -- 0:04:37
406500 -- [-2018.658] (-2029.341) (-2022.779) (-2019.242) * (-2017.564) (-2020.144) [-2010.351] (-2014.306) -- 0:04:38
407000 -- [-2012.676] (-2017.910) (-2020.152) (-2020.038) * (-2023.834) (-2022.183) (-2015.945) [-2019.644] -- 0:04:38
407500 -- (-2013.774) (-2022.460) (-2022.520) [-2012.998] * (-2029.003) (-2017.505) (-2026.146) [-2014.974] -- 0:04:37
408000 -- (-2020.066) (-2029.188) [-2019.205] (-2024.378) * (-2023.237) (-2015.201) [-2023.113] (-2029.209) -- 0:04:37
408500 -- [-2017.157] (-2019.063) (-2026.738) (-2020.162) * [-2025.986] (-2022.168) (-2017.753) (-2015.181) -- 0:04:36
409000 -- [-2024.463] (-2025.163) (-2020.438) (-2018.082) * (-2021.089) (-2022.352) (-2025.322) [-2023.240] -- 0:04:37
409500 -- (-2019.320) (-2021.933) (-2030.199) [-2020.849] * (-2023.888) (-2025.634) (-2028.985) [-2014.510] -- 0:04:36
410000 -- (-2024.723) (-2023.243) [-2015.366] (-2015.016) * (-2039.553) (-2029.972) (-2019.480) [-2020.113] -- 0:04:36
Average standard deviation of split frequencies: 0.009095
410500 -- (-2024.240) (-2017.584) [-2011.901] (-2019.855) * (-2021.701) (-2018.826) [-2013.465] (-2019.959) -- 0:04:35
411000 -- [-2017.765] (-2025.553) (-2018.561) (-2024.773) * (-2027.596) (-2015.295) [-2020.842] (-2021.033) -- 0:04:36
411500 -- (-2020.216) [-2016.821] (-2020.270) (-2023.576) * [-2014.722] (-2014.512) (-2017.700) (-2021.738) -- 0:04:36
412000 -- [-2018.749] (-2021.118) (-2018.460) (-2013.393) * [-2016.483] (-2019.521) (-2017.940) (-2021.541) -- 0:04:35
412500 -- (-2023.280) (-2026.211) (-2014.422) [-2019.556] * (-2018.920) (-2019.129) [-2020.069] (-2022.003) -- 0:04:34
413000 -- (-2022.578) (-2017.418) (-2023.674) [-2014.466] * (-2032.523) [-2018.794] (-2026.775) (-2020.105) -- 0:04:35
413500 -- [-2015.636] (-2024.063) (-2017.742) (-2015.725) * (-2029.973) (-2017.096) [-2022.981] (-2019.902) -- 0:04:35
414000 -- [-2020.347] (-2026.515) (-2025.780) (-2014.843) * [-2019.509] (-2016.328) (-2016.651) (-2016.011) -- 0:04:34
414500 -- (-2025.581) (-2020.687) (-2024.534) [-2011.552] * (-2019.828) (-2021.872) [-2016.338] (-2010.077) -- 0:04:34
415000 -- (-2018.442) (-2018.872) (-2027.866) [-2016.013] * (-2022.692) [-2014.682] (-2020.870) (-2022.742) -- 0:04:33
Average standard deviation of split frequencies: 0.009153
415500 -- [-2021.081] (-2013.769) (-2025.602) (-2016.917) * (-2017.958) (-2025.207) [-2023.743] (-2011.537) -- 0:04:34
416000 -- [-2012.753] (-2018.928) (-2017.748) (-2018.426) * (-2011.458) [-2017.060] (-2031.869) (-2015.252) -- 0:04:33
416500 -- (-2028.008) (-2027.565) (-2024.419) [-2020.333] * [-2016.302] (-2018.376) (-2026.330) (-2025.189) -- 0:04:33
417000 -- (-2020.315) (-2016.506) (-2017.104) [-2015.990] * (-2016.064) [-2018.939] (-2025.373) (-2023.406) -- 0:04:32
417500 -- (-2016.888) (-2023.678) [-2016.939] (-2018.400) * (-2016.168) (-2023.704) [-2024.338] (-2013.444) -- 0:04:33
418000 -- (-2014.238) (-2023.930) (-2021.507) [-2025.602] * (-2018.188) [-2013.566] (-2022.584) (-2022.420) -- 0:04:32
418500 -- [-2013.321] (-2018.614) (-2020.278) (-2033.016) * (-2020.769) (-2017.234) [-2024.096] (-2023.028) -- 0:04:32
419000 -- (-2025.426) (-2013.264) [-2021.886] (-2018.990) * (-2023.184) (-2016.987) (-2022.342) [-2019.695] -- 0:04:31
419500 -- (-2012.746) (-2027.529) (-2019.395) [-2022.440] * (-2015.320) (-2025.865) (-2021.352) [-2023.399] -- 0:04:32
420000 -- (-2020.249) (-2033.305) [-2015.179] (-2012.768) * (-2026.575) (-2018.265) (-2017.599) [-2015.200] -- 0:04:32
Average standard deviation of split frequencies: 0.008620
420500 -- [-2020.383] (-2025.573) (-2018.954) (-2017.025) * (-2018.366) [-2013.931] (-2020.030) (-2024.511) -- 0:04:31
421000 -- (-2016.969) (-2018.799) [-2022.952] (-2023.885) * (-2022.378) [-2014.052] (-2019.486) (-2016.248) -- 0:04:30
421500 -- (-2023.489) (-2020.811) [-2014.107] (-2022.586) * (-2024.445) (-2018.572) (-2021.165) [-2014.597] -- 0:04:30
422000 -- (-2026.328) (-2024.653) [-2019.596] (-2018.098) * (-2018.803) [-2012.494] (-2024.495) (-2024.496) -- 0:04:31
422500 -- (-2019.088) (-2015.294) (-2021.110) [-2016.094] * (-2018.527) [-2018.418] (-2016.090) (-2026.809) -- 0:04:30
423000 -- (-2020.601) [-2013.835] (-2018.567) (-2012.563) * (-2031.088) (-2015.733) (-2017.468) [-2019.749] -- 0:04:30
423500 -- [-2015.134] (-2019.514) (-2018.617) (-2014.308) * (-2023.867) [-2010.115] (-2025.879) (-2024.464) -- 0:04:29
424000 -- [-2019.239] (-2022.056) (-2011.653) (-2016.096) * (-2026.137) (-2018.747) (-2021.414) [-2025.166] -- 0:04:30
424500 -- [-2016.006] (-2024.482) (-2027.972) (-2023.131) * [-2016.059] (-2020.574) (-2021.983) (-2025.445) -- 0:04:29
425000 -- (-2022.958) [-2017.687] (-2025.445) (-2017.000) * (-2015.314) (-2026.018) (-2011.977) [-2019.869] -- 0:04:29
Average standard deviation of split frequencies: 0.009534
425500 -- (-2015.706) (-2013.663) [-2019.325] (-2028.762) * (-2017.282) (-2021.424) [-2015.825] (-2017.203) -- 0:04:28
426000 -- [-2012.322] (-2022.066) (-2027.206) (-2016.681) * (-2023.459) (-2023.045) [-2016.810] (-2019.265) -- 0:04:29
426500 -- [-2016.483] (-2023.777) (-2017.624) (-2031.149) * (-2020.298) (-2028.837) [-2016.226] (-2019.318) -- 0:04:28
427000 -- (-2017.729) (-2018.748) (-2024.143) [-2015.914] * [-2018.977] (-2013.029) (-2018.401) (-2024.308) -- 0:04:28
427500 -- (-2029.748) (-2016.569) (-2016.334) [-2013.719] * [-2019.641] (-2020.205) (-2017.632) (-2024.830) -- 0:04:27
428000 -- (-2020.746) (-2023.718) [-2009.903] (-2017.288) * (-2024.346) [-2025.450] (-2016.100) (-2023.034) -- 0:04:27
428500 -- (-2019.250) (-2030.609) (-2025.126) [-2018.214] * (-2019.182) (-2015.156) [-2014.077] (-2018.108) -- 0:04:28
429000 -- [-2019.439] (-2015.942) (-2023.310) (-2015.039) * [-2016.357] (-2019.545) (-2028.380) (-2014.365) -- 0:04:27
429500 -- (-2018.167) [-2022.029] (-2019.971) (-2013.646) * (-2013.368) (-2018.725) [-2015.240] (-2013.576) -- 0:04:26
430000 -- (-2021.173) [-2018.501] (-2015.218) (-2015.442) * [-2014.048] (-2017.391) (-2019.654) (-2018.432) -- 0:04:26
Average standard deviation of split frequencies: 0.010020
430500 -- (-2021.233) [-2018.353] (-2024.822) (-2021.568) * (-2015.273) (-2016.047) (-2015.967) [-2016.922] -- 0:04:27
431000 -- (-2015.144) (-2017.233) [-2014.422] (-2016.112) * [-2015.826] (-2015.284) (-2017.234) (-2024.730) -- 0:04:26
431500 -- (-2013.122) (-2018.750) (-2021.260) [-2017.676] * (-2018.240) [-2015.900] (-2019.407) (-2016.413) -- 0:04:26
432000 -- (-2014.617) (-2014.819) [-2024.956] (-2015.407) * [-2012.642] (-2019.991) (-2020.003) (-2020.156) -- 0:04:25
432500 -- [-2014.386] (-2014.381) (-2023.599) (-2014.476) * (-2018.269) [-2021.501] (-2025.045) (-2017.486) -- 0:04:25
433000 -- [-2013.548] (-2022.372) (-2028.013) (-2012.868) * (-2026.412) (-2016.608) (-2027.188) [-2016.888] -- 0:04:25
433500 -- [-2015.494] (-2025.944) (-2020.027) (-2017.653) * (-2025.971) (-2023.515) [-2016.125] (-2014.576) -- 0:04:25
434000 -- (-2020.144) (-2020.560) (-2019.887) [-2018.064] * (-2020.422) [-2017.088] (-2018.013) (-2016.042) -- 0:04:24
434500 -- [-2018.457] (-2027.194) (-2020.393) (-2009.295) * (-2018.449) (-2022.773) [-2019.609] (-2014.356) -- 0:04:24
435000 -- [-2016.103] (-2025.066) (-2018.376) (-2015.325) * (-2022.192) [-2014.274] (-2015.641) (-2012.212) -- 0:04:24
Average standard deviation of split frequencies: 0.010895
435500 -- (-2019.643) (-2023.881) (-2019.049) [-2017.711] * [-2027.692] (-2021.281) (-2024.900) (-2023.447) -- 0:04:24
436000 -- (-2029.657) [-2016.155] (-2022.896) (-2021.272) * (-2018.462) (-2014.408) [-2016.170] (-2017.269) -- 0:04:23
436500 -- [-2019.722] (-2014.255) (-2030.162) (-2015.223) * (-2027.221) (-2013.484) [-2020.723] (-2025.351) -- 0:04:23
437000 -- (-2018.366) [-2014.774] (-2021.926) (-2031.162) * (-2026.615) (-2015.282) [-2022.629] (-2020.727) -- 0:04:24
437500 -- (-2024.457) (-2015.080) (-2015.983) [-2014.934] * (-2024.021) (-2015.157) [-2016.975] (-2023.848) -- 0:04:23
438000 -- (-2018.038) (-2025.341) [-2021.863] (-2018.978) * (-2023.222) [-2012.000] (-2017.131) (-2018.651) -- 0:04:23
438500 -- (-2027.188) (-2020.168) [-2021.939] (-2017.304) * (-2023.146) (-2017.085) (-2021.043) [-2011.988] -- 0:04:22
439000 -- (-2020.518) [-2024.082] (-2023.759) (-2021.489) * (-2015.709) (-2018.989) (-2016.742) [-2014.160] -- 0:04:23
439500 -- [-2016.230] (-2028.464) (-2024.839) (-2022.597) * (-2021.610) (-2019.520) (-2020.003) [-2014.801] -- 0:04:22
440000 -- (-2021.057) [-2014.334] (-2026.908) (-2026.992) * (-2028.493) (-2022.541) (-2026.558) [-2022.482] -- 0:04:22
Average standard deviation of split frequencies: 0.010698
440500 -- [-2026.708] (-2014.103) (-2028.430) (-2027.851) * (-2031.053) (-2021.921) [-2018.623] (-2024.573) -- 0:04:21
441000 -- (-2015.737) (-2027.766) (-2027.721) [-2020.224] * (-2023.890) (-2019.139) (-2017.607) [-2016.559] -- 0:04:21
441500 -- [-2023.555] (-2027.894) (-2026.847) (-2020.061) * [-2017.492] (-2023.973) (-2016.987) (-2019.212) -- 0:04:21
442000 -- [-2012.914] (-2023.513) (-2018.267) (-2015.235) * (-2018.565) (-2016.302) (-2018.390) [-2019.426] -- 0:04:21
442500 -- (-2025.107) (-2016.267) (-2022.383) [-2021.933] * (-2019.083) (-2020.623) (-2021.564) [-2015.251] -- 0:04:20
443000 -- [-2016.511] (-2012.900) (-2024.721) (-2022.164) * [-2012.175] (-2019.712) (-2017.923) (-2019.952) -- 0:04:20
443500 -- (-2023.665) (-2023.494) [-2019.660] (-2018.722) * [-2013.682] (-2019.326) (-2023.553) (-2022.130) -- 0:04:20
444000 -- (-2020.432) [-2015.864] (-2013.700) (-2012.979) * (-2018.868) (-2012.127) (-2024.128) [-2014.807] -- 0:04:20
444500 -- [-2014.255] (-2016.265) (-2015.687) (-2021.234) * (-2016.665) (-2017.295) (-2023.001) [-2012.393] -- 0:04:19
445000 -- [-2018.757] (-2026.652) (-2011.252) (-2015.804) * (-2025.827) (-2020.947) [-2019.827] (-2023.565) -- 0:04:19
Average standard deviation of split frequencies: 0.011627
445500 -- (-2013.171) [-2014.602] (-2018.790) (-2021.389) * (-2025.836) (-2037.072) (-2018.247) [-2013.979] -- 0:04:20
446000 -- [-2013.189] (-2020.612) (-2017.286) (-2020.864) * (-2026.164) (-2024.284) (-2019.235) [-2013.209] -- 0:04:19
446500 -- (-2023.142) [-2020.557] (-2022.931) (-2017.806) * (-2016.302) [-2017.015] (-2024.468) (-2019.544) -- 0:04:19
447000 -- (-2014.609) (-2024.622) [-2019.254] (-2019.885) * (-2023.815) (-2020.165) [-2019.020] (-2018.489) -- 0:04:18
447500 -- (-2017.565) [-2016.680] (-2014.302) (-2023.927) * (-2024.157) [-2022.544] (-2016.998) (-2022.094) -- 0:04:18
448000 -- (-2018.940) [-2023.544] (-2019.912) (-2019.207) * (-2015.674) (-2021.430) (-2033.655) [-2019.190] -- 0:04:18
448500 -- (-2024.590) (-2017.873) (-2022.051) [-2018.215] * [-2016.640] (-2020.869) (-2024.569) (-2016.384) -- 0:04:18
449000 -- (-2030.376) (-2020.255) [-2019.711] (-2014.643) * [-2015.126] (-2020.859) (-2020.489) (-2019.120) -- 0:04:17
449500 -- (-2015.985) [-2014.793] (-2020.911) (-2015.166) * (-2017.984) (-2024.274) (-2017.890) [-2023.389] -- 0:04:17
450000 -- (-2022.853) (-2020.850) [-2014.727] (-2018.606) * [-2013.129] (-2027.309) (-2020.851) (-2023.681) -- 0:04:17
Average standard deviation of split frequencies: 0.012230
450500 -- (-2021.629) (-2020.165) [-2017.661] (-2024.234) * (-2027.632) [-2016.116] (-2017.105) (-2019.191) -- 0:04:17
451000 -- (-2017.212) (-2021.658) [-2009.803] (-2020.095) * [-2016.433] (-2024.001) (-2017.569) (-2012.416) -- 0:04:16
451500 -- [-2014.113] (-2013.030) (-2023.681) (-2026.753) * (-2021.176) (-2023.154) (-2021.399) [-2016.800] -- 0:04:16
452000 -- [-2020.873] (-2019.131) (-2021.562) (-2017.031) * (-2016.426) (-2020.730) (-2016.624) [-2017.324] -- 0:04:17
452500 -- [-2025.711] (-2021.702) (-2023.913) (-2023.553) * (-2016.999) (-2016.055) (-2014.162) [-2011.852] -- 0:04:16
453000 -- [-2015.380] (-2021.860) (-2022.048) (-2022.089) * (-2025.424) (-2019.515) [-2016.296] (-2020.731) -- 0:04:15
453500 -- (-2021.803) [-2018.709] (-2024.196) (-2016.741) * (-2026.644) (-2015.222) [-2017.229] (-2021.197) -- 0:04:15
454000 -- (-2014.553) (-2025.099) [-2023.231] (-2013.717) * (-2014.883) [-2016.025] (-2020.779) (-2014.316) -- 0:04:14
454500 -- (-2020.990) [-2018.276] (-2017.798) (-2022.753) * (-2027.285) (-2016.409) [-2018.881] (-2020.186) -- 0:04:15
455000 -- (-2014.163) [-2015.640] (-2015.177) (-2019.350) * [-2016.093] (-2018.888) (-2020.180) (-2026.504) -- 0:04:15
Average standard deviation of split frequencies: 0.011928
455500 -- (-2014.263) (-2016.003) [-2014.124] (-2025.692) * [-2020.865] (-2016.837) (-2016.838) (-2022.724) -- 0:04:14
456000 -- [-2023.465] (-2015.192) (-2017.172) (-2034.039) * (-2016.201) (-2017.363) (-2016.568) [-2018.651] -- 0:04:14
456500 -- (-2021.928) (-2015.346) (-2013.861) [-2015.274] * (-2020.864) [-2022.295] (-2019.905) (-2017.957) -- 0:04:14
457000 -- (-2019.192) [-2012.966] (-2022.584) (-2021.975) * (-2031.050) (-2019.648) [-2016.631] (-2018.486) -- 0:04:14
457500 -- [-2013.877] (-2024.506) (-2014.062) (-2018.235) * [-2023.125] (-2016.507) (-2046.342) (-2016.335) -- 0:04:13
458000 -- (-2016.340) (-2014.250) [-2026.311] (-2021.283) * (-2016.003) (-2011.784) (-2016.248) [-2016.817] -- 0:04:13
458500 -- (-2013.783) (-2018.227) (-2026.679) [-2024.221] * (-2030.461) (-2023.973) [-2017.156] (-2019.327) -- 0:04:13
459000 -- (-2020.653) (-2022.433) [-2020.257] (-2037.784) * (-2017.793) (-2042.366) (-2020.459) [-2022.326] -- 0:04:13
459500 -- [-2021.945] (-2025.642) (-2025.816) (-2024.621) * (-2018.668) (-2019.352) [-2018.166] (-2024.095) -- 0:04:12
460000 -- [-2026.848] (-2017.421) (-2023.110) (-2022.240) * [-2011.866] (-2020.953) (-2023.483) (-2032.118) -- 0:04:12
Average standard deviation of split frequencies: 0.011886
460500 -- (-2010.408) [-2021.992] (-2022.688) (-2013.745) * (-2024.032) (-2019.848) (-2015.663) [-2025.290] -- 0:04:13
461000 -- (-2023.714) (-2016.735) [-2014.559] (-2021.404) * (-2019.310) (-2033.421) [-2022.473] (-2022.731) -- 0:04:12
461500 -- (-2019.400) (-2020.942) (-2022.626) [-2012.963] * (-2011.894) (-2024.120) [-2018.624] (-2023.301) -- 0:04:12
462000 -- (-2021.294) [-2023.650] (-2026.260) (-2021.897) * (-2026.878) (-2018.517) (-2023.226) [-2022.413] -- 0:04:11
462500 -- (-2016.476) (-2019.939) [-2024.745] (-2020.466) * (-2016.525) (-2023.264) (-2031.379) [-2017.331] -- 0:04:11
463000 -- [-2016.215] (-2020.081) (-2028.655) (-2015.715) * [-2014.539] (-2022.193) (-2020.715) (-2015.448) -- 0:04:11
463500 -- (-2022.706) (-2018.498) (-2015.430) [-2015.146] * [-2011.182] (-2021.649) (-2017.456) (-2015.094) -- 0:04:11
464000 -- (-2022.782) [-2015.528] (-2025.227) (-2024.784) * [-2013.057] (-2013.748) (-2021.449) (-2021.756) -- 0:04:10
464500 -- (-2020.502) (-2016.420) (-2014.968) [-2018.954] * [-2014.200] (-2016.685) (-2017.991) (-2015.751) -- 0:04:10
465000 -- [-2016.230] (-2024.781) (-2025.887) (-2014.551) * (-2020.574) [-2013.800] (-2020.112) (-2027.346) -- 0:04:10
Average standard deviation of split frequencies: 0.011750
465500 -- (-2028.212) [-2015.681] (-2021.428) (-2011.758) * (-2021.394) [-2019.088] (-2019.507) (-2025.719) -- 0:04:10
466000 -- (-2040.002) (-2016.936) [-2023.269] (-2018.384) * (-2032.267) (-2015.586) [-2015.559] (-2011.418) -- 0:04:09
466500 -- (-2023.680) (-2013.095) (-2029.745) [-2019.757] * (-2016.412) [-2018.682] (-2016.090) (-2019.438) -- 0:04:09
467000 -- [-2013.248] (-2016.086) (-2023.041) (-2014.836) * [-2034.681] (-2020.513) (-2016.220) (-2021.408) -- 0:04:08
467500 -- [-2013.897] (-2018.469) (-2027.156) (-2016.024) * (-2022.039) (-2023.531) [-2020.457] (-2014.641) -- 0:04:09
468000 -- (-2013.029) [-2017.435] (-2019.991) (-2025.938) * (-2018.608) [-2015.753] (-2028.434) (-2020.922) -- 0:04:08
468500 -- [-2013.091] (-2014.083) (-2022.596) (-2027.066) * (-2019.945) (-2015.933) [-2016.960] (-2012.891) -- 0:04:08
469000 -- [-2019.017] (-2018.928) (-2027.707) (-2023.662) * [-2018.445] (-2016.916) (-2022.647) (-2014.433) -- 0:04:07
469500 -- (-2014.284) [-2017.183] (-2022.087) (-2023.166) * (-2023.880) (-2020.751) [-2017.139] (-2020.524) -- 0:04:08
470000 -- (-2011.031) [-2018.726] (-2025.864) (-2017.479) * [-2022.442] (-2023.267) (-2021.766) (-2016.439) -- 0:04:08
Average standard deviation of split frequencies: 0.010863
470500 -- (-2011.632) (-2026.220) (-2026.209) [-2022.311] * (-2019.118) (-2026.924) (-2013.351) [-2013.027] -- 0:04:07
471000 -- [-2017.759] (-2018.353) (-2020.254) (-2023.307) * (-2018.047) (-2021.413) [-2022.917] (-2022.185) -- 0:04:07
471500 -- [-2018.304] (-2023.404) (-2019.723) (-2013.838) * (-2020.216) [-2023.671] (-2016.171) (-2030.179) -- 0:04:07
472000 -- (-2017.703) (-2031.405) [-2015.966] (-2021.272) * (-2013.997) (-2034.184) (-2016.238) [-2013.911] -- 0:04:07
472500 -- (-2017.615) (-2021.167) [-2027.657] (-2023.549) * (-2015.902) (-2027.801) (-2032.666) [-2015.178] -- 0:04:06
473000 -- [-2021.636] (-2023.268) (-2020.387) (-2024.577) * [-2022.730] (-2017.583) (-2017.282) (-2021.072) -- 0:04:06
473500 -- (-2013.971) (-2016.620) [-2010.910] (-2025.289) * (-2025.873) [-2015.177] (-2020.604) (-2018.766) -- 0:04:05
474000 -- (-2019.929) (-2029.515) (-2021.972) [-2019.265] * (-2027.632) (-2029.677) (-2033.125) [-2014.539] -- 0:04:06
474500 -- (-2013.410) [-2016.575] (-2029.316) (-2024.352) * (-2021.991) [-2020.565] (-2016.577) (-2023.711) -- 0:04:05
475000 -- [-2015.832] (-2028.720) (-2014.264) (-2014.043) * (-2018.747) (-2015.793) (-2026.811) [-2021.435] -- 0:04:05
Average standard deviation of split frequencies: 0.010741
475500 -- (-2022.405) [-2017.149] (-2021.860) (-2014.184) * (-2025.694) (-2023.264) (-2014.701) [-2018.375] -- 0:04:04
476000 -- (-2022.969) (-2022.634) [-2014.966] (-2025.372) * (-2024.209) (-2026.284) [-2019.796] (-2020.258) -- 0:04:05
476500 -- (-2015.152) (-2015.287) [-2014.848] (-2013.457) * (-2020.135) [-2021.649] (-2020.960) (-2013.218) -- 0:04:04
477000 -- (-2018.642) (-2018.871) (-2020.763) [-2017.770] * (-2018.690) (-2022.271) (-2014.679) [-2014.766] -- 0:04:04
477500 -- (-2020.336) (-2029.227) [-2015.184] (-2020.228) * [-2014.029] (-2020.371) (-2019.116) (-2025.337) -- 0:04:04
478000 -- (-2023.029) [-2019.479] (-2019.269) (-2021.137) * (-2016.201) (-2021.705) [-2015.959] (-2026.990) -- 0:04:04
478500 -- (-2019.029) (-2025.203) (-2021.423) [-2013.237] * (-2034.604) (-2017.647) (-2025.252) [-2025.513] -- 0:04:04
479000 -- (-2017.128) [-2014.809] (-2020.394) (-2027.051) * (-2021.209) (-2021.032) (-2028.760) [-2017.955] -- 0:04:03
479500 -- (-2021.032) (-2014.849) [-2015.749] (-2018.828) * (-2017.839) (-2019.460) (-2016.805) [-2013.717] -- 0:04:03
480000 -- (-2016.519) (-2023.141) (-2027.308) [-2014.097] * (-2022.705) (-2018.314) [-2014.443] (-2019.228) -- 0:04:02
Average standard deviation of split frequencies: 0.009883
480500 -- (-2017.532) [-2017.869] (-2027.352) (-2023.002) * (-2016.523) (-2018.607) [-2017.201] (-2025.339) -- 0:04:03
481000 -- (-2017.226) (-2012.153) [-2025.323] (-2024.765) * (-2012.533) (-2023.430) [-2013.514] (-2019.496) -- 0:04:02
481500 -- (-2019.244) [-2017.100] (-2018.375) (-2016.580) * (-2023.074) (-2020.857) [-2012.316] (-2014.361) -- 0:04:02
482000 -- (-2017.154) [-2012.126] (-2019.370) (-2014.795) * (-2032.837) [-2022.894] (-2017.209) (-2017.543) -- 0:04:01
482500 -- (-2017.486) [-2009.373] (-2025.769) (-2020.726) * (-2020.079) [-2020.224] (-2014.269) (-2016.569) -- 0:04:02
483000 -- (-2027.597) (-2011.689) (-2023.268) [-2017.899] * (-2021.596) (-2017.148) [-2014.525] (-2017.819) -- 0:04:01
483500 -- (-2021.038) [-2015.060] (-2023.713) (-2020.794) * (-2010.520) (-2024.012) (-2021.046) [-2019.534] -- 0:04:01
484000 -- (-2016.710) [-2012.646] (-2029.516) (-2023.345) * (-2017.013) (-2027.504) (-2018.079) [-2017.954] -- 0:04:00
484500 -- [-2014.408] (-2016.789) (-2027.012) (-2027.785) * (-2022.886) [-2025.122] (-2021.042) (-2026.026) -- 0:04:01
485000 -- (-2021.106) [-2013.684] (-2021.593) (-2022.486) * (-2018.199) (-2022.687) (-2027.095) [-2021.821] -- 0:04:01
Average standard deviation of split frequencies: 0.009550
485500 -- [-2017.609] (-2018.392) (-2028.699) (-2017.556) * (-2022.031) (-2019.005) [-2016.827] (-2032.223) -- 0:04:00
486000 -- (-2020.592) (-2029.607) (-2022.038) [-2018.161] * (-2020.485) (-2026.958) (-2027.130) [-2015.211] -- 0:04:00
486500 -- [-2015.308] (-2036.207) (-2024.065) (-2022.222) * (-2021.103) (-2015.016) [-2015.571] (-2017.484) -- 0:04:00
487000 -- [-2015.273] (-2020.863) (-2020.804) (-2022.092) * [-2018.759] (-2017.808) (-2016.715) (-2023.129) -- 0:04:00
487500 -- (-2018.603) [-2022.822] (-2022.742) (-2017.443) * [-2014.939] (-2023.784) (-2018.554) (-2017.452) -- 0:03:59
488000 -- (-2018.542) (-2026.145) [-2017.889] (-2022.319) * (-2019.988) (-2023.978) [-2019.379] (-2018.620) -- 0:03:59
488500 -- (-2017.362) (-2017.956) [-2013.560] (-2025.703) * [-2019.935] (-2019.499) (-2021.559) (-2024.830) -- 0:03:58
489000 -- (-2016.889) (-2022.652) [-2017.760] (-2018.004) * [-2018.966] (-2019.464) (-2023.766) (-2011.610) -- 0:03:59
489500 -- (-2023.013) (-2021.072) [-2013.263] (-2014.479) * (-2017.524) (-2024.066) [-2014.245] (-2014.351) -- 0:03:58
490000 -- [-2023.246] (-2029.461) (-2020.337) (-2018.131) * (-2017.398) (-2014.366) [-2020.279] (-2022.087) -- 0:03:58
Average standard deviation of split frequencies: 0.010494
490500 -- [-2016.915] (-2013.026) (-2021.710) (-2015.703) * (-2017.859) (-2019.460) (-2016.218) [-2013.043] -- 0:03:57
491000 -- (-2022.600) [-2012.289] (-2012.029) (-2018.278) * (-2027.496) [-2016.224] (-2014.506) (-2015.740) -- 0:03:58
491500 -- (-2014.299) (-2015.854) [-2013.298] (-2020.540) * (-2029.578) (-2013.029) (-2019.595) [-2018.961] -- 0:03:57
492000 -- (-2019.910) (-2014.180) [-2014.692] (-2025.898) * (-2027.076) (-2017.948) (-2016.228) [-2019.633] -- 0:03:57
492500 -- (-2020.032) [-2013.200] (-2021.770) (-2020.375) * [-2016.887] (-2019.421) (-2014.210) (-2020.565) -- 0:03:57
493000 -- (-2023.291) [-2013.491] (-2015.913) (-2018.027) * (-2013.952) (-2017.530) [-2014.874] (-2032.355) -- 0:03:57
493500 -- (-2023.893) [-2015.107] (-2015.488) (-2019.282) * (-2015.531) (-2026.655) [-2024.981] (-2025.791) -- 0:03:57
494000 -- (-2014.580) (-2020.058) (-2018.163) [-2018.751] * (-2012.551) [-2015.385] (-2018.549) (-2028.232) -- 0:03:56
494500 -- (-2014.419) [-2017.264] (-2021.907) (-2024.816) * (-2021.671) [-2017.130] (-2019.527) (-2017.925) -- 0:03:56
495000 -- (-2021.699) [-2013.218] (-2014.685) (-2016.055) * (-2024.461) [-2014.105] (-2019.867) (-2017.867) -- 0:03:55
Average standard deviation of split frequencies: 0.010089
495500 -- [-2014.527] (-2014.547) (-2019.946) (-2015.222) * (-2016.104) (-2019.492) (-2023.225) [-2020.795] -- 0:03:56
496000 -- (-2021.596) (-2023.450) (-2013.288) [-2015.876] * (-2017.338) (-2024.941) [-2019.740] (-2019.023) -- 0:03:55
496500 -- (-2023.498) (-2017.475) (-2019.869) [-2016.839] * (-2020.508) [-2026.891] (-2018.579) (-2016.102) -- 0:03:55
497000 -- (-2028.669) [-2020.672] (-2024.593) (-2019.304) * [-2019.503] (-2028.018) (-2022.480) (-2018.692) -- 0:03:54
497500 -- (-2017.952) [-2018.676] (-2020.241) (-2020.948) * (-2017.009) (-2022.975) (-2026.164) [-2018.861] -- 0:03:55
498000 -- (-2017.574) (-2020.264) (-2014.267) [-2018.020] * [-2015.962] (-2015.422) (-2011.368) (-2021.732) -- 0:03:54
498500 -- (-2020.988) (-2018.027) (-2015.372) [-2018.489] * [-2019.833] (-2015.361) (-2017.936) (-2021.428) -- 0:03:54
499000 -- (-2018.074) (-2019.809) (-2015.197) [-2018.617] * (-2023.353) (-2018.269) [-2013.416] (-2018.730) -- 0:03:53
499500 -- (-2019.801) (-2016.609) (-2015.917) [-2023.211] * (-2024.034) (-2020.733) (-2025.963) [-2018.916] -- 0:03:53
500000 -- [-2020.004] (-2018.425) (-2030.690) (-2023.224) * (-2028.581) (-2020.509) (-2025.513) [-2019.242] -- 0:03:54
Average standard deviation of split frequencies: 0.009705
500500 -- [-2016.619] (-2024.980) (-2012.371) (-2028.866) * [-2015.955] (-2018.193) (-2017.674) (-2028.369) -- 0:03:53
501000 -- (-2017.963) (-2021.598) (-2017.178) [-2016.470] * (-2020.146) (-2022.432) (-2025.000) [-2022.775] -- 0:03:53
501500 -- (-2018.599) (-2016.707) (-2017.774) [-2025.496] * (-2017.563) [-2012.224] (-2019.544) (-2023.448) -- 0:03:52
502000 -- (-2025.828) (-2018.821) (-2016.823) [-2018.123] * (-2016.977) (-2014.146) [-2013.937] (-2030.650) -- 0:03:53
502500 -- [-2021.260] (-2014.967) (-2026.337) (-2018.145) * (-2018.932) (-2024.422) [-2013.692] (-2021.826) -- 0:03:52
503000 -- (-2015.198) (-2018.551) (-2028.916) [-2020.619] * (-2016.652) [-2016.542] (-2021.113) (-2021.565) -- 0:03:52
503500 -- (-2015.924) (-2028.186) [-2025.110] (-2015.865) * [-2024.330] (-2022.968) (-2021.819) (-2021.267) -- 0:03:51
504000 -- [-2024.923] (-2019.232) (-2022.592) (-2013.627) * (-2026.558) (-2018.099) (-2023.792) [-2015.802] -- 0:03:52
504500 -- (-2026.634) (-2025.309) (-2019.434) [-2016.926] * [-2017.244] (-2018.518) (-2019.227) (-2022.986) -- 0:03:51
505000 -- (-2028.678) (-2017.872) [-2029.753] (-2019.590) * (-2021.336) (-2019.074) [-2019.596] (-2020.111) -- 0:03:51
Average standard deviation of split frequencies: 0.009675
505500 -- (-2017.554) (-2035.787) (-2031.710) [-2016.162] * (-2019.625) (-2024.530) [-2023.301] (-2018.614) -- 0:03:50
506000 -- (-2014.914) [-2016.390] (-2026.818) (-2017.234) * (-2015.824) [-2014.287] (-2022.383) (-2019.199) -- 0:03:51
506500 -- [-2013.955] (-2016.382) (-2024.552) (-2018.501) * (-2010.902) (-2014.670) (-2011.901) [-2017.890] -- 0:03:50
507000 -- (-2020.417) [-2011.713] (-2017.949) (-2026.382) * [-2011.979] (-2015.038) (-2016.782) (-2023.203) -- 0:03:50
507500 -- (-2024.827) (-2022.274) [-2017.117] (-2016.073) * (-2018.089) [-2015.690] (-2028.778) (-2021.702) -- 0:03:49
508000 -- (-2017.777) (-2021.467) [-2015.946] (-2025.031) * (-2018.078) (-2025.136) [-2021.014] (-2022.230) -- 0:03:49
508500 -- (-2011.633) (-2013.060) (-2018.984) [-2019.775] * [-2015.320] (-2028.703) (-2020.016) (-2016.004) -- 0:03:50
509000 -- (-2027.535) [-2014.848] (-2018.982) (-2028.052) * [-2018.262] (-2027.417) (-2016.417) (-2020.157) -- 0:03:49
509500 -- (-2028.407) (-2017.201) [-2021.773] (-2026.296) * (-2017.942) (-2017.040) [-2011.487] (-2011.914) -- 0:03:49
510000 -- (-2021.387) (-2015.217) (-2015.168) [-2017.680] * [-2019.016] (-2020.509) (-2021.596) (-2011.975) -- 0:03:48
Average standard deviation of split frequencies: 0.010012
510500 -- (-2022.643) (-2018.075) (-2024.023) [-2014.208] * (-2019.167) [-2022.162] (-2019.478) (-2014.772) -- 0:03:49
511000 -- (-2014.942) [-2016.376] (-2019.678) (-2022.920) * (-2021.188) (-2026.976) (-2019.575) [-2014.688] -- 0:03:48
511500 -- (-2015.684) (-2017.251) [-2025.042] (-2012.032) * (-2014.995) (-2030.075) [-2017.891] (-2021.448) -- 0:03:48
512000 -- (-2023.030) [-2014.309] (-2016.929) (-2018.113) * [-2020.848] (-2019.947) (-2014.633) (-2020.893) -- 0:03:47
512500 -- (-2020.618) (-2019.961) (-2015.474) [-2021.369] * [-2016.594] (-2020.873) (-2021.276) (-2020.545) -- 0:03:48
513000 -- [-2018.577] (-2023.885) (-2017.158) (-2018.442) * (-2021.025) [-2017.368] (-2016.906) (-2018.333) -- 0:03:47
513500 -- (-2016.190) (-2018.235) [-2014.337] (-2021.976) * (-2028.847) [-2016.527] (-2018.266) (-2018.331) -- 0:03:47
514000 -- (-2017.590) [-2012.085] (-2018.215) (-2022.300) * [-2021.751] (-2017.491) (-2016.699) (-2016.800) -- 0:03:46
514500 -- [-2017.083] (-2023.041) (-2024.459) (-2021.557) * (-2024.211) (-2019.218) [-2015.846] (-2010.916) -- 0:03:46
515000 -- (-2015.157) [-2022.836] (-2016.703) (-2024.277) * (-2022.952) (-2023.123) [-2011.987] (-2016.001) -- 0:03:46
Average standard deviation of split frequencies: 0.009838
515500 -- (-2016.900) [-2023.041] (-2024.301) (-2017.654) * [-2015.593] (-2016.106) (-2020.685) (-2023.487) -- 0:03:46
516000 -- [-2012.834] (-2016.016) (-2023.615) (-2017.521) * (-2013.389) (-2017.610) [-2015.237] (-2018.386) -- 0:03:46
516500 -- (-2023.874) (-2021.636) (-2018.711) [-2014.844] * (-2013.511) [-2016.142] (-2027.148) (-2019.930) -- 0:03:45
517000 -- (-2022.280) (-2024.627) (-2016.178) [-2020.865] * (-2014.622) (-2021.610) (-2023.151) [-2011.132] -- 0:03:46
517500 -- (-2020.099) (-2019.431) [-2019.709] (-2018.013) * (-2012.355) [-2010.741] (-2020.547) (-2026.669) -- 0:03:45
518000 -- (-2023.491) [-2015.253] (-2020.523) (-2022.390) * [-2012.820] (-2022.776) (-2022.356) (-2030.584) -- 0:03:45
518500 -- [-2018.724] (-2023.370) (-2021.095) (-2023.090) * (-2022.600) [-2017.932] (-2027.261) (-2026.204) -- 0:03:44
519000 -- (-2024.018) [-2024.351] (-2020.494) (-2019.262) * (-2025.603) [-2020.683] (-2018.137) (-2025.889) -- 0:03:45
519500 -- (-2018.441) (-2027.383) [-2014.383] (-2018.613) * (-2016.914) (-2018.643) [-2021.027] (-2026.435) -- 0:03:44
520000 -- (-2022.322) (-2018.256) [-2018.996] (-2017.349) * (-2028.627) (-2019.389) (-2019.321) [-2015.755] -- 0:03:44
Average standard deviation of split frequencies: 0.010307
520500 -- (-2026.367) (-2017.889) (-2029.595) [-2016.287] * [-2022.082] (-2027.901) (-2019.320) (-2018.462) -- 0:03:43
521000 -- (-2027.440) [-2015.205] (-2022.134) (-2017.508) * (-2014.458) [-2015.571] (-2025.378) (-2025.236) -- 0:03:43
521500 -- (-2022.217) (-2022.950) (-2018.678) [-2015.058] * (-2028.113) (-2017.447) [-2024.498] (-2018.062) -- 0:03:43
522000 -- (-2024.691) (-2021.634) [-2019.753] (-2022.236) * (-2029.237) (-2026.683) (-2023.254) [-2023.322] -- 0:03:43
522500 -- [-2025.698] (-2022.966) (-2019.468) (-2018.391) * (-2027.133) (-2012.768) [-2018.538] (-2017.991) -- 0:03:42
523000 -- (-2025.048) (-2026.696) (-2024.369) [-2015.666] * (-2028.201) (-2014.845) [-2017.983] (-2019.095) -- 0:03:42
523500 -- (-2027.729) (-2021.695) [-2021.562] (-2030.877) * (-2032.159) [-2021.406] (-2026.602) (-2029.335) -- 0:03:43
524000 -- (-2024.486) (-2022.720) [-2017.087] (-2020.012) * (-2020.076) (-2027.436) (-2029.549) [-2018.247] -- 0:03:42
524500 -- (-2024.831) [-2018.142] (-2022.420) (-2021.494) * [-2016.415] (-2017.736) (-2025.144) (-2011.181) -- 0:03:42
525000 -- (-2023.093) (-2016.835) (-2030.037) [-2014.257] * (-2022.962) (-2024.668) [-2017.497] (-2012.807) -- 0:03:41
Average standard deviation of split frequencies: 0.009996
525500 -- [-2013.945] (-2022.095) (-2013.967) (-2016.476) * [-2021.684] (-2023.834) (-2027.695) (-2010.181) -- 0:03:42
526000 -- (-2021.629) (-2012.861) (-2015.349) [-2027.146] * (-2017.829) (-2017.794) (-2015.917) [-2020.741] -- 0:03:41
526500 -- (-2027.547) (-2015.344) [-2020.267] (-2014.314) * (-2021.791) [-2016.918] (-2019.464) (-2022.714) -- 0:03:41
527000 -- [-2017.051] (-2021.299) (-2020.552) (-2018.656) * [-2021.870] (-2019.303) (-2033.214) (-2022.717) -- 0:03:40
527500 -- (-2016.492) (-2017.987) (-2021.085) [-2014.389] * (-2019.639) [-2020.219] (-2023.765) (-2022.269) -- 0:03:40
528000 -- (-2021.398) (-2015.673) (-2025.467) [-2015.644] * (-2022.235) (-2025.004) [-2020.095] (-2012.882) -- 0:03:40
528500 -- [-2017.160] (-2018.593) (-2023.714) (-2017.608) * (-2013.314) (-2020.597) (-2020.689) [-2019.054] -- 0:03:40
529000 -- (-2017.685) (-2021.634) [-2018.395] (-2029.737) * (-2017.934) [-2015.156] (-2029.847) (-2012.531) -- 0:03:39
529500 -- [-2015.590] (-2020.427) (-2019.184) (-2029.145) * (-2023.444) [-2015.654] (-2019.083) (-2024.122) -- 0:03:39
530000 -- (-2014.544) (-2023.270) (-2020.476) [-2018.754] * (-2017.317) [-2014.389] (-2018.643) (-2016.946) -- 0:03:39
Average standard deviation of split frequencies: 0.009225
530500 -- [-2012.222] (-2018.617) (-2018.787) (-2017.619) * (-2017.154) (-2024.264) (-2022.024) [-2017.577] -- 0:03:39
531000 -- (-2016.500) (-2014.072) (-2012.518) [-2017.407] * (-2015.824) [-2014.384] (-2018.591) (-2018.616) -- 0:03:39
531500 -- (-2022.167) [-2016.508] (-2016.388) (-2018.734) * (-2028.700) [-2027.142] (-2017.673) (-2016.984) -- 0:03:38
532000 -- (-2030.250) (-2013.752) [-2016.237] (-2019.766) * (-2018.103) (-2016.535) (-2017.899) [-2010.315] -- 0:03:39
532500 -- (-2020.251) [-2021.550] (-2018.130) (-2022.242) * (-2027.824) [-2016.267] (-2020.143) (-2020.499) -- 0:03:38
533000 -- (-2018.431) [-2014.242] (-2017.077) (-2021.171) * [-2017.077] (-2020.174) (-2017.206) (-2016.907) -- 0:03:38
533500 -- [-2015.067] (-2018.955) (-2022.863) (-2018.169) * (-2011.048) (-2023.778) (-2025.211) [-2016.099] -- 0:03:37
534000 -- (-2014.941) (-2022.053) [-2012.456] (-2024.849) * (-2011.307) (-2016.660) [-2013.349] (-2022.438) -- 0:03:38
534500 -- (-2024.370) (-2026.396) (-2025.158) [-2017.999] * (-2016.632) (-2013.776) [-2012.492] (-2037.113) -- 0:03:37
535000 -- (-2024.283) [-2018.093] (-2027.995) (-2019.379) * (-2019.093) [-2021.208] (-2018.756) (-2024.663) -- 0:03:37
Average standard deviation of split frequencies: 0.008863
535500 -- (-2022.845) (-2021.847) (-2021.903) [-2014.026] * (-2016.101) (-2024.205) (-2018.711) [-2015.404] -- 0:03:36
536000 -- (-2028.003) (-2025.587) [-2015.003] (-2017.356) * (-2013.595) (-2020.915) (-2014.327) [-2015.225] -- 0:03:36
536500 -- (-2029.424) [-2016.480] (-2015.488) (-2017.916) * (-2013.837) (-2015.277) (-2016.477) [-2014.217] -- 0:03:36
537000 -- [-2011.502] (-2021.914) (-2022.125) (-2019.593) * [-2024.196] (-2010.928) (-2022.556) (-2016.488) -- 0:03:36
537500 -- (-2020.987) [-2018.077] (-2020.867) (-2013.956) * (-2025.618) [-2018.544] (-2012.444) (-2022.121) -- 0:03:35
538000 -- (-2015.222) [-2022.025] (-2016.586) (-2021.365) * (-2022.651) [-2014.325] (-2017.249) (-2014.919) -- 0:03:35
538500 -- (-2019.092) (-2026.254) [-2025.092] (-2028.399) * (-2015.631) [-2019.805] (-2018.915) (-2017.949) -- 0:03:35
539000 -- (-2018.565) (-2018.332) (-2021.509) [-2017.828] * [-2023.484] (-2021.085) (-2015.035) (-2015.907) -- 0:03:35
539500 -- (-2025.934) [-2013.509] (-2020.990) (-2014.780) * (-2022.009) (-2025.871) [-2016.489] (-2019.973) -- 0:03:35
540000 -- (-2019.754) [-2025.987] (-2017.564) (-2016.832) * (-2030.958) (-2019.458) [-2011.007] (-2023.871) -- 0:03:34
Average standard deviation of split frequencies: 0.008920
540500 -- (-2018.506) [-2012.010] (-2021.887) (-2015.523) * [-2020.343] (-2024.766) (-2023.965) (-2022.586) -- 0:03:35
541000 -- (-2016.370) [-2013.591] (-2020.639) (-2013.319) * (-2017.710) [-2014.433] (-2016.313) (-2025.155) -- 0:03:34
541500 -- (-2017.706) (-2027.854) (-2030.797) [-2015.949] * [-2019.106] (-2017.074) (-2025.504) (-2016.120) -- 0:03:34
542000 -- [-2023.294] (-2026.939) (-2030.122) (-2019.348) * (-2018.792) (-2013.471) [-2015.362] (-2016.211) -- 0:03:33
542500 -- (-2014.822) (-2023.492) (-2020.496) [-2015.479] * (-2030.530) [-2013.523] (-2015.479) (-2017.378) -- 0:03:33
543000 -- (-2020.804) (-2029.281) (-2025.634) [-2014.986] * (-2018.650) [-2015.395] (-2027.253) (-2024.424) -- 0:03:33
543500 -- (-2017.785) (-2026.979) [-2015.412] (-2018.054) * [-2024.495] (-2018.870) (-2020.843) (-2020.674) -- 0:03:33
544000 -- (-2030.424) (-2019.684) [-2012.147] (-2022.180) * (-2023.350) (-2020.976) (-2019.332) [-2011.338] -- 0:03:32
544500 -- (-2045.076) (-2021.838) (-2017.738) [-2019.624] * [-2021.206] (-2027.889) (-2032.461) (-2020.169) -- 0:03:32
545000 -- (-2020.349) (-2017.513) (-2025.358) [-2018.800] * (-2018.589) (-2015.899) [-2015.235] (-2024.778) -- 0:03:32
Average standard deviation of split frequencies: 0.009962
545500 -- (-2023.192) [-2022.784] (-2015.954) (-2023.501) * (-2024.908) (-2027.808) (-2016.866) [-2024.049] -- 0:03:32
546000 -- (-2025.556) (-2015.218) (-2023.440) [-2016.511] * [-2014.816] (-2026.892) (-2031.541) (-2027.373) -- 0:03:32
546500 -- [-2018.087] (-2022.687) (-2020.623) (-2029.211) * (-2027.732) (-2016.922) [-2018.517] (-2013.888) -- 0:03:31
547000 -- [-2013.020] (-2017.888) (-2017.203) (-2015.028) * (-2018.805) (-2029.353) [-2019.616] (-2024.172) -- 0:03:32
547500 -- (-2018.291) (-2016.913) (-2021.556) [-2015.869] * (-2033.233) [-2020.001] (-2016.146) (-2015.835) -- 0:03:31
548000 -- (-2025.175) [-2019.135] (-2019.595) (-2020.363) * (-2020.908) (-2018.255) (-2019.783) [-2014.920] -- 0:03:31
548500 -- [-2016.615] (-2025.142) (-2021.828) (-2020.174) * (-2020.316) (-2015.292) [-2016.645] (-2011.229) -- 0:03:30
549000 -- [-2014.987] (-2013.937) (-2015.442) (-2023.238) * (-2021.899) (-2014.821) [-2016.332] (-2023.397) -- 0:03:30
549500 -- [-2016.740] (-2017.653) (-2020.331) (-2018.362) * (-2020.127) (-2024.873) [-2019.982] (-2017.674) -- 0:03:30
550000 -- (-2022.126) (-2023.559) (-2018.069) [-2013.590] * [-2012.963] (-2019.253) (-2016.658) (-2023.308) -- 0:03:30
Average standard deviation of split frequencies: 0.010009
550500 -- (-2011.452) (-2013.831) [-2012.501] (-2015.298) * (-2014.537) (-2015.259) (-2017.773) [-2017.200] -- 0:03:29
551000 -- (-2015.225) (-2018.043) (-2019.158) [-2018.995] * (-2023.732) [-2019.314] (-2019.946) (-2022.084) -- 0:03:29
551500 -- (-2020.545) (-2019.422) (-2008.629) [-2010.289] * (-2024.478) [-2015.417] (-2013.481) (-2017.805) -- 0:03:29
552000 -- (-2025.053) (-2019.672) [-2012.051] (-2012.524) * (-2023.352) [-2024.674] (-2019.148) (-2014.018) -- 0:03:29
552500 -- (-2018.085) (-2022.064) [-2013.836] (-2014.094) * (-2023.720) [-2017.317] (-2015.963) (-2020.461) -- 0:03:28
553000 -- (-2018.571) (-2016.770) (-2026.794) [-2010.309] * [-2022.825] (-2023.602) (-2024.814) (-2019.105) -- 0:03:28
553500 -- (-2024.872) [-2019.665] (-2013.573) (-2015.435) * (-2021.150) (-2010.953) [-2019.833] (-2016.812) -- 0:03:28
554000 -- (-2026.622) (-2017.823) [-2016.443] (-2017.960) * (-2028.460) [-2015.527] (-2027.434) (-2021.449) -- 0:03:28
554500 -- (-2028.341) (-2020.470) (-2017.286) [-2020.057] * (-2018.263) [-2017.009] (-2014.163) (-2033.566) -- 0:03:28
555000 -- (-2025.324) [-2017.766] (-2019.320) (-2021.206) * (-2019.563) (-2023.715) (-2019.920) [-2020.501] -- 0:03:27
Average standard deviation of split frequencies: 0.009522
555500 -- (-2023.924) (-2018.866) [-2019.291] (-2021.323) * (-2021.247) (-2022.451) [-2016.931] (-2008.719) -- 0:03:27
556000 -- (-2030.173) [-2025.279] (-2012.442) (-2023.373) * [-2015.630] (-2027.674) (-2019.822) (-2024.206) -- 0:03:27
556500 -- (-2029.501) (-2023.142) [-2014.567] (-2021.335) * (-2016.213) [-2015.329] (-2022.760) (-2019.934) -- 0:03:27
557000 -- (-2025.897) [-2021.870] (-2018.534) (-2022.246) * (-2016.085) [-2016.540] (-2029.253) (-2026.610) -- 0:03:26
557500 -- (-2027.304) (-2022.458) (-2023.530) [-2019.153] * [-2014.275] (-2019.796) (-2019.510) (-2018.777) -- 0:03:26
558000 -- (-2022.206) [-2015.938] (-2018.639) (-2013.884) * (-2012.425) (-2014.550) (-2017.320) [-2013.329] -- 0:03:26
558500 -- (-2020.721) (-2027.572) (-2013.509) [-2010.230] * (-2019.477) [-2018.608] (-2024.428) (-2021.547) -- 0:03:26
559000 -- (-2013.298) (-2020.260) [-2019.138] (-2020.803) * [-2013.637] (-2023.744) (-2017.651) (-2034.734) -- 0:03:25
559500 -- (-2024.480) [-2013.888] (-2027.572) (-2015.780) * [-2018.242] (-2016.251) (-2016.750) (-2021.488) -- 0:03:25
560000 -- (-2024.248) [-2015.235] (-2020.626) (-2021.684) * (-2016.706) (-2022.804) (-2022.429) [-2021.847] -- 0:03:25
Average standard deviation of split frequencies: 0.009701
560500 -- (-2019.598) [-2015.538] (-2015.166) (-2016.639) * [-2018.141] (-2010.120) (-2017.121) (-2014.695) -- 0:03:25
561000 -- [-2019.107] (-2024.349) (-2016.185) (-2020.419) * [-2014.219] (-2022.727) (-2021.095) (-2023.702) -- 0:03:25
561500 -- (-2017.258) [-2014.135] (-2016.326) (-2021.416) * [-2021.628] (-2024.724) (-2018.424) (-2027.250) -- 0:03:24
562000 -- (-2022.635) [-2017.176] (-2029.851) (-2016.758) * (-2020.719) (-2022.610) (-2017.090) [-2015.032] -- 0:03:24
562500 -- [-2011.706] (-2024.784) (-2028.456) (-2018.724) * (-2017.213) (-2018.616) [-2016.757] (-2015.674) -- 0:03:24
563000 -- (-2013.797) [-2020.442] (-2020.133) (-2022.233) * (-2017.696) (-2015.070) (-2026.768) [-2016.887] -- 0:03:24
563500 -- (-2019.823) (-2020.813) [-2025.287] (-2015.094) * (-2018.628) [-2011.163] (-2016.324) (-2022.475) -- 0:03:23
564000 -- [-2015.069] (-2030.429) (-2017.039) (-2024.773) * (-2018.551) (-2019.188) (-2017.931) [-2012.564] -- 0:03:23
564500 -- (-2017.015) (-2017.556) [-2026.814] (-2020.044) * (-2018.047) (-2012.736) [-2025.557] (-2014.718) -- 0:03:23
565000 -- [-2011.290] (-2018.713) (-2018.574) (-2021.158) * (-2022.912) (-2028.501) [-2018.090] (-2024.134) -- 0:03:23
Average standard deviation of split frequencies: 0.009930
565500 -- [-2017.491] (-2020.485) (-2018.359) (-2019.812) * (-2026.060) [-2018.077] (-2025.087) (-2020.141) -- 0:03:22
566000 -- [-2016.113] (-2017.775) (-2019.003) (-2025.833) * (-2019.355) [-2014.060] (-2021.587) (-2022.212) -- 0:03:22
566500 -- [-2016.821] (-2019.243) (-2017.674) (-2021.145) * (-2021.849) [-2023.176] (-2030.601) (-2018.477) -- 0:03:22
567000 -- (-2019.271) [-2013.711] (-2025.000) (-2024.734) * (-2022.550) (-2021.211) (-2023.457) [-2016.248] -- 0:03:22
567500 -- (-2026.925) (-2017.562) (-2024.118) [-2018.894] * [-2011.714] (-2017.405) (-2021.401) (-2019.823) -- 0:03:21
568000 -- (-2028.972) (-2019.265) (-2017.028) [-2020.547] * [-2022.276] (-2018.463) (-2014.517) (-2010.463) -- 0:03:21
568500 -- [-2027.933] (-2028.950) (-2013.282) (-2025.596) * (-2015.457) [-2018.578] (-2025.306) (-2019.597) -- 0:03:21
569000 -- (-2019.788) (-2024.808) (-2013.015) [-2022.044] * [-2021.834] (-2017.534) (-2024.326) (-2018.216) -- 0:03:21
569500 -- (-2017.697) (-2014.836) [-2016.840] (-2019.729) * (-2019.428) (-2030.950) [-2020.124] (-2013.690) -- 0:03:21
570000 -- (-2017.299) (-2024.448) [-2019.143] (-2017.489) * (-2019.810) (-2013.126) [-2016.832] (-2017.545) -- 0:03:20
Average standard deviation of split frequencies: 0.010612
570500 -- (-2016.092) (-2014.593) [-2017.775] (-2021.610) * (-2016.277) (-2013.594) (-2028.768) [-2016.945] -- 0:03:20
571000 -- (-2018.909) (-2018.423) [-2017.248] (-2027.004) * (-2022.720) (-2022.015) [-2017.843] (-2014.862) -- 0:03:20
571500 -- (-2019.910) (-2020.816) (-2014.035) [-2019.958] * (-2024.800) [-2019.177] (-2010.235) (-2016.236) -- 0:03:20
572000 -- (-2024.413) (-2019.382) [-2016.368] (-2014.187) * (-2014.008) (-2022.860) [-2018.534] (-2014.811) -- 0:03:19
572500 -- (-2018.838) (-2018.093) [-2022.836] (-2021.308) * (-2014.957) [-2019.512] (-2026.236) (-2016.615) -- 0:03:19
573000 -- (-2017.537) (-2025.412) (-2024.497) [-2014.341] * (-2013.041) (-2020.899) (-2019.931) [-2017.206] -- 0:03:19
573500 -- (-2022.781) (-2018.583) (-2020.617) [-2017.864] * (-2015.872) [-2019.678] (-2017.272) (-2013.582) -- 0:03:19
574000 -- [-2017.803] (-2023.596) (-2027.484) (-2014.720) * (-2020.523) (-2020.767) [-2015.092] (-2013.915) -- 0:03:18
574500 -- (-2015.389) [-2020.943] (-2023.131) (-2016.346) * (-2012.822) [-2015.428] (-2016.926) (-2017.715) -- 0:03:18
575000 -- (-2024.707) (-2024.031) [-2009.656] (-2020.500) * [-2017.175] (-2016.103) (-2024.408) (-2019.356) -- 0:03:18
Average standard deviation of split frequencies: 0.009569
575500 -- (-2020.951) (-2022.750) (-2023.708) [-2026.629] * (-2023.004) (-2018.617) [-2017.584] (-2030.839) -- 0:03:18
576000 -- (-2019.092) (-2029.279) (-2023.327) [-2016.337] * (-2021.820) (-2016.161) [-2017.771] (-2023.401) -- 0:03:18
576500 -- (-2021.444) [-2032.018] (-2025.698) (-2016.358) * (-2017.421) (-2028.789) (-2021.846) [-2017.152] -- 0:03:17
577000 -- [-2018.361] (-2032.280) (-2033.741) (-2013.330) * (-2020.877) [-2013.933] (-2021.178) (-2014.420) -- 0:03:17
577500 -- [-2022.231] (-2031.051) (-2026.836) (-2027.410) * (-2023.144) (-2021.046) [-2025.429] (-2032.092) -- 0:03:17
578000 -- (-2018.573) (-2021.809) (-2018.109) [-2022.599] * (-2026.676) (-2024.608) [-2017.679] (-2022.624) -- 0:03:17
578500 -- (-2018.461) (-2012.327) (-2025.516) [-2021.727] * [-2010.301] (-2021.572) (-2021.102) (-2028.130) -- 0:03:16
579000 -- (-2013.757) (-2016.683) [-2016.759] (-2022.827) * (-2019.654) (-2022.830) (-2015.189) [-2015.824] -- 0:03:16
579500 -- (-2020.429) (-2022.265) (-2016.643) [-2018.444] * (-2024.229) [-2010.597] (-2015.878) (-2022.533) -- 0:03:16
580000 -- (-2020.047) (-2030.242) (-2015.646) [-2018.888] * (-2030.360) (-2025.585) [-2012.533] (-2021.871) -- 0:03:16
Average standard deviation of split frequencies: 0.010366
580500 -- [-2016.997] (-2026.501) (-2018.100) (-2023.498) * (-2029.016) (-2012.252) [-2023.348] (-2037.924) -- 0:03:15
581000 -- (-2018.535) (-2031.929) (-2014.369) [-2012.858] * (-2015.666) (-2021.308) [-2017.543] (-2017.937) -- 0:03:15
581500 -- (-2011.851) (-2022.446) (-2017.494) [-2018.860] * (-2018.606) (-2020.169) [-2020.626] (-2015.096) -- 0:03:15
582000 -- (-2013.886) (-2021.321) [-2014.460] (-2019.348) * (-2013.507) (-2027.642) (-2021.529) [-2021.840] -- 0:03:15
582500 -- (-2017.621) (-2015.472) (-2018.005) [-2015.164] * (-2022.265) (-2028.860) [-2023.896] (-2017.933) -- 0:03:14
583000 -- [-2014.237] (-2019.128) (-2021.037) (-2023.813) * [-2017.700] (-2016.578) (-2021.704) (-2025.107) -- 0:03:14
583500 -- (-2018.765) (-2020.570) (-2021.037) [-2018.951] * (-2024.944) (-2023.439) (-2014.935) [-2014.071] -- 0:03:14
584000 -- (-2019.852) [-2017.576] (-2022.513) (-2021.496) * (-2029.010) [-2034.734] (-2017.694) (-2024.238) -- 0:03:14
584500 -- [-2021.885] (-2017.392) (-2022.352) (-2019.950) * (-2030.365) (-2019.895) (-2021.182) [-2022.413] -- 0:03:14
585000 -- (-2021.949) [-2013.951] (-2017.937) (-2024.612) * [-2021.668] (-2020.440) (-2021.189) (-2011.058) -- 0:03:13
Average standard deviation of split frequencies: 0.009839
585500 -- (-2022.269) (-2026.294) [-2015.109] (-2020.360) * (-2017.534) (-2021.641) [-2019.813] (-2026.447) -- 0:03:13
586000 -- (-2026.616) [-2016.707] (-2021.386) (-2020.918) * (-2019.743) (-2018.335) [-2013.635] (-2017.671) -- 0:03:13
586500 -- (-2023.669) (-2026.105) [-2015.444] (-2027.809) * [-2019.775] (-2017.946) (-2025.414) (-2026.879) -- 0:03:13
587000 -- (-2014.959) (-2020.939) (-2016.383) [-2016.741] * (-2025.717) (-2013.079) (-2014.309) [-2017.509] -- 0:03:12
587500 -- [-2017.689] (-2020.757) (-2017.489) (-2027.338) * (-2023.959) (-2018.169) (-2021.844) [-2026.245] -- 0:03:12
588000 -- (-2018.074) (-2023.448) [-2015.439] (-2024.514) * (-2023.009) (-2018.678) (-2019.468) [-2013.997] -- 0:03:11
588500 -- (-2019.080) [-2017.764] (-2022.484) (-2015.467) * [-2022.172] (-2020.264) (-2031.540) (-2016.519) -- 0:03:12
589000 -- [-2017.400] (-2025.903) (-2021.915) (-2017.342) * (-2025.219) (-2017.454) [-2024.167] (-2014.916) -- 0:03:11
589500 -- (-2016.087) (-2024.447) [-2022.675] (-2020.619) * (-2012.714) (-2022.795) [-2022.551] (-2011.484) -- 0:03:11
590000 -- (-2019.090) (-2024.422) (-2016.078) [-2011.197] * [-2009.841] (-2023.046) (-2020.873) (-2018.528) -- 0:03:11
Average standard deviation of split frequencies: 0.009761
590500 -- (-2022.724) [-2014.420] (-2019.428) (-2018.593) * [-2010.599] (-2021.260) (-2015.441) (-2017.846) -- 0:03:11
591000 -- (-2020.442) [-2012.693] (-2015.867) (-2023.513) * [-2014.894] (-2021.239) (-2021.949) (-2018.342) -- 0:03:11
591500 -- [-2017.610] (-2037.657) (-2022.065) (-2020.730) * (-2015.189) (-2021.373) (-2017.219) [-2012.025] -- 0:03:10
592000 -- (-2027.746) [-2017.720] (-2014.607) (-2022.888) * [-2014.013] (-2016.283) (-2026.713) (-2025.511) -- 0:03:10
592500 -- (-2017.020) [-2017.993] (-2019.509) (-2017.849) * (-2018.158) (-2020.295) [-2019.966] (-2021.391) -- 0:03:10
593000 -- (-2018.938) [-2019.288] (-2020.669) (-2022.563) * [-2012.676] (-2024.894) (-2018.858) (-2020.017) -- 0:03:10
593500 -- (-2018.174) (-2017.542) (-2027.570) [-2020.385] * [-2023.508] (-2027.891) (-2018.210) (-2014.469) -- 0:03:09
594000 -- (-2013.961) [-2026.756] (-2025.663) (-2016.530) * (-2015.718) (-2018.120) [-2011.262] (-2024.927) -- 0:03:09
594500 -- (-2015.733) (-2032.330) [-2019.968] (-2021.940) * (-2016.030) [-2011.318] (-2018.713) (-2029.779) -- 0:03:08
595000 -- (-2021.666) (-2023.418) [-2011.252] (-2015.816) * (-2022.124) (-2012.224) [-2018.294] (-2029.711) -- 0:03:09
Average standard deviation of split frequencies: 0.010404
595500 -- [-2018.531] (-2015.333) (-2021.152) (-2031.023) * (-2017.841) (-2025.683) [-2016.224] (-2014.809) -- 0:03:08
596000 -- (-2012.562) (-2017.683) [-2015.458] (-2028.835) * (-2017.163) (-2022.447) [-2016.654] (-2018.541) -- 0:03:08
596500 -- (-2021.027) (-2023.576) [-2013.566] (-2030.375) * [-2017.891] (-2016.798) (-2023.400) (-2015.591) -- 0:03:08
597000 -- (-2016.885) (-2016.297) [-2012.998] (-2028.443) * (-2017.348) (-2022.583) (-2025.130) [-2015.344] -- 0:03:08
597500 -- [-2021.945] (-2016.255) (-2019.065) (-2029.496) * [-2018.507] (-2019.051) (-2024.849) (-2014.616) -- 0:03:07
598000 -- (-2019.957) [-2024.738] (-2023.766) (-2021.450) * [-2021.934] (-2025.388) (-2020.605) (-2010.661) -- 0:03:07
598500 -- (-2023.208) (-2017.830) (-2019.860) [-2016.095] * (-2026.934) (-2015.608) (-2025.044) [-2013.474] -- 0:03:07
599000 -- (-2017.497) [-2017.961] (-2020.916) (-2016.231) * (-2019.817) (-2019.579) (-2020.069) [-2019.852] -- 0:03:07
599500 -- (-2021.456) (-2020.832) (-2017.963) [-2017.022] * (-2016.613) [-2021.006] (-2022.032) (-2019.903) -- 0:03:07
600000 -- (-2021.853) (-2022.043) [-2020.449] (-2024.053) * (-2018.786) (-2012.520) [-2020.537] (-2016.392) -- 0:03:06
Average standard deviation of split frequencies: 0.010875
600500 -- (-2014.463) [-2016.613] (-2027.122) (-2013.502) * (-2017.168) [-2013.311] (-2022.024) (-2016.471) -- 0:03:06
601000 -- (-2015.746) (-2021.105) (-2023.829) [-2015.462] * (-2016.453) (-2021.696) (-2029.615) [-2015.202] -- 0:03:05
601500 -- [-2020.821] (-2019.799) (-2018.714) (-2025.190) * (-2017.303) [-2013.640] (-2027.775) (-2022.050) -- 0:03:06
602000 -- [-2019.331] (-2023.393) (-2023.794) (-2022.687) * (-2018.675) [-2013.580] (-2024.598) (-2028.615) -- 0:03:05
602500 -- [-2017.476] (-2021.087) (-2014.702) (-2015.427) * [-2013.255] (-2021.150) (-2030.765) (-2024.605) -- 0:03:05
603000 -- [-2025.180] (-2020.790) (-2021.112) (-2018.566) * (-2013.145) [-2016.072] (-2030.667) (-2029.383) -- 0:03:05
603500 -- [-2012.771] (-2025.558) (-2017.465) (-2021.397) * [-2016.460] (-2015.741) (-2021.927) (-2021.827) -- 0:03:05
604000 -- (-2023.942) [-2022.002] (-2019.238) (-2014.193) * [-2012.635] (-2016.308) (-2022.796) (-2023.656) -- 0:03:04
604500 -- (-2024.817) (-2025.912) (-2011.376) [-2013.931] * (-2024.987) [-2014.915] (-2022.601) (-2024.451) -- 0:03:04
605000 -- (-2019.380) (-2018.125) [-2021.767] (-2019.339) * (-2015.222) (-2013.932) (-2013.324) [-2012.982] -- 0:03:04
Average standard deviation of split frequencies: 0.011279
605500 -- (-2021.103) (-2019.026) (-2021.577) [-2024.670] * (-2019.209) (-2020.504) [-2022.494] (-2016.732) -- 0:03:04
606000 -- (-2017.722) [-2020.502] (-2023.216) (-2018.509) * [-2016.988] (-2016.827) (-2024.341) (-2019.150) -- 0:03:03
606500 -- (-2019.966) [-2020.447] (-2021.568) (-2017.641) * (-2015.943) [-2011.633] (-2021.946) (-2024.237) -- 0:03:03
607000 -- (-2019.082) (-2021.811) [-2017.300] (-2016.454) * (-2019.023) [-2017.183] (-2018.628) (-2018.131) -- 0:03:03
607500 -- (-2012.973) (-2017.463) [-2012.684] (-2016.275) * (-2016.647) [-2015.661] (-2023.751) (-2019.098) -- 0:03:02
608000 -- (-2019.860) (-2021.895) (-2018.290) [-2015.625] * (-2016.307) (-2023.459) [-2016.388] (-2021.058) -- 0:03:03
608500 -- (-2026.532) (-2018.337) (-2024.010) [-2013.825] * (-2018.364) (-2021.003) [-2014.941] (-2017.767) -- 0:03:02
609000 -- [-2018.408] (-2017.883) (-2022.923) (-2014.592) * (-2017.680) (-2025.239) [-2016.776] (-2012.960) -- 0:03:02
609500 -- [-2018.133] (-2022.212) (-2017.506) (-2021.019) * (-2022.641) (-2018.895) [-2016.319] (-2016.475) -- 0:03:01
610000 -- (-2023.394) [-2013.822] (-2019.664) (-2019.040) * [-2018.347] (-2016.885) (-2020.558) (-2020.789) -- 0:03:02
Average standard deviation of split frequencies: 0.010807
610500 -- (-2020.549) (-2017.182) [-2020.065] (-2020.697) * (-2016.688) (-2012.322) [-2014.888] (-2012.157) -- 0:03:01
611000 -- (-2020.932) (-2022.777) [-2019.771] (-2013.198) * (-2012.612) (-2020.278) [-2012.774] (-2020.450) -- 0:03:01
611500 -- (-2021.602) (-2020.021) (-2029.202) [-2018.290] * (-2017.366) (-2015.595) [-2014.789] (-2024.997) -- 0:03:01
612000 -- (-2018.352) [-2012.430] (-2020.361) (-2020.132) * (-2017.777) (-2017.269) [-2012.966] (-2027.405) -- 0:03:01
612500 -- [-2014.119] (-2021.104) (-2026.825) (-2018.936) * [-2017.933] (-2017.269) (-2013.383) (-2024.818) -- 0:03:00
613000 -- (-2016.606) (-2022.033) (-2026.221) [-2020.554] * [-2016.822] (-2022.524) (-2018.236) (-2021.441) -- 0:03:00
613500 -- [-2017.382] (-2026.482) (-2026.316) (-2018.466) * (-2025.070) (-2027.904) [-2022.399] (-2028.274) -- 0:03:00
614000 -- (-2023.151) (-2017.530) [-2015.750] (-2018.071) * (-2019.342) (-2028.560) (-2023.525) [-2013.660] -- 0:02:59
614500 -- (-2021.798) (-2020.450) [-2022.148] (-2015.639) * (-2013.457) (-2025.505) (-2018.912) [-2013.393] -- 0:03:00
615000 -- (-2029.010) (-2023.348) [-2021.828] (-2029.365) * (-2023.761) (-2014.830) [-2019.496] (-2020.647) -- 0:02:59
Average standard deviation of split frequencies: 0.010949
615500 -- [-2015.037] (-2022.401) (-2019.971) (-2020.669) * [-2013.709] (-2013.142) (-2022.521) (-2016.296) -- 0:02:59
616000 -- (-2015.920) (-2020.881) [-2012.938] (-2029.936) * (-2019.777) (-2026.615) [-2020.821] (-2018.266) -- 0:02:58
616500 -- (-2021.182) (-2020.553) [-2010.407] (-2028.493) * (-2017.613) (-2019.841) (-2018.612) [-2014.305] -- 0:02:59
617000 -- (-2024.962) (-2015.825) (-2020.557) [-2022.935] * (-2009.208) (-2020.536) [-2017.475] (-2014.186) -- 0:02:58
617500 -- [-2017.902] (-2019.870) (-2023.622) (-2020.917) * [-2013.219] (-2021.939) (-2015.740) (-2016.443) -- 0:02:58
618000 -- (-2015.452) [-2021.310] (-2018.997) (-2017.595) * (-2015.447) (-2018.033) [-2012.948] (-2037.808) -- 0:02:58
618500 -- (-2017.510) [-2026.738] (-2020.560) (-2022.911) * [-2014.938] (-2019.525) (-2018.996) (-2021.968) -- 0:02:58
619000 -- (-2019.831) (-2017.186) (-2018.882) [-2011.681] * [-2018.282] (-2020.528) (-2023.270) (-2024.329) -- 0:02:57
619500 -- (-2015.629) (-2016.892) (-2022.431) [-2013.214] * (-2017.314) (-2025.125) [-2020.450] (-2027.498) -- 0:02:57
620000 -- [-2018.403] (-2022.534) (-2017.025) (-2020.519) * (-2020.712) (-2020.305) [-2017.843] (-2013.816) -- 0:02:57
Average standard deviation of split frequencies: 0.011101
620500 -- [-2023.595] (-2024.706) (-2016.808) (-2016.654) * (-2012.751) (-2016.031) [-2019.510] (-2016.722) -- 0:02:57
621000 -- [-2017.932] (-2018.280) (-2018.695) (-2026.788) * (-2017.590) (-2012.643) [-2023.550] (-2023.287) -- 0:02:56
621500 -- (-2023.401) [-2014.741] (-2021.813) (-2030.560) * (-2020.875) [-2012.090] (-2023.207) (-2021.889) -- 0:02:56
622000 -- (-2023.524) (-2020.243) [-2021.188] (-2028.925) * (-2024.177) [-2009.725] (-2013.555) (-2030.174) -- 0:02:56
622500 -- (-2022.743) (-2019.162) [-2020.403] (-2027.568) * (-2023.063) (-2021.179) [-2019.183] (-2027.965) -- 0:02:55
623000 -- (-2018.743) [-2016.899] (-2023.189) (-2024.210) * (-2021.650) (-2021.083) (-2020.112) [-2016.090] -- 0:02:56
623500 -- (-2028.975) (-2020.763) [-2018.199] (-2020.963) * (-2023.481) [-2016.672] (-2022.595) (-2017.815) -- 0:02:55
624000 -- (-2026.309) (-2018.367) (-2016.577) [-2020.425] * (-2024.139) (-2020.141) (-2018.543) [-2017.262] -- 0:02:55
624500 -- (-2027.606) (-2024.452) [-2012.343] (-2029.469) * (-2020.927) (-2021.927) (-2012.529) [-2019.300] -- 0:02:54
625000 -- (-2023.272) (-2019.956) [-2013.604] (-2016.610) * (-2021.484) (-2021.376) [-2019.629] (-2017.645) -- 0:02:55
Average standard deviation of split frequencies: 0.011064
625500 -- (-2015.690) [-2018.536] (-2025.346) (-2020.556) * (-2015.080) (-2018.772) (-2014.100) [-2022.075] -- 0:02:54
626000 -- (-2018.627) (-2022.199) (-2022.989) [-2022.039] * (-2014.706) (-2026.625) (-2024.018) [-2023.320] -- 0:02:54
626500 -- (-2016.661) [-2012.998] (-2015.393) (-2016.193) * [-2020.356] (-2022.278) (-2020.220) (-2019.882) -- 0:02:54
627000 -- (-2017.797) [-2011.616] (-2021.220) (-2026.105) * (-2016.871) [-2015.265] (-2021.158) (-2026.662) -- 0:02:54
627500 -- [-2015.943] (-2016.756) (-2020.845) (-2011.351) * (-2017.067) [-2018.246] (-2021.012) (-2024.764) -- 0:02:53
628000 -- (-2022.591) [-2018.115] (-2023.374) (-2020.857) * (-2019.557) (-2029.204) [-2020.366] (-2015.104) -- 0:02:53
628500 -- (-2018.805) [-2013.315] (-2012.268) (-2018.991) * [-2022.164] (-2027.305) (-2019.130) (-2021.369) -- 0:02:53
629000 -- (-2017.115) [-2020.857] (-2027.687) (-2019.671) * (-2021.893) (-2018.272) [-2015.593] (-2014.377) -- 0:02:53
629500 -- (-2016.290) (-2023.154) (-2022.306) [-2016.899] * (-2035.238) (-2016.749) (-2023.902) [-2014.757] -- 0:02:53
630000 -- (-2015.098) (-2025.084) [-2017.330] (-2024.807) * (-2032.667) (-2019.131) (-2020.007) [-2013.714] -- 0:02:52
Average standard deviation of split frequencies: 0.011040
630500 -- (-2017.996) (-2031.418) (-2018.172) [-2013.828] * (-2025.065) (-2016.177) [-2014.936] (-2021.661) -- 0:02:52
631000 -- (-2016.521) (-2029.926) [-2016.279] (-2016.805) * (-2024.913) (-2022.554) [-2023.271] (-2013.105) -- 0:02:51
631500 -- (-2019.038) (-2024.430) [-2013.386] (-2025.219) * (-2019.165) (-2018.532) [-2017.161] (-2016.243) -- 0:02:52
632000 -- (-2033.110) (-2016.299) (-2016.814) [-2020.544] * (-2019.977) [-2017.739] (-2015.394) (-2023.769) -- 0:02:51
632500 -- (-2020.742) (-2019.320) [-2022.233] (-2021.564) * (-2021.005) (-2025.269) (-2015.006) [-2020.239] -- 0:02:51
633000 -- (-2025.157) [-2017.372] (-2022.148) (-2015.000) * [-2021.842] (-2028.783) (-2018.294) (-2020.133) -- 0:02:51
633500 -- (-2018.448) (-2021.056) [-2019.101] (-2023.525) * (-2025.470) (-2022.084) (-2019.506) [-2014.543] -- 0:02:51
634000 -- (-2021.464) [-2020.663] (-2029.631) (-2013.061) * (-2014.300) (-2022.671) (-2024.570) [-2013.331] -- 0:02:50
634500 -- [-2022.153] (-2021.100) (-2014.865) (-2023.533) * (-2016.858) (-2026.921) (-2021.017) [-2023.226] -- 0:02:50
635000 -- (-2024.653) [-2011.209] (-2019.831) (-2022.308) * [-2013.699] (-2030.345) (-2021.762) (-2020.460) -- 0:02:50
Average standard deviation of split frequencies: 0.010719
635500 -- (-2028.375) [-2019.245] (-2023.391) (-2015.455) * (-2021.564) [-2023.047] (-2020.496) (-2028.493) -- 0:02:50
636000 -- [-2010.894] (-2020.177) (-2024.042) (-2018.850) * (-2026.742) [-2018.421] (-2032.367) (-2020.678) -- 0:02:49
636500 -- (-2017.303) (-2020.855) [-2013.102] (-2018.798) * [-2020.635] (-2013.220) (-2022.041) (-2015.930) -- 0:02:49
637000 -- (-2026.181) (-2016.384) [-2019.620] (-2025.832) * (-2019.323) (-2013.521) (-2016.996) [-2013.173] -- 0:02:49
637500 -- (-2025.621) (-2017.724) (-2015.057) [-2010.974] * (-2016.301) (-2014.098) [-2020.808] (-2018.453) -- 0:02:49
638000 -- (-2017.686) (-2021.018) [-2012.753] (-2014.937) * (-2032.833) [-2017.795] (-2025.483) (-2011.858) -- 0:02:49
638500 -- (-2018.993) [-2021.072] (-2030.752) (-2024.220) * [-2015.711] (-2017.683) (-2028.612) (-2020.336) -- 0:02:48
639000 -- [-2021.832] (-2017.809) (-2023.473) (-2019.790) * (-2011.985) (-2014.779) (-2024.440) [-2016.915] -- 0:02:48
639500 -- (-2018.783) (-2018.735) (-2022.195) [-2022.957] * (-2013.504) [-2017.656] (-2032.627) (-2030.728) -- 0:02:48
640000 -- [-2021.032] (-2022.912) (-2015.710) (-2018.176) * (-2019.132) (-2015.067) [-2018.469] (-2024.072) -- 0:02:48
Average standard deviation of split frequencies: 0.010528
640500 -- (-2013.742) (-2019.787) [-2012.091] (-2028.080) * (-2017.521) (-2019.334) [-2014.868] (-2024.527) -- 0:02:47
641000 -- (-2013.247) [-2020.710] (-2022.734) (-2024.346) * (-2026.775) [-2015.347] (-2013.953) (-2020.114) -- 0:02:47
641500 -- [-2019.752] (-2019.000) (-2016.206) (-2019.936) * (-2021.814) (-2022.816) [-2011.431] (-2013.553) -- 0:02:47
642000 -- (-2030.270) [-2019.467] (-2019.227) (-2018.067) * (-2017.303) (-2021.268) [-2020.395] (-2024.022) -- 0:02:47
642500 -- [-2025.402] (-2025.915) (-2019.649) (-2023.083) * (-2020.077) (-2023.866) (-2016.533) [-2016.544] -- 0:02:46
643000 -- (-2024.771) (-2019.914) (-2017.608) [-2021.545] * (-2021.464) (-2016.848) (-2021.393) [-2014.095] -- 0:02:46
643500 -- (-2021.417) (-2018.939) (-2023.695) [-2020.019] * [-2015.029] (-2023.229) (-2024.963) (-2020.035) -- 0:02:46
644000 -- (-2035.136) (-2022.291) [-2015.329] (-2024.332) * (-2017.476) (-2021.626) [-2020.799] (-2023.037) -- 0:02:46
644500 -- (-2036.900) [-2016.945] (-2012.384) (-2014.593) * [-2017.777] (-2022.173) (-2016.978) (-2016.622) -- 0:02:46
645000 -- (-2027.069) (-2020.035) (-2019.532) [-2021.745] * (-2019.144) (-2016.533) (-2024.871) [-2015.085] -- 0:02:45
Average standard deviation of split frequencies: 0.010890
645500 -- (-2026.465) (-2020.184) [-2015.927] (-2019.533) * (-2022.339) (-2023.978) (-2021.925) [-2012.641] -- 0:02:45
646000 -- (-2026.473) (-2018.338) (-2014.479) [-2022.808] * (-2015.533) (-2023.586) [-2017.159] (-2012.697) -- 0:02:45
646500 -- (-2025.554) (-2019.245) [-2010.849] (-2013.135) * (-2024.678) [-2020.274] (-2024.482) (-2031.472) -- 0:02:45
647000 -- (-2024.047) (-2025.144) [-2017.037] (-2018.269) * (-2014.082) (-2021.319) (-2019.371) [-2016.077] -- 0:02:44
647500 -- (-2015.979) (-2025.862) [-2019.138] (-2021.753) * (-2017.053) (-2015.807) [-2020.567] (-2016.700) -- 0:02:44
648000 -- [-2012.772] (-2024.983) (-2015.996) (-2022.871) * (-2013.968) (-2028.469) (-2017.608) [-2026.480] -- 0:02:44
648500 -- (-2031.037) [-2020.546] (-2020.059) (-2018.475) * [-2011.066] (-2019.950) (-2017.865) (-2026.713) -- 0:02:44
649000 -- (-2019.284) (-2025.102) (-2020.360) [-2019.256] * [-2020.932] (-2027.969) (-2016.420) (-2019.281) -- 0:02:43
649500 -- (-2009.864) (-2023.396) (-2019.666) [-2016.259] * (-2016.572) [-2017.009] (-2015.854) (-2017.483) -- 0:02:43
650000 -- [-2016.948] (-2018.360) (-2017.087) (-2017.724) * (-2022.994) (-2012.909) [-2029.659] (-2027.085) -- 0:02:43
Average standard deviation of split frequencies: 0.010700
650500 -- (-2014.180) [-2019.014] (-2022.747) (-2020.118) * (-2024.476) (-2018.650) (-2023.110) [-2019.925] -- 0:02:43
651000 -- (-2028.656) [-2018.236] (-2015.595) (-2022.844) * (-2017.813) (-2022.871) (-2020.717) [-2013.186] -- 0:02:42
651500 -- (-2024.826) (-2021.850) (-2013.537) [-2015.329] * (-2010.163) (-2019.747) [-2024.312] (-2028.567) -- 0:02:42
652000 -- [-2019.864] (-2016.914) (-2017.058) (-2023.175) * (-2018.463) (-2019.053) [-2020.205] (-2018.581) -- 0:02:42
652500 -- (-2025.877) [-2021.209] (-2023.508) (-2023.918) * (-2023.702) (-2018.907) [-2014.723] (-2019.417) -- 0:02:42
653000 -- [-2017.166] (-2022.015) (-2027.585) (-2015.752) * (-2017.803) (-2015.666) [-2024.947] (-2017.545) -- 0:02:42
653500 -- (-2018.014) (-2019.309) (-2019.829) [-2016.177] * (-2023.962) [-2011.563] (-2024.852) (-2028.315) -- 0:02:41
654000 -- (-2024.753) (-2020.907) (-2018.584) [-2024.625] * (-2013.930) (-2013.711) (-2033.428) [-2014.522] -- 0:02:41
654500 -- (-2017.915) [-2015.284] (-2019.998) (-2020.519) * (-2012.231) (-2023.291) [-2016.834] (-2012.544) -- 0:02:41
655000 -- [-2023.567] (-2020.576) (-2033.126) (-2017.734) * (-2025.384) [-2015.561] (-2017.687) (-2020.738) -- 0:02:41
Average standard deviation of split frequencies: 0.010669
655500 -- [-2020.575] (-2024.039) (-2024.159) (-2026.054) * (-2020.142) (-2017.163) (-2029.641) [-2012.133] -- 0:02:40
656000 -- [-2014.940] (-2018.526) (-2015.414) (-2018.135) * (-2023.351) (-2020.092) [-2017.137] (-2021.681) -- 0:02:40
656500 -- [-2013.281] (-2020.186) (-2021.056) (-2024.453) * [-2017.042] (-2021.883) (-2025.791) (-2021.309) -- 0:02:40
657000 -- (-2022.716) [-2013.295] (-2019.639) (-2023.261) * (-2020.822) [-2020.507] (-2022.913) (-2024.340) -- 0:02:40
657500 -- (-2014.546) [-2019.520] (-2021.522) (-2016.801) * [-2020.580] (-2013.086) (-2016.960) (-2016.043) -- 0:02:39
658000 -- (-2036.199) (-2017.820) (-2012.962) [-2013.609] * (-2010.840) [-2020.015] (-2019.841) (-2022.190) -- 0:02:39
658500 -- (-2027.815) (-2020.857) [-2022.811] (-2016.623) * (-2019.277) (-2017.641) (-2024.226) [-2015.967] -- 0:02:39
659000 -- (-2019.475) (-2016.964) [-2024.505] (-2015.159) * (-2015.667) (-2031.260) (-2020.031) [-2016.202] -- 0:02:39
659500 -- [-2020.167] (-2020.822) (-2014.666) (-2019.448) * [-2017.424] (-2029.432) (-2030.464) (-2021.456) -- 0:02:39
660000 -- [-2027.509] (-2017.174) (-2016.203) (-2017.932) * (-2020.179) [-2017.554] (-2022.689) (-2024.860) -- 0:02:38
Average standard deviation of split frequencies: 0.011087
660500 -- (-2023.812) (-2020.430) (-2016.109) [-2015.296] * (-2019.868) (-2022.129) (-2021.779) [-2020.630] -- 0:02:38
661000 -- [-2011.809] (-2017.972) (-2025.572) (-2015.551) * (-2014.566) (-2024.240) (-2032.798) [-2017.247] -- 0:02:38
661500 -- (-2014.910) [-2021.303] (-2017.424) (-2024.789) * (-2016.108) [-2012.652] (-2019.898) (-2022.662) -- 0:02:38
662000 -- (-2020.999) [-2024.947] (-2018.301) (-2021.727) * (-2015.960) (-2015.236) [-2020.669] (-2020.200) -- 0:02:37
662500 -- (-2018.209) [-2022.461] (-2024.809) (-2028.105) * [-2016.242] (-2022.181) (-2017.797) (-2019.849) -- 0:02:37
663000 -- (-2019.375) (-2021.501) [-2011.686] (-2017.306) * (-2033.539) [-2019.282] (-2019.860) (-2018.232) -- 0:02:37
663500 -- (-2016.975) (-2024.553) (-2015.559) [-2019.215] * (-2028.489) (-2015.198) [-2016.731] (-2028.561) -- 0:02:37
664000 -- (-2020.003) [-2016.289] (-2020.298) (-2016.272) * [-2019.293] (-2024.898) (-2020.058) (-2023.641) -- 0:02:36
664500 -- [-2014.794] (-2018.007) (-2021.787) (-2022.691) * (-2022.678) (-2020.067) [-2015.534] (-2023.456) -- 0:02:36
665000 -- (-2022.848) (-2013.018) (-2021.000) [-2009.734] * (-2024.484) (-2020.228) (-2013.107) [-2019.635] -- 0:02:36
Average standard deviation of split frequencies: 0.010672
665500 -- (-2019.625) [-2016.270] (-2018.051) (-2025.000) * (-2016.058) (-2019.160) (-2025.230) [-2019.136] -- 0:02:36
666000 -- [-2015.447] (-2012.305) (-2027.227) (-2020.291) * (-2013.762) (-2019.666) [-2018.765] (-2024.731) -- 0:02:35
666500 -- (-2017.238) (-2019.550) [-2022.148] (-2012.704) * (-2025.409) [-2012.200] (-2020.687) (-2017.680) -- 0:02:35
667000 -- [-2015.375] (-2014.455) (-2018.625) (-2015.637) * (-2024.317) (-2015.047) (-2022.807) [-2016.643] -- 0:02:35
667500 -- (-2015.550) (-2021.312) (-2020.817) [-2014.200] * (-2026.405) [-2021.622] (-2028.099) (-2014.499) -- 0:02:35
668000 -- (-2017.083) (-2022.805) (-2022.580) [-2011.213] * (-2020.770) (-2031.900) [-2018.675] (-2020.453) -- 0:02:35
668500 -- [-2018.362] (-2024.272) (-2018.690) (-2019.322) * (-2022.275) (-2025.643) [-2012.125] (-2022.751) -- 0:02:34
669000 -- (-2014.684) (-2026.449) (-2021.046) [-2015.218] * (-2017.616) [-2028.949] (-2012.175) (-2024.531) -- 0:02:34
669500 -- [-2014.728] (-2020.185) (-2018.367) (-2016.322) * (-2025.791) (-2021.760) (-2019.706) [-2014.512] -- 0:02:34
670000 -- (-2017.832) [-2012.743] (-2014.910) (-2012.807) * (-2019.975) (-2026.840) (-2022.225) [-2018.119] -- 0:02:34
Average standard deviation of split frequencies: 0.011246
670500 -- (-2022.619) (-2023.020) [-2013.273] (-2019.653) * (-2022.912) (-2016.103) (-2018.981) [-2014.091] -- 0:02:33
671000 -- (-2021.093) (-2025.202) (-2018.147) [-2015.698] * (-2019.510) (-2015.465) [-2015.367] (-2019.255) -- 0:02:33
671500 -- [-2019.989] (-2012.885) (-2019.602) (-2019.293) * (-2017.654) (-2023.955) (-2024.069) [-2019.964] -- 0:02:33
672000 -- (-2026.893) (-2021.457) [-2012.783] (-2025.236) * (-2013.475) (-2031.383) [-2019.810] (-2021.650) -- 0:02:33
672500 -- (-2024.451) (-2018.648) [-2016.700] (-2021.441) * (-2014.279) (-2018.547) [-2018.589] (-2025.048) -- 0:02:32
673000 -- (-2022.154) (-2013.957) [-2018.222] (-2013.766) * (-2018.498) (-2013.936) [-2016.667] (-2017.644) -- 0:02:32
673500 -- (-2018.514) (-2013.392) (-2014.421) [-2013.300] * (-2019.171) (-2014.879) [-2018.193] (-2020.005) -- 0:02:32
674000 -- (-2017.271) (-2012.495) [-2018.909] (-2018.029) * (-2028.766) (-2019.993) (-2018.531) [-2013.423] -- 0:02:32
674500 -- (-2019.379) (-2018.507) (-2021.123) [-2018.569] * (-2021.108) [-2014.315] (-2023.203) (-2017.185) -- 0:02:32
675000 -- [-2022.027] (-2017.901) (-2022.815) (-2014.467) * (-2025.218) [-2022.322] (-2019.613) (-2027.724) -- 0:02:31
Average standard deviation of split frequencies: 0.010675
675500 -- [-2018.803] (-2015.865) (-2016.669) (-2018.990) * (-2018.813) [-2015.597] (-2019.361) (-2017.702) -- 0:02:31
676000 -- [-2022.569] (-2018.305) (-2018.641) (-2013.911) * (-2023.647) (-2031.525) [-2014.059] (-2019.743) -- 0:02:30
676500 -- (-2019.693) (-2028.491) [-2015.903] (-2028.415) * [-2012.746] (-2016.669) (-2016.496) (-2019.718) -- 0:02:31
677000 -- (-2023.890) (-2012.685) (-2019.188) [-2025.614] * (-2013.536) [-2013.453] (-2013.395) (-2017.123) -- 0:02:30
677500 -- [-2024.551] (-2024.954) (-2020.127) (-2027.072) * (-2025.585) (-2020.056) [-2012.920] (-2020.780) -- 0:02:30
678000 -- (-2024.079) (-2020.863) [-2017.132] (-2026.019) * [-2017.828] (-2031.844) (-2017.544) (-2021.355) -- 0:02:30
678500 -- (-2021.646) (-2025.375) [-2016.437] (-2016.352) * (-2018.403) [-2014.933] (-2023.741) (-2016.778) -- 0:02:30
679000 -- (-2018.111) (-2014.809) [-2016.247] (-2017.407) * (-2017.234) (-2022.238) (-2024.339) [-2017.718] -- 0:02:29
679500 -- (-2018.492) [-2013.156] (-2020.791) (-2023.198) * (-2011.335) (-2020.703) [-2018.516] (-2017.537) -- 0:02:29
680000 -- (-2018.176) [-2013.568] (-2015.187) (-2025.424) * (-2019.041) [-2015.807] (-2025.454) (-2016.705) -- 0:02:29
Average standard deviation of split frequencies: 0.010655
680500 -- (-2015.831) [-2016.154] (-2012.003) (-2029.243) * (-2024.627) (-2018.547) (-2028.131) [-2018.334] -- 0:02:29
681000 -- (-2016.004) [-2012.247] (-2012.885) (-2018.787) * (-2031.552) (-2018.604) (-2018.624) [-2014.630] -- 0:02:28
681500 -- (-2020.814) (-2014.695) [-2014.813] (-2016.251) * (-2026.661) (-2021.533) [-2020.292] (-2022.827) -- 0:02:28
682000 -- (-2010.552) [-2017.949] (-2012.632) (-2024.706) * [-2018.608] (-2012.542) (-2022.343) (-2011.952) -- 0:02:28
682500 -- (-2018.110) (-2017.556) [-2015.574] (-2023.091) * (-2013.457) [-2023.833] (-2023.544) (-2022.688) -- 0:02:27
683000 -- [-2021.692] (-2022.303) (-2020.289) (-2014.150) * [-2023.937] (-2024.148) (-2019.194) (-2018.793) -- 0:02:28
683500 -- (-2021.084) (-2013.630) [-2018.644] (-2020.491) * (-2021.034) [-2017.180] (-2017.474) (-2017.392) -- 0:02:27
684000 -- [-2014.279] (-2018.054) (-2016.411) (-2011.395) * (-2016.192) (-2022.825) [-2014.085] (-2031.159) -- 0:02:27
684500 -- [-2027.595] (-2028.139) (-2018.928) (-2017.038) * (-2016.862) (-2021.188) [-2012.556] (-2013.320) -- 0:02:27
685000 -- [-2013.205] (-2022.184) (-2016.351) (-2023.230) * (-2014.934) (-2030.408) (-2020.621) [-2012.101] -- 0:02:27
Average standard deviation of split frequencies: 0.010361
685500 -- (-2019.323) [-2029.343] (-2020.412) (-2018.041) * [-2017.729] (-2029.699) (-2018.883) (-2020.439) -- 0:02:26
686000 -- (-2021.456) [-2018.770] (-2010.054) (-2018.597) * (-2016.078) [-2017.129] (-2019.527) (-2020.187) -- 0:02:26
686500 -- (-2025.611) (-2026.061) (-2012.038) [-2014.978] * (-2023.068) (-2022.942) [-2024.541] (-2018.216) -- 0:02:26
687000 -- (-2023.792) (-2020.938) [-2019.897] (-2019.955) * (-2024.482) (-2022.516) (-2020.224) [-2014.495] -- 0:02:26
687500 -- [-2015.258] (-2018.521) (-2015.799) (-2017.778) * (-2011.457) (-2022.443) [-2016.673] (-2020.047) -- 0:02:25
688000 -- [-2015.048] (-2027.333) (-2020.349) (-2016.074) * (-2013.618) [-2014.784] (-2023.784) (-2021.132) -- 0:02:25
688500 -- (-2020.476) [-2011.001] (-2018.437) (-2018.991) * (-2018.174) [-2013.018] (-2023.559) (-2015.540) -- 0:02:25
689000 -- [-2020.761] (-2014.482) (-2025.147) (-2022.802) * (-2018.622) (-2018.102) (-2022.584) [-2017.851] -- 0:02:24
689500 -- (-2021.039) (-2018.387) (-2019.154) [-2016.654] * (-2015.041) (-2033.048) [-2011.365] (-2013.554) -- 0:02:25
690000 -- (-2024.616) (-2014.282) (-2021.724) [-2023.585] * (-2023.269) [-2019.863] (-2026.177) (-2020.004) -- 0:02:24
Average standard deviation of split frequencies: 0.010501
690500 -- (-2017.796) (-2015.505) (-2020.108) [-2016.746] * (-2019.023) [-2016.215] (-2021.693) (-2012.473) -- 0:02:24
691000 -- (-2012.820) [-2022.204] (-2028.537) (-2018.979) * (-2027.549) (-2019.922) (-2013.612) [-2010.202] -- 0:02:23
691500 -- (-2024.183) [-2022.181] (-2020.715) (-2025.671) * (-2025.954) (-2026.902) (-2021.594) [-2015.460] -- 0:02:24
692000 -- (-2021.233) (-2029.073) (-2016.051) [-2017.560] * (-2022.459) [-2014.432] (-2023.958) (-2015.240) -- 0:02:23
692500 -- (-2017.954) (-2027.668) (-2023.944) [-2016.977] * (-2022.642) [-2016.696] (-2021.800) (-2014.990) -- 0:02:23
693000 -- (-2023.458) (-2017.030) (-2021.781) [-2017.692] * (-2019.650) [-2010.642] (-2018.810) (-2017.396) -- 0:02:23
693500 -- [-2018.762] (-2016.205) (-2020.341) (-2024.461) * (-2033.626) [-2019.646] (-2021.969) (-2019.471) -- 0:02:22
694000 -- (-2016.109) [-2015.943] (-2020.830) (-2030.624) * [-2018.938] (-2014.842) (-2018.248) (-2023.184) -- 0:02:22
694500 -- (-2015.900) (-2022.256) [-2019.843] (-2026.307) * (-2015.335) (-2019.558) [-2010.567] (-2021.865) -- 0:02:22
695000 -- (-2030.548) (-2031.448) (-2016.792) [-2017.840] * [-2024.148] (-2029.528) (-2016.919) (-2016.876) -- 0:02:22
Average standard deviation of split frequencies: 0.011670
695500 -- (-2027.579) (-2025.567) (-2015.422) [-2024.064] * (-2021.729) (-2020.046) [-2014.440] (-2020.999) -- 0:02:21
696000 -- [-2023.495] (-2027.381) (-2017.184) (-2015.214) * (-2025.244) (-2023.240) [-2015.582] (-2026.469) -- 0:02:21
696500 -- (-2026.192) [-2018.336] (-2009.605) (-2024.727) * (-2018.678) (-2012.806) (-2019.347) [-2019.840] -- 0:02:21
697000 -- (-2018.858) (-2029.064) (-2011.212) [-2016.985] * (-2021.889) (-2017.353) (-2023.475) [-2023.356] -- 0:02:21
697500 -- (-2019.654) (-2023.956) [-2018.395] (-2019.151) * [-2011.662] (-2026.711) (-2019.511) (-2026.653) -- 0:02:20
698000 -- [-2018.171] (-2018.933) (-2015.281) (-2017.486) * (-2012.229) (-2024.320) (-2018.975) [-2026.128] -- 0:02:21
698500 -- (-2019.564) (-2020.623) (-2018.526) [-2018.480] * (-2017.799) (-2018.363) (-2017.269) [-2021.677] -- 0:02:20
699000 -- [-2015.909] (-2025.221) (-2020.526) (-2030.398) * [-2018.055] (-2019.810) (-2017.947) (-2016.229) -- 0:02:20
699500 -- (-2015.370) (-2025.129) (-2016.559) [-2029.721] * (-2016.346) [-2018.780] (-2020.850) (-2015.003) -- 0:02:20
700000 -- [-2015.645] (-2019.995) (-2022.026) (-2020.203) * (-2017.810) (-2019.205) (-2018.120) [-2015.871] -- 0:02:19
Average standard deviation of split frequencies: 0.011955
700500 -- (-2026.118) (-2019.512) (-2013.940) [-2015.429] * (-2020.476) (-2018.038) [-2024.298] (-2022.889) -- 0:02:19
701000 -- (-2026.152) [-2016.267] (-2020.919) (-2034.842) * (-2017.559) [-2013.186] (-2024.334) (-2020.236) -- 0:02:19
701500 -- (-2022.966) (-2022.317) [-2017.242] (-2018.917) * (-2015.393) [-2020.349] (-2017.912) (-2024.584) -- 0:02:19
702000 -- (-2017.075) [-2016.391] (-2017.417) (-2017.998) * (-2016.480) (-2017.766) (-2017.767) [-2016.675] -- 0:02:18
702500 -- (-2022.219) [-2016.320] (-2027.090) (-2017.868) * (-2021.300) (-2016.989) [-2017.123] (-2026.392) -- 0:02:18
703000 -- (-2024.403) (-2017.704) (-2015.448) [-2018.863] * (-2015.414) (-2023.264) (-2016.330) [-2020.064] -- 0:02:18
703500 -- [-2026.360] (-2020.005) (-2021.269) (-2019.371) * (-2027.494) (-2029.625) (-2021.221) [-2012.581] -- 0:02:18
704000 -- [-2018.203] (-2015.548) (-2022.436) (-2020.090) * [-2023.100] (-2023.387) (-2015.407) (-2016.658) -- 0:02:17
704500 -- (-2026.543) [-2022.374] (-2022.035) (-2027.646) * (-2019.689) (-2017.805) (-2031.361) [-2014.324] -- 0:02:17
705000 -- (-2016.404) (-2017.776) (-2021.966) [-2022.275] * [-2018.256] (-2017.472) (-2018.004) (-2013.520) -- 0:02:17
Average standard deviation of split frequencies: 0.012430
705500 -- [-2019.362] (-2019.668) (-2017.110) (-2022.062) * (-2021.694) [-2015.562] (-2023.699) (-2028.378) -- 0:02:17
706000 -- [-2014.113] (-2012.378) (-2027.729) (-2037.050) * (-2016.919) [-2016.866] (-2026.096) (-2021.238) -- 0:02:17
706500 -- (-2019.284) [-2011.819] (-2025.571) (-2016.191) * (-2021.646) (-2019.301) (-2025.541) [-2017.700] -- 0:02:17
707000 -- (-2016.025) [-2015.794] (-2025.545) (-2014.923) * (-2015.488) (-2018.489) (-2021.482) [-2019.473] -- 0:02:16
707500 -- (-2019.902) (-2020.043) (-2019.727) [-2019.265] * (-2024.521) [-2020.027] (-2022.250) (-2027.404) -- 0:02:16
708000 -- (-2015.441) (-2020.748) [-2015.880] (-2020.420) * (-2026.434) [-2011.311] (-2022.302) (-2021.366) -- 0:02:16
708500 -- (-2021.054) (-2024.194) [-2021.336] (-2016.011) * (-2016.686) (-2019.813) [-2011.226] (-2025.388) -- 0:02:15
709000 -- (-2027.327) [-2016.047] (-2016.792) (-2016.204) * [-2016.418] (-2024.841) (-2010.063) (-2019.401) -- 0:02:15
709500 -- [-2015.138] (-2019.543) (-2012.710) (-2015.342) * [-2018.373] (-2024.491) (-2020.658) (-2016.497) -- 0:02:15
710000 -- [-2016.491] (-2025.632) (-2019.895) (-2025.689) * (-2011.813) (-2023.815) (-2020.598) [-2012.572] -- 0:02:15
Average standard deviation of split frequencies: 0.012246
710500 -- [-2013.708] (-2022.955) (-2017.210) (-2018.551) * [-2013.220] (-2017.196) (-2023.085) (-2013.603) -- 0:02:14
711000 -- (-2014.169) (-2021.943) (-2016.604) [-2015.853] * (-2020.376) (-2016.693) [-2016.430] (-2017.403) -- 0:02:14
711500 -- (-2023.967) (-2019.226) (-2020.305) [-2015.323] * (-2018.649) [-2016.030] (-2020.127) (-2021.050) -- 0:02:14
712000 -- (-2022.866) (-2014.557) (-2023.129) [-2023.121] * (-2023.773) (-2018.216) [-2021.619] (-2021.061) -- 0:02:14
712500 -- [-2010.278] (-2016.425) (-2028.505) (-2031.472) * (-2014.380) [-2016.937] (-2014.164) (-2014.478) -- 0:02:13
713000 -- (-2026.403) (-2019.611) [-2018.354] (-2025.752) * (-2014.789) (-2021.263) [-2023.519] (-2021.067) -- 0:02:14
713500 -- (-2017.784) [-2017.676] (-2022.461) (-2018.785) * [-2013.417] (-2024.342) (-2019.367) (-2016.776) -- 0:02:13
714000 -- [-2019.998] (-2024.478) (-2021.547) (-2014.576) * (-2014.365) (-2020.092) [-2020.523] (-2022.326) -- 0:02:13
714500 -- [-2014.653] (-2016.780) (-2018.455) (-2011.576) * (-2016.420) (-2015.893) [-2020.269] (-2018.579) -- 0:02:13
715000 -- [-2015.044] (-2019.199) (-2012.916) (-2017.609) * (-2021.962) [-2019.884] (-2017.623) (-2013.461) -- 0:02:13
Average standard deviation of split frequencies: 0.011750
715500 -- [-2012.334] (-2025.771) (-2025.047) (-2020.992) * [-2015.846] (-2019.887) (-2014.986) (-2016.998) -- 0:02:12
716000 -- (-2018.853) [-2024.605] (-2022.399) (-2025.522) * (-2018.216) [-2020.619] (-2019.957) (-2021.986) -- 0:02:12
716500 -- (-2022.389) [-2011.043] (-2025.388) (-2028.952) * [-2015.083] (-2024.162) (-2017.225) (-2020.432) -- 0:02:12
717000 -- [-2028.697] (-2017.698) (-2019.310) (-2017.908) * (-2014.634) (-2014.774) [-2019.910] (-2014.985) -- 0:02:11
717500 -- (-2021.796) [-2017.660] (-2031.302) (-2019.684) * (-2018.075) (-2014.267) (-2017.116) [-2014.896] -- 0:02:11
718000 -- (-2016.304) (-2023.129) (-2029.265) [-2017.019] * (-2012.765) (-2018.861) (-2017.021) [-2018.406] -- 0:02:11
718500 -- [-2017.569] (-2028.857) (-2027.207) (-2025.068) * (-2015.456) [-2017.380] (-2020.935) (-2016.883) -- 0:02:11
719000 -- (-2018.075) (-2027.355) [-2020.012] (-2021.196) * (-2019.053) (-2018.388) [-2016.843] (-2019.021) -- 0:02:10
719500 -- (-2017.650) (-2015.402) [-2017.234] (-2020.468) * (-2024.819) [-2021.785] (-2023.262) (-2016.238) -- 0:02:10
720000 -- [-2014.302] (-2021.577) (-2026.268) (-2024.086) * (-2017.625) (-2018.344) (-2028.979) [-2014.323] -- 0:02:10
Average standard deviation of split frequencies: 0.011674
720500 -- (-2020.392) [-2019.761] (-2021.323) (-2016.136) * [-2018.095] (-2023.633) (-2017.036) (-2024.570) -- 0:02:10
721000 -- (-2017.664) (-2017.206) (-2018.652) [-2020.536] * (-2018.102) [-2021.796] (-2016.306) (-2014.464) -- 0:02:10
721500 -- (-2029.238) (-2018.693) (-2020.315) [-2021.904] * (-2015.137) (-2017.905) [-2015.593] (-2022.974) -- 0:02:10
722000 -- [-2009.470] (-2028.953) (-2020.243) (-2019.904) * (-2022.407) [-2018.307] (-2017.544) (-2025.111) -- 0:02:09
722500 -- (-2022.224) (-2014.957) (-2017.704) [-2011.462] * (-2018.924) [-2019.813] (-2019.020) (-2026.527) -- 0:02:09
723000 -- [-2016.719] (-2020.212) (-2029.163) (-2016.568) * (-2017.986) (-2027.090) (-2023.604) [-2017.742] -- 0:02:09
723500 -- (-2017.513) [-2013.046] (-2018.098) (-2018.172) * (-2020.149) [-2023.996] (-2024.282) (-2019.480) -- 0:02:08
724000 -- (-2012.227) [-2014.057] (-2026.010) (-2017.796) * (-2022.186) [-2020.398] (-2020.591) (-2020.610) -- 0:02:08
724500 -- [-2013.274] (-2021.166) (-2021.575) (-2029.107) * (-2019.861) [-2015.252] (-2020.723) (-2023.522) -- 0:02:08
725000 -- (-2014.130) [-2016.105] (-2013.226) (-2022.301) * [-2016.949] (-2023.734) (-2018.673) (-2022.965) -- 0:02:08
Average standard deviation of split frequencies: 0.011188
725500 -- (-2015.813) [-2020.848] (-2030.235) (-2021.023) * (-2018.960) [-2015.990] (-2019.099) (-2021.118) -- 0:02:07
726000 -- (-2024.851) [-2011.186] (-2030.856) (-2019.655) * [-2019.213] (-2020.450) (-2017.021) (-2016.125) -- 0:02:07
726500 -- (-2016.692) (-2014.486) (-2023.538) [-2016.915] * (-2021.055) (-2013.218) (-2018.380) [-2011.616] -- 0:02:07
727000 -- (-2012.438) (-2020.685) (-2025.697) [-2018.431] * (-2023.978) (-2022.153) [-2018.380] (-2020.225) -- 0:02:07
727500 -- (-2015.302) (-2020.970) (-2019.186) [-2023.240] * (-2019.971) (-2023.544) [-2016.091] (-2021.828) -- 0:02:06
728000 -- (-2019.694) (-2017.425) (-2024.882) [-2014.759] * (-2017.440) [-2014.375] (-2017.130) (-2027.116) -- 0:02:07
728500 -- (-2029.129) [-2017.510] (-2020.424) (-2016.425) * (-2019.812) (-2017.559) [-2019.086] (-2020.926) -- 0:02:06
729000 -- (-2027.427) (-2019.214) [-2012.902] (-2020.430) * (-2014.126) (-2015.220) (-2027.261) [-2017.416] -- 0:02:06
729500 -- (-2023.808) (-2024.573) [-2015.207] (-2013.115) * [-2013.405] (-2018.860) (-2027.178) (-2014.228) -- 0:02:06
730000 -- (-2020.522) (-2023.903) [-2012.186] (-2022.996) * (-2018.785) (-2027.194) (-2020.985) [-2015.294] -- 0:02:06
Average standard deviation of split frequencies: 0.009624
730500 -- (-2025.972) (-2019.488) (-2019.808) [-2012.787] * [-2018.192] (-2017.369) (-2018.413) (-2013.901) -- 0:02:05
731000 -- [-2024.279] (-2020.789) (-2020.715) (-2021.505) * (-2024.026) (-2014.689) [-2024.033] (-2009.583) -- 0:02:05
731500 -- (-2031.456) (-2020.161) [-2019.211] (-2018.317) * (-2017.030) (-2016.314) (-2022.337) [-2017.920] -- 0:02:05
732000 -- (-2024.270) (-2025.463) (-2015.435) [-2023.719] * (-2014.871) (-2009.969) (-2022.253) [-2019.517] -- 0:02:05
732500 -- (-2028.777) [-2018.638] (-2018.849) (-2023.669) * (-2016.576) [-2015.241] (-2025.237) (-2019.886) -- 0:02:04
733000 -- (-2018.214) [-2020.081] (-2021.716) (-2022.973) * [-2016.980] (-2014.634) (-2034.667) (-2019.827) -- 0:02:04
733500 -- (-2030.255) (-2016.911) [-2018.934] (-2014.008) * (-2018.872) (-2017.736) (-2020.547) [-2014.720] -- 0:02:04
734000 -- (-2016.510) (-2017.658) [-2017.903] (-2019.561) * (-2019.119) [-2012.661] (-2021.982) (-2020.056) -- 0:02:03
734500 -- (-2028.525) (-2019.634) (-2018.872) [-2021.121] * (-2018.644) (-2017.409) [-2021.436] (-2024.423) -- 0:02:03
735000 -- [-2014.760] (-2019.731) (-2021.002) (-2018.134) * (-2016.878) [-2023.522] (-2018.530) (-2021.593) -- 0:02:03
Average standard deviation of split frequencies: 0.009234
735500 -- (-2018.942) (-2023.929) (-2015.712) [-2012.635] * (-2013.789) (-2017.122) (-2023.406) [-2019.460] -- 0:02:03
736000 -- [-2014.718] (-2024.771) (-2019.083) (-2022.932) * (-2019.251) (-2020.883) [-2016.147] (-2023.407) -- 0:02:03
736500 -- (-2023.945) [-2013.248] (-2015.603) (-2018.836) * (-2028.534) (-2020.634) [-2016.840] (-2017.118) -- 0:02:03
737000 -- (-2011.934) (-2021.746) (-2020.009) [-2011.297] * (-2025.860) (-2012.455) (-2020.557) [-2024.757] -- 0:02:02
737500 -- (-2017.135) (-2015.017) [-2019.771] (-2029.684) * (-2022.201) [-2017.974] (-2017.894) (-2021.616) -- 0:02:02
738000 -- (-2022.505) [-2014.619] (-2028.769) (-2020.657) * (-2024.914) (-2022.756) (-2012.154) [-2015.280] -- 0:02:02
738500 -- (-2020.037) (-2011.809) [-2016.260] (-2020.252) * [-2013.253] (-2014.151) (-2016.988) (-2021.751) -- 0:02:02
739000 -- [-2017.702] (-2021.317) (-2014.717) (-2016.365) * [-2021.294] (-2017.599) (-2012.462) (-2020.015) -- 0:02:01
739500 -- [-2012.308] (-2033.308) (-2020.282) (-2015.336) * (-2018.868) (-2018.181) [-2015.830] (-2018.322) -- 0:02:01
740000 -- (-2022.708) (-2024.405) (-2031.706) [-2016.391] * (-2016.761) [-2012.035] (-2022.913) (-2016.783) -- 0:02:01
Average standard deviation of split frequencies: 0.009176
740500 -- (-2023.153) (-2018.192) (-2031.686) [-2015.349] * (-2018.081) (-2013.934) (-2021.480) [-2015.856] -- 0:02:01
741000 -- [-2019.970] (-2022.281) (-2027.911) (-2018.448) * (-2022.588) [-2020.728] (-2016.995) (-2023.761) -- 0:02:00
741500 -- [-2025.043] (-2018.460) (-2025.055) (-2033.146) * (-2016.205) (-2017.393) (-2020.290) [-2020.228] -- 0:02:00
742000 -- [-2024.901] (-2013.181) (-2018.626) (-2022.104) * (-2017.423) (-2027.732) (-2019.031) [-2017.371] -- 0:02:00
742500 -- (-2020.229) (-2020.653) [-2011.176] (-2031.050) * [-2013.805] (-2021.840) (-2015.801) (-2020.162) -- 0:01:59
743000 -- (-2012.045) (-2018.068) (-2024.973) [-2017.353] * (-2018.138) [-2015.173] (-2016.355) (-2018.617) -- 0:02:00
743500 -- (-2032.620) [-2015.401] (-2015.571) (-2025.419) * (-2018.901) (-2021.098) [-2017.447] (-2024.090) -- 0:01:59
744000 -- [-2019.130] (-2015.983) (-2023.108) (-2020.887) * (-2021.392) (-2016.906) (-2020.357) [-2019.457] -- 0:01:59
744500 -- (-2020.614) [-2023.471] (-2018.370) (-2015.504) * (-2024.121) (-2016.540) [-2020.920] (-2025.963) -- 0:01:59
745000 -- (-2017.407) (-2021.965) [-2021.618] (-2024.670) * (-2013.898) [-2015.634] (-2012.980) (-2019.527) -- 0:01:59
Average standard deviation of split frequencies: 0.008952
745500 -- [-2018.579] (-2024.065) (-2021.506) (-2033.361) * (-2019.370) [-2017.175] (-2021.537) (-2021.227) -- 0:01:58
746000 -- [-2018.456] (-2026.593) (-2012.603) (-2022.038) * (-2022.240) (-2016.912) [-2014.266] (-2021.202) -- 0:01:58
746500 -- (-2014.334) (-2019.716) [-2015.010] (-2021.816) * (-2020.811) (-2012.652) (-2015.950) [-2017.173] -- 0:01:58
747000 -- [-2021.532] (-2016.257) (-2020.091) (-2025.207) * (-2022.708) (-2023.852) [-2014.406] (-2019.304) -- 0:01:58
747500 -- (-2014.853) [-2017.625] (-2018.465) (-2020.406) * (-2015.756) (-2024.822) [-2014.744] (-2018.728) -- 0:01:57
748000 -- (-2018.105) (-2015.192) (-2013.220) [-2014.285] * (-2023.297) (-2017.851) (-2020.114) [-2016.538] -- 0:01:57
748500 -- [-2013.985] (-2015.738) (-2017.847) (-2017.991) * (-2020.201) (-2030.502) (-2022.406) [-2023.129] -- 0:01:57
749000 -- (-2023.101) [-2020.794] (-2029.698) (-2014.699) * (-2016.460) (-2028.901) [-2017.396] (-2014.708) -- 0:01:56
749500 -- (-2015.184) (-2025.738) (-2023.876) [-2019.354] * [-2015.591] (-2017.118) (-2020.160) (-2019.119) -- 0:01:56
750000 -- (-2023.694) (-2027.932) (-2020.038) [-2017.754] * (-2020.438) (-2022.852) [-2015.770] (-2011.251) -- 0:01:56
Average standard deviation of split frequencies: 0.008739
750500 -- (-2027.513) (-2017.198) (-2016.948) [-2024.039] * (-2019.365) (-2026.549) (-2015.911) [-2020.014] -- 0:01:56
751000 -- [-2015.020] (-2023.017) (-2021.295) (-2024.049) * [-2018.213] (-2024.410) (-2015.204) (-2023.143) -- 0:01:56
751500 -- (-2023.687) (-2013.225) (-2023.327) [-2019.383] * [-2015.253] (-2019.338) (-2021.758) (-2023.585) -- 0:01:56
752000 -- (-2020.790) [-2017.600] (-2013.097) (-2014.554) * (-2022.292) [-2015.284] (-2017.493) (-2014.322) -- 0:01:55
752500 -- [-2024.197] (-2016.636) (-2017.058) (-2018.454) * [-2020.125] (-2017.493) (-2017.308) (-2019.666) -- 0:01:55
753000 -- (-2022.811) [-2022.381] (-2023.156) (-2013.150) * (-2022.691) [-2013.167] (-2019.844) (-2018.129) -- 0:01:55
753500 -- (-2020.254) [-2016.754] (-2021.897) (-2023.830) * (-2022.695) [-2009.880] (-2026.129) (-2018.128) -- 0:01:55
754000 -- (-2016.759) (-2033.218) (-2025.069) [-2021.316] * (-2014.698) [-2014.489] (-2023.852) (-2016.587) -- 0:01:54
754500 -- (-2016.844) [-2022.811] (-2015.830) (-2016.372) * (-2022.851) (-2018.158) (-2019.575) [-2012.740] -- 0:01:54
755000 -- (-2013.669) [-2017.123] (-2015.158) (-2016.597) * [-2018.226] (-2013.746) (-2029.475) (-2018.014) -- 0:01:54
Average standard deviation of split frequencies: 0.008678
755500 -- (-2021.915) (-2025.126) [-2017.349] (-2018.977) * (-2014.672) [-2015.946] (-2018.123) (-2013.149) -- 0:01:53
756000 -- (-2016.907) [-2028.816] (-2024.144) (-2015.643) * [-2015.408] (-2023.778) (-2015.046) (-2017.522) -- 0:01:53
756500 -- (-2025.860) (-2025.382) [-2017.792] (-2017.171) * (-2018.853) (-2027.203) [-2012.868] (-2014.895) -- 0:01:53
757000 -- (-2028.242) (-2025.273) (-2014.522) [-2011.226] * (-2015.750) (-2015.501) [-2017.441] (-2026.542) -- 0:01:53
757500 -- (-2013.570) [-2020.577] (-2027.203) (-2020.696) * [-2015.475] (-2017.959) (-2017.887) (-2017.874) -- 0:01:53
758000 -- (-2028.463) (-2025.279) (-2021.415) [-2018.145] * (-2019.855) (-2025.976) (-2016.615) [-2016.455] -- 0:01:53
758500 -- (-2019.300) [-2014.123] (-2028.576) (-2016.190) * (-2016.604) [-2015.650] (-2023.870) (-2025.043) -- 0:01:52
759000 -- (-2022.372) (-2015.271) [-2023.227] (-2014.080) * [-2020.028] (-2015.828) (-2015.841) (-2022.028) -- 0:01:52
759500 -- (-2027.353) [-2014.570] (-2023.274) (-2021.435) * (-2020.345) (-2024.601) (-2022.092) [-2022.533] -- 0:01:52
760000 -- (-2020.315) (-2026.880) (-2015.825) [-2018.529] * (-2015.824) (-2016.130) (-2018.437) [-2018.058] -- 0:01:51
Average standard deviation of split frequencies: 0.008831
760500 -- (-2026.478) (-2027.319) (-2017.065) [-2024.905] * (-2021.605) (-2019.392) (-2021.218) [-2018.914] -- 0:01:51
761000 -- (-2023.005) (-2016.639) (-2016.122) [-2016.217] * [-2020.826] (-2018.763) (-2021.020) (-2020.342) -- 0:01:51
761500 -- (-2025.115) (-2022.738) (-2022.032) [-2012.907] * (-2014.433) (-2020.501) (-2018.622) [-2011.890] -- 0:01:51
762000 -- (-2019.707) (-2018.289) (-2014.997) [-2011.996] * [-2022.513] (-2024.770) (-2021.360) (-2015.064) -- 0:01:50
762500 -- [-2018.700] (-2021.226) (-2023.705) (-2013.864) * (-2021.329) (-2022.842) (-2023.855) [-2018.606] -- 0:01:50
763000 -- (-2021.860) (-2012.399) (-2016.816) [-2024.423] * (-2022.336) [-2015.930] (-2013.104) (-2016.325) -- 0:01:50
763500 -- (-2022.545) (-2024.947) [-2016.353] (-2024.245) * (-2016.744) [-2020.089] (-2027.965) (-2015.905) -- 0:01:50
764000 -- (-2018.617) [-2015.458] (-2017.964) (-2018.579) * [-2013.918] (-2017.289) (-2021.884) (-2020.553) -- 0:01:49
764500 -- [-2012.932] (-2021.664) (-2028.181) (-2019.736) * [-2021.521] (-2024.335) (-2025.429) (-2030.122) -- 0:01:49
765000 -- (-2025.251) [-2023.547] (-2016.090) (-2026.377) * [-2017.811] (-2015.976) (-2024.228) (-2022.644) -- 0:01:49
Average standard deviation of split frequencies: 0.008359
765500 -- (-2025.687) (-2020.300) [-2016.359] (-2020.332) * (-2020.652) (-2024.288) (-2027.710) [-2016.888] -- 0:01:49
766000 -- (-2020.105) (-2018.162) (-2020.886) [-2009.864] * (-2017.811) [-2016.063] (-2028.675) (-2018.166) -- 0:01:49
766500 -- (-2013.159) [-2016.982] (-2029.065) (-2022.953) * (-2019.632) (-2024.158) [-2016.759] (-2019.548) -- 0:01:48
767000 -- [-2021.110] (-2018.801) (-2016.601) (-2028.259) * (-2017.693) (-2013.475) [-2024.048] (-2016.674) -- 0:01:48
767500 -- (-2021.508) (-2022.765) (-2027.783) [-2016.428] * [-2017.808] (-2021.653) (-2025.779) (-2030.010) -- 0:01:48
768000 -- (-2023.544) [-2014.120] (-2017.935) (-2024.530) * [-2019.580] (-2022.762) (-2019.626) (-2018.609) -- 0:01:48
768500 -- (-2022.253) [-2016.242] (-2019.368) (-2025.020) * (-2018.394) (-2031.341) (-2017.536) [-2017.338] -- 0:01:47
769000 -- (-2018.375) [-2015.025] (-2025.707) (-2027.495) * (-2021.214) [-2015.677] (-2031.796) (-2017.061) -- 0:01:47
769500 -- (-2019.146) [-2012.534] (-2017.037) (-2024.543) * (-2016.999) (-2015.913) [-2011.723] (-2016.136) -- 0:01:47
770000 -- (-2022.014) (-2022.610) [-2015.428] (-2023.450) * (-2020.467) (-2015.638) [-2014.866] (-2019.339) -- 0:01:47
Average standard deviation of split frequencies: 0.008054
770500 -- (-2031.032) (-2024.052) (-2015.525) [-2015.276] * (-2022.527) (-2023.375) [-2015.447] (-2025.852) -- 0:01:46
771000 -- (-2020.824) (-2019.883) (-2020.027) [-2014.141] * (-2028.261) [-2019.671] (-2019.580) (-2015.851) -- 0:01:46
771500 -- (-2016.478) (-2022.289) (-2024.905) [-2019.606] * (-2014.840) (-2017.824) [-2018.320] (-2016.693) -- 0:01:46
772000 -- (-2016.236) (-2023.259) [-2016.841] (-2018.424) * (-2024.395) [-2016.218] (-2010.626) (-2021.481) -- 0:01:46
772500 -- (-2012.961) (-2019.923) (-2031.321) [-2014.190] * (-2023.840) (-2021.276) (-2023.949) [-2016.622] -- 0:01:46
773000 -- [-2021.639] (-2020.461) (-2022.365) (-2019.671) * [-2020.898] (-2016.776) (-2024.151) (-2014.743) -- 0:01:45
773500 -- (-2033.544) (-2023.007) (-2019.660) [-2017.430] * [-2014.713] (-2022.372) (-2016.837) (-2020.574) -- 0:01:45
774000 -- [-2014.761] (-2023.104) (-2019.589) (-2013.335) * (-2023.240) [-2022.113] (-2021.580) (-2017.452) -- 0:01:45
774500 -- [-2020.008] (-2023.087) (-2019.843) (-2012.275) * (-2022.764) (-2025.387) (-2028.647) [-2019.960] -- 0:01:45
775000 -- (-2019.062) (-2026.792) (-2023.861) [-2010.635] * (-2012.416) (-2021.945) [-2012.646] (-2022.348) -- 0:01:44
Average standard deviation of split frequencies: 0.007897
775500 -- (-2023.012) (-2029.485) [-2028.117] (-2014.483) * [-2012.733] (-2024.092) (-2017.895) (-2016.412) -- 0:01:44
776000 -- (-2031.180) (-2022.374) (-2022.001) [-2013.694] * (-2013.472) (-2018.550) (-2017.827) [-2019.025] -- 0:01:44
776500 -- (-2019.875) (-2017.570) (-2021.421) [-2019.183] * (-2026.252) [-2014.327] (-2018.339) (-2025.618) -- 0:01:44
777000 -- (-2013.638) (-2030.172) [-2016.227] (-2020.771) * (-2022.147) (-2019.249) (-2020.801) [-2020.748] -- 0:01:43
777500 -- (-2018.731) [-2013.063] (-2020.874) (-2019.290) * (-2019.936) (-2015.095) (-2022.652) [-2017.730] -- 0:01:43
778000 -- (-2018.191) (-2024.051) [-2014.891] (-2022.458) * (-2016.719) [-2015.101] (-2025.278) (-2020.790) -- 0:01:43
778500 -- (-2026.502) (-2026.359) [-2017.301] (-2016.326) * (-2021.683) [-2022.115] (-2018.739) (-2019.602) -- 0:01:43
779000 -- (-2028.001) (-2026.436) (-2016.325) [-2019.157] * (-2027.786) (-2017.261) [-2023.216] (-2014.367) -- 0:01:42
779500 -- (-2034.181) (-2017.511) (-2035.271) [-2012.055] * (-2020.798) (-2014.600) [-2017.019] (-2015.673) -- 0:01:42
780000 -- (-2020.430) (-2018.724) [-2019.600] (-2028.548) * (-2022.113) (-2018.048) (-2018.984) [-2019.792] -- 0:01:42
Average standard deviation of split frequencies: 0.007598
780500 -- (-2019.212) (-2019.796) [-2018.469] (-2026.555) * (-2021.673) (-2016.778) [-2019.945] (-2027.637) -- 0:01:42
781000 -- (-2013.796) [-2016.737] (-2014.905) (-2017.203) * [-2018.877] (-2016.986) (-2014.845) (-2015.792) -- 0:01:42
781500 -- (-2015.898) [-2016.503] (-2016.971) (-2020.511) * (-2013.280) (-2020.000) [-2012.267] (-2025.563) -- 0:01:41
782000 -- [-2013.659] (-2019.518) (-2012.528) (-2014.399) * [-2011.411] (-2017.279) (-2016.672) (-2020.379) -- 0:01:41
782500 -- (-2015.923) [-2016.204] (-2015.775) (-2017.217) * [-2016.155] (-2023.658) (-2020.422) (-2019.911) -- 0:01:41
783000 -- (-2021.344) [-2011.699] (-2021.003) (-2019.411) * (-2020.851) [-2023.697] (-2019.147) (-2020.366) -- 0:01:41
783500 -- (-2014.968) (-2011.172) (-2014.312) [-2015.331] * (-2011.684) (-2015.225) (-2014.521) [-2016.696] -- 0:01:40
784000 -- (-2018.115) (-2020.656) (-2017.748) [-2016.240] * [-2016.922] (-2019.761) (-2012.319) (-2011.530) -- 0:01:40
784500 -- [-2019.867] (-2016.129) (-2017.429) (-2026.609) * (-2017.362) [-2016.139] (-2019.230) (-2024.697) -- 0:01:40
785000 -- (-2029.488) (-2016.996) (-2021.393) [-2012.741] * (-2013.941) (-2015.057) (-2026.646) [-2018.211] -- 0:01:40
Average standard deviation of split frequencies: 0.007935
785500 -- (-2020.700) (-2019.084) (-2030.579) [-2021.969] * [-2016.579] (-2017.087) (-2016.719) (-2014.826) -- 0:01:39
786000 -- [-2020.795] (-2026.025) (-2019.467) (-2024.500) * (-2017.564) (-2021.245) [-2021.751] (-2018.753) -- 0:01:39
786500 -- (-2014.860) (-2020.167) (-2019.782) [-2017.147] * (-2015.348) (-2021.226) (-2020.435) [-2021.816] -- 0:01:39
787000 -- (-2015.263) (-2019.850) (-2014.902) [-2020.055] * (-2019.317) (-2018.055) (-2032.170) [-2020.684] -- 0:01:39
787500 -- (-2019.072) (-2023.107) [-2018.386] (-2014.265) * (-2026.478) (-2018.011) [-2019.683] (-2018.262) -- 0:01:39
788000 -- (-2023.069) [-2016.379] (-2027.504) (-2016.231) * (-2020.786) [-2016.244] (-2018.245) (-2028.606) -- 0:01:38
788500 -- (-2015.718) (-2017.042) (-2029.233) [-2015.402] * [-2018.263] (-2030.304) (-2021.694) (-2017.286) -- 0:01:38
789000 -- (-2016.500) [-2022.309] (-2020.157) (-2022.020) * [-2019.140] (-2024.478) (-2014.270) (-2016.719) -- 0:01:38
789500 -- [-2017.268] (-2028.206) (-2016.879) (-2017.011) * (-2022.155) (-2015.972) [-2019.408] (-2022.854) -- 0:01:38
790000 -- [-2013.893] (-2021.232) (-2017.687) (-2023.449) * (-2018.607) (-2024.143) (-2012.012) [-2017.805] -- 0:01:37
Average standard deviation of split frequencies: 0.007552
790500 -- [-2017.296] (-2022.843) (-2015.212) (-2024.466) * (-2017.838) [-2014.280] (-2021.641) (-2019.398) -- 0:01:37
791000 -- (-2027.258) [-2015.030] (-2013.669) (-2024.629) * (-2014.596) [-2019.807] (-2015.745) (-2019.136) -- 0:01:37
791500 -- [-2014.198] (-2017.971) (-2014.714) (-2016.815) * (-2015.628) (-2017.531) (-2013.687) [-2012.800] -- 0:01:37
792000 -- [-2015.231] (-2016.390) (-2013.486) (-2016.788) * (-2022.776) (-2016.524) [-2015.868] (-2035.836) -- 0:01:36
792500 -- (-2018.580) (-2010.877) [-2016.203] (-2025.823) * [-2020.644] (-2021.750) (-2021.518) (-2020.712) -- 0:01:36
793000 -- (-2020.798) (-2010.638) (-2023.993) [-2015.611] * (-2022.739) [-2017.655] (-2021.535) (-2034.582) -- 0:01:36
793500 -- (-2023.986) (-2018.468) [-2019.944] (-2021.398) * (-2013.965) (-2023.080) [-2016.366] (-2024.570) -- 0:01:36
794000 -- (-2022.603) (-2012.842) (-2016.013) [-2019.100] * (-2022.864) (-2025.422) (-2015.060) [-2016.598] -- 0:01:35
794500 -- (-2022.632) (-2023.205) [-2011.797] (-2017.797) * (-2014.876) (-2012.022) (-2024.226) [-2014.703] -- 0:01:35
795000 -- (-2031.931) [-2019.965] (-2014.268) (-2016.504) * (-2021.434) (-2019.498) [-2015.130] (-2022.809) -- 0:01:35
Average standard deviation of split frequencies: 0.008044
795500 -- [-2020.247] (-2017.100) (-2021.122) (-2029.784) * (-2025.179) (-2016.500) (-2016.184) [-2010.268] -- 0:01:35
796000 -- (-2023.197) (-2015.586) [-2016.192] (-2018.941) * (-2016.296) [-2021.390] (-2014.453) (-2017.475) -- 0:01:35
796500 -- (-2023.338) (-2020.707) [-2013.629] (-2021.312) * (-2032.733) (-2019.626) [-2019.380] (-2014.636) -- 0:01:34
797000 -- (-2022.554) (-2023.067) (-2015.767) [-2012.431] * (-2022.078) (-2023.430) (-2022.117) [-2010.798] -- 0:01:34
797500 -- (-2031.165) (-2020.570) [-2028.296] (-2013.580) * [-2016.639] (-2018.131) (-2015.434) (-2013.663) -- 0:01:34
798000 -- (-2018.218) (-2022.320) [-2025.364] (-2017.044) * (-2013.166) (-2011.567) (-2010.124) [-2018.340] -- 0:01:34
798500 -- (-2023.842) (-2030.622) (-2017.554) [-2017.621] * (-2014.687) (-2016.760) [-2014.029] (-2015.267) -- 0:01:33
799000 -- (-2020.121) (-2023.648) (-2020.139) [-2014.350] * (-2026.261) [-2017.794] (-2026.029) (-2016.011) -- 0:01:33
799500 -- (-2018.659) (-2025.252) [-2012.519] (-2023.930) * [-2028.413] (-2027.227) (-2022.998) (-2016.100) -- 0:01:33
800000 -- [-2012.264] (-2018.329) (-2017.338) (-2017.383) * [-2022.615] (-2019.463) (-2018.209) (-2017.163) -- 0:01:33
Average standard deviation of split frequencies: 0.007654
800500 -- (-2025.880) [-2019.557] (-2026.374) (-2020.969) * (-2018.628) [-2019.440] (-2026.976) (-2016.406) -- 0:01:32
801000 -- (-2023.285) (-2029.247) (-2014.518) [-2021.658] * [-2017.790] (-2019.986) (-2027.642) (-2019.726) -- 0:01:32
801500 -- (-2024.492) (-2029.282) [-2009.561] (-2017.805) * (-2022.501) (-2018.528) (-2017.891) [-2018.741] -- 0:01:32
802000 -- [-2022.517] (-2023.153) (-2017.365) (-2028.167) * [-2016.615] (-2021.644) (-2020.970) (-2024.311) -- 0:01:32
802500 -- (-2013.423) (-2022.756) [-2018.509] (-2022.386) * (-2022.484) [-2019.160] (-2032.425) (-2023.994) -- 0:01:32
803000 -- (-2022.056) (-2019.545) [-2016.626] (-2016.661) * (-2023.642) (-2030.247) [-2025.522] (-2012.776) -- 0:01:31
803500 -- [-2012.078] (-2024.538) (-2023.058) (-2023.151) * (-2022.181) (-2022.982) [-2017.686] (-2018.554) -- 0:01:31
804000 -- [-2013.736] (-2020.993) (-2024.100) (-2023.271) * (-2018.787) (-2018.957) [-2019.337] (-2027.779) -- 0:01:31
804500 -- [-2020.833] (-2012.240) (-2020.202) (-2020.526) * (-2022.726) (-2018.948) (-2020.260) [-2020.890] -- 0:01:31
805000 -- [-2018.918] (-2014.481) (-2021.039) (-2020.763) * (-2022.504) [-2012.867] (-2024.394) (-2028.115) -- 0:01:30
Average standard deviation of split frequencies: 0.008368
805500 -- (-2024.002) (-2018.300) (-2019.136) [-2015.106] * (-2016.716) (-2022.472) (-2026.925) [-2016.745] -- 0:01:30
806000 -- (-2024.253) (-2021.531) (-2030.156) [-2025.797] * (-2027.207) (-2021.170) [-2028.776] (-2015.155) -- 0:01:30
806500 -- (-2015.678) (-2013.995) [-2018.203] (-2021.000) * (-2014.065) [-2016.698] (-2021.832) (-2013.623) -- 0:01:30
807000 -- (-2023.321) [-2010.211] (-2019.194) (-2019.883) * [-2020.702] (-2025.762) (-2019.379) (-2026.535) -- 0:01:29
807500 -- [-2016.550] (-2015.321) (-2025.514) (-2018.844) * (-2028.678) [-2020.806] (-2021.618) (-2019.957) -- 0:01:29
808000 -- (-2014.531) [-2019.406] (-2025.059) (-2016.075) * (-2017.719) (-2025.351) (-2016.195) [-2013.804] -- 0:01:29
808500 -- (-2018.680) [-2020.665] (-2021.567) (-2020.854) * (-2019.496) (-2025.063) [-2019.521] (-2014.565) -- 0:01:29
809000 -- (-2020.069) [-2016.031] (-2021.951) (-2017.269) * (-2031.531) (-2027.459) [-2020.500] (-2015.338) -- 0:01:29
809500 -- [-2008.740] (-2027.547) (-2021.956) (-2016.842) * (-2010.396) (-2026.328) [-2018.384] (-2024.168) -- 0:01:28
810000 -- [-2019.084] (-2019.176) (-2022.808) (-2012.224) * (-2022.593) (-2021.395) [-2019.897] (-2018.538) -- 0:01:28
Average standard deviation of split frequencies: 0.008767
810500 -- (-2020.041) (-2024.992) [-2022.078] (-2018.367) * [-2016.576] (-2029.569) (-2018.505) (-2019.919) -- 0:01:28
811000 -- (-2026.339) (-2020.479) [-2013.903] (-2021.231) * (-2026.149) [-2023.125] (-2019.411) (-2021.824) -- 0:01:28
811500 -- (-2026.292) (-2022.563) [-2019.143] (-2013.830) * (-2023.205) (-2023.248) (-2018.305) [-2022.495] -- 0:01:27
812000 -- (-2020.144) (-2030.505) [-2020.397] (-2022.137) * (-2021.694) (-2017.326) (-2017.191) [-2026.828] -- 0:01:27
812500 -- (-2013.344) (-2016.877) [-2013.305] (-2030.387) * (-2022.005) (-2022.778) (-2019.807) [-2021.235] -- 0:01:27
813000 -- [-2019.214] (-2022.826) (-2019.279) (-2021.092) * (-2011.573) [-2020.139] (-2015.539) (-2036.308) -- 0:01:27
813500 -- [-2015.153] (-2019.800) (-2019.353) (-2027.311) * (-2019.714) [-2019.673] (-2019.635) (-2018.902) -- 0:01:26
814000 -- [-2014.324] (-2014.677) (-2019.326) (-2019.322) * (-2023.948) (-2022.777) (-2015.746) [-2017.338] -- 0:01:26
814500 -- (-2016.142) (-2016.046) (-2032.097) [-2024.342] * (-2028.641) (-2026.991) [-2014.206] (-2015.694) -- 0:01:26
815000 -- (-2023.178) (-2023.251) [-2010.561] (-2015.527) * [-2023.003] (-2027.210) (-2022.213) (-2018.529) -- 0:01:26
Average standard deviation of split frequencies: 0.008666
815500 -- [-2015.611] (-2030.510) (-2017.440) (-2025.596) * (-2021.657) (-2018.844) (-2016.237) [-2016.754] -- 0:01:25
816000 -- (-2019.525) (-2015.196) [-2016.820] (-2011.156) * (-2019.185) (-2019.402) (-2019.437) [-2019.549] -- 0:01:25
816500 -- (-2016.899) [-2020.710] (-2014.495) (-2014.662) * (-2019.021) [-2019.726] (-2022.972) (-2016.304) -- 0:01:25
817000 -- [-2020.937] (-2017.344) (-2020.572) (-2014.178) * (-2016.719) (-2014.109) (-2019.741) [-2011.723] -- 0:01:25
817500 -- (-2022.989) (-2020.382) (-2015.378) [-2015.534] * [-2010.791] (-2020.863) (-2033.116) (-2020.914) -- 0:01:25
818000 -- [-2014.551] (-2022.121) (-2023.351) (-2012.705) * (-2024.814) (-2013.892) (-2028.981) [-2015.637] -- 0:01:24
818500 -- [-2020.252] (-2019.161) (-2021.015) (-2017.558) * (-2016.088) [-2018.969] (-2026.687) (-2025.852) -- 0:01:24
819000 -- (-2017.890) (-2023.115) [-2020.225] (-2021.834) * (-2024.686) (-2013.054) (-2020.944) [-2015.708] -- 0:01:24
819500 -- (-2016.804) (-2023.218) (-2027.319) [-2014.914] * (-2027.714) (-2010.913) (-2020.133) [-2022.574] -- 0:01:24
820000 -- (-2016.009) (-2027.002) [-2024.923] (-2033.430) * (-2025.979) [-2009.583] (-2027.607) (-2025.655) -- 0:01:23
Average standard deviation of split frequencies: 0.008281
820500 -- (-2017.645) (-2022.553) [-2017.918] (-2015.860) * (-2020.519) (-2015.597) [-2018.844] (-2027.919) -- 0:01:23
821000 -- [-2016.145] (-2020.336) (-2021.701) (-2023.725) * [-2018.397] (-2017.336) (-2022.883) (-2019.072) -- 0:01:23
821500 -- (-2021.113) (-2020.878) (-2014.690) [-2016.960] * [-2022.525] (-2018.833) (-2019.117) (-2022.173) -- 0:01:23
822000 -- (-2025.970) (-2020.914) [-2022.338] (-2012.130) * (-2015.456) (-2028.418) [-2015.825] (-2025.187) -- 0:01:22
822500 -- [-2010.945] (-2019.409) (-2019.528) (-2018.538) * (-2014.839) (-2014.061) (-2031.307) [-2013.974] -- 0:01:22
823000 -- (-2015.005) (-2015.318) [-2019.694] (-2019.085) * (-2012.305) [-2017.114] (-2022.443) (-2019.016) -- 0:01:22
823500 -- (-2019.526) (-2018.843) [-2015.581] (-2016.334) * (-2024.065) [-2023.490] (-2018.241) (-2024.500) -- 0:01:22
824000 -- [-2014.494] (-2027.127) (-2017.725) (-2014.794) * (-2017.136) [-2012.922] (-2022.823) (-2019.380) -- 0:01:22
824500 -- [-2014.852] (-2017.279) (-2015.908) (-2021.922) * (-2034.441) (-2017.080) (-2013.810) [-2017.539] -- 0:01:21
825000 -- [-2018.808] (-2025.651) (-2020.798) (-2014.196) * (-2019.103) (-2016.057) [-2018.284] (-2022.559) -- 0:01:21
Average standard deviation of split frequencies: 0.008085
825500 -- (-2029.331) (-2014.030) [-2013.773] (-2023.132) * (-2016.217) (-2022.975) [-2015.055] (-2025.766) -- 0:01:21
826000 -- (-2021.036) [-2019.243] (-2022.906) (-2017.544) * (-2023.809) (-2016.045) [-2022.944] (-2019.911) -- 0:01:21
826500 -- [-2011.919] (-2020.594) (-2017.723) (-2014.721) * (-2021.122) (-2027.200) [-2021.732] (-2013.838) -- 0:01:20
827000 -- [-2013.277] (-2018.716) (-2019.528) (-2028.725) * (-2025.085) [-2023.047] (-2020.266) (-2018.857) -- 0:01:20
827500 -- [-2015.365] (-2018.749) (-2015.997) (-2024.246) * (-2022.244) [-2022.712] (-2027.436) (-2018.093) -- 0:01:20
828000 -- (-2017.013) [-2019.155] (-2020.465) (-2034.128) * (-2026.143) (-2017.888) (-2027.936) [-2011.358] -- 0:01:20
828500 -- (-2017.342) [-2016.222] (-2024.958) (-2017.813) * (-2024.134) (-2016.006) (-2022.815) [-2013.597] -- 0:01:19
829000 -- (-2018.583) [-2015.342] (-2016.875) (-2021.146) * (-2016.974) (-2029.070) (-2019.106) [-2015.785] -- 0:01:19
829500 -- (-2023.629) [-2024.820] (-2028.611) (-2020.788) * (-2019.225) [-2013.875] (-2021.565) (-2019.786) -- 0:01:19
830000 -- (-2019.716) (-2019.340) (-2020.147) [-2018.709] * [-2010.978] (-2016.503) (-2021.464) (-2020.129) -- 0:01:19
Average standard deviation of split frequencies: 0.008276
830500 -- [-2016.585] (-2015.342) (-2016.814) (-2020.702) * [-2024.047] (-2016.278) (-2017.986) (-2019.505) -- 0:01:18
831000 -- (-2010.651) [-2019.113] (-2016.075) (-2020.721) * [-2015.419] (-2019.905) (-2017.495) (-2016.405) -- 0:01:18
831500 -- (-2026.016) [-2017.146] (-2011.406) (-2018.876) * (-2017.514) (-2024.812) [-2016.821] (-2021.853) -- 0:01:18
832000 -- (-2013.528) [-2018.039] (-2024.985) (-2014.171) * (-2019.183) (-2021.014) (-2018.592) [-2022.065] -- 0:01:18
832500 -- (-2018.790) (-2021.714) [-2012.639] (-2018.915) * [-2017.904] (-2018.955) (-2019.964) (-2023.328) -- 0:01:18
833000 -- (-2014.049) (-2026.451) [-2013.893] (-2016.953) * (-2014.693) [-2019.700] (-2010.784) (-2020.486) -- 0:01:17
833500 -- (-2019.273) (-2020.856) (-2016.031) [-2014.427] * [-2021.116] (-2018.728) (-2021.376) (-2015.196) -- 0:01:17
834000 -- (-2031.107) (-2020.284) (-2020.847) [-2020.943] * [-2011.983] (-2015.295) (-2017.399) (-2018.550) -- 0:01:17
834500 -- (-2018.018) (-2020.999) [-2015.868] (-2020.029) * (-2020.022) (-2019.787) [-2016.069] (-2028.659) -- 0:01:17
835000 -- (-2021.351) (-2017.054) (-2015.421) [-2021.437] * [-2020.735] (-2020.188) (-2028.631) (-2022.409) -- 0:01:16
Average standard deviation of split frequencies: 0.008505
835500 -- [-2018.012] (-2026.833) (-2013.574) (-2029.957) * (-2022.118) (-2025.049) [-2016.065] (-2017.767) -- 0:01:16
836000 -- (-2020.335) (-2020.843) [-2021.514] (-2019.258) * (-2022.329) [-2010.895] (-2021.030) (-2027.169) -- 0:01:16
836500 -- [-2015.653] (-2018.481) (-2021.982) (-2021.338) * [-2020.742] (-2018.978) (-2018.572) (-2019.333) -- 0:01:16
837000 -- (-2011.816) (-2016.966) (-2018.672) [-2018.298] * [-2014.241] (-2016.144) (-2022.477) (-2027.032) -- 0:01:15
837500 -- (-2018.651) [-2015.617] (-2024.909) (-2019.775) * (-2026.721) (-2013.341) [-2018.941] (-2020.066) -- 0:01:15
838000 -- [-2011.336] (-2013.861) (-2036.467) (-2020.344) * (-2024.425) (-2017.509) (-2013.970) [-2016.077] -- 0:01:15
838500 -- (-2020.252) (-2027.539) (-2027.224) [-2021.441] * (-2026.057) [-2018.511] (-2024.488) (-2022.264) -- 0:01:15
839000 -- (-2022.019) (-2021.648) [-2013.462] (-2019.996) * [-2017.427] (-2013.077) (-2024.846) (-2017.900) -- 0:01:15
839500 -- [-2019.435] (-2022.365) (-2020.352) (-2024.526) * (-2020.902) [-2020.364] (-2019.926) (-2025.544) -- 0:01:14
840000 -- [-2013.437] (-2020.660) (-2016.461) (-2020.338) * (-2016.206) [-2020.691] (-2015.343) (-2015.611) -- 0:01:14
Average standard deviation of split frequencies: 0.008738
840500 -- (-2017.117) [-2023.166] (-2025.730) (-2021.676) * [-2010.964] (-2017.793) (-2021.193) (-2024.001) -- 0:01:14
841000 -- [-2013.576] (-2012.681) (-2026.897) (-2026.386) * (-2013.408) (-2020.943) [-2018.097] (-2022.589) -- 0:01:14
841500 -- [-2021.759] (-2016.564) (-2027.133) (-2022.838) * (-2012.056) [-2019.481] (-2014.542) (-2022.598) -- 0:01:13
842000 -- (-2018.637) (-2018.942) [-2022.766] (-2014.073) * (-2017.396) [-2012.578] (-2013.923) (-2031.341) -- 0:01:13
842500 -- (-2010.839) (-2020.890) [-2018.136] (-2018.568) * (-2018.405) (-2020.192) [-2013.123] (-2012.298) -- 0:01:13
843000 -- (-2015.866) [-2014.492] (-2025.444) (-2017.044) * (-2021.181) [-2020.536] (-2022.868) (-2014.874) -- 0:01:13
843500 -- (-2016.938) [-2009.253] (-2025.956) (-2015.695) * (-2014.851) (-2024.880) (-2023.251) [-2015.134] -- 0:01:12
844000 -- (-2015.496) [-2014.241] (-2028.510) (-2015.199) * (-2011.104) (-2018.065) [-2017.286] (-2023.123) -- 0:01:12
844500 -- [-2016.099] (-2017.071) (-2015.758) (-2020.528) * [-2012.637] (-2018.254) (-2027.402) (-2015.890) -- 0:01:12
845000 -- (-2012.798) [-2014.529] (-2016.858) (-2017.555) * [-2016.956] (-2024.567) (-2025.979) (-2023.319) -- 0:01:12
Average standard deviation of split frequencies: 0.008776
845500 -- [-2014.319] (-2016.620) (-2025.112) (-2015.013) * (-2023.855) [-2013.117] (-2036.323) (-2026.368) -- 0:01:11
846000 -- [-2013.623] (-2022.774) (-2018.509) (-2019.476) * (-2015.572) (-2019.332) (-2023.155) [-2014.774] -- 0:01:11
846500 -- (-2017.673) (-2021.019) (-2016.881) [-2015.924] * (-2029.074) [-2018.270] (-2018.288) (-2022.421) -- 0:01:11
847000 -- (-2025.198) (-2027.584) (-2014.641) [-2014.600] * (-2020.894) (-2022.408) (-2024.514) [-2014.180] -- 0:01:11
847500 -- (-2017.914) [-2020.135] (-2020.227) (-2025.421) * (-2023.718) (-2022.489) (-2024.828) [-2019.373] -- 0:01:11
848000 -- (-2021.554) (-2020.876) (-2013.419) [-2013.486] * (-2025.034) (-2018.374) [-2018.305] (-2029.895) -- 0:01:10
848500 -- (-2019.627) [-2020.653] (-2020.223) (-2021.975) * (-2022.943) (-2027.909) (-2023.870) [-2017.634] -- 0:01:10
849000 -- (-2017.513) [-2016.904] (-2019.481) (-2016.029) * (-2023.970) (-2015.841) (-2019.948) [-2009.075] -- 0:01:10
849500 -- (-2014.990) (-2033.428) (-2020.101) [-2013.140] * (-2023.085) (-2021.229) [-2014.507] (-2017.974) -- 0:01:10
850000 -- (-2020.322) [-2019.878] (-2024.797) (-2020.742) * (-2019.825) (-2026.358) [-2019.040] (-2024.754) -- 0:01:09
Average standard deviation of split frequencies: 0.009005
850500 -- [-2015.075] (-2023.598) (-2017.625) (-2018.220) * (-2019.378) [-2015.654] (-2019.340) (-2018.978) -- 0:01:09
851000 -- (-2022.525) (-2018.381) (-2018.603) [-2025.526] * (-2025.850) (-2013.029) [-2017.012] (-2027.435) -- 0:01:09
851500 -- [-2016.780] (-2029.072) (-2017.812) (-2019.113) * (-2024.016) (-2032.835) (-2016.807) [-2014.105] -- 0:01:09
852000 -- (-2023.615) (-2016.702) (-2021.595) [-2016.758] * (-2028.638) (-2018.498) [-2018.626] (-2014.063) -- 0:01:08
852500 -- (-2029.676) [-2019.402] (-2016.954) (-2016.749) * (-2028.299) (-2023.313) (-2018.149) [-2017.284] -- 0:01:08
853000 -- (-2019.981) (-2016.433) (-2020.544) [-2012.525] * (-2018.242) (-2022.984) [-2020.138] (-2014.570) -- 0:01:08
853500 -- (-2020.780) (-2020.827) (-2020.168) [-2017.363] * (-2020.131) [-2019.971] (-2021.438) (-2017.106) -- 0:01:08
854000 -- (-2018.149) (-2021.540) (-2018.741) [-2015.205] * (-2015.670) (-2016.670) [-2013.564] (-2021.914) -- 0:01:08
854500 -- (-2017.215) (-2019.563) (-2030.459) [-2013.960] * (-2014.271) (-2021.229) [-2019.388] (-2020.362) -- 0:01:07
855000 -- (-2016.885) [-2015.927] (-2020.116) (-2026.694) * (-2013.617) (-2016.643) [-2016.288] (-2018.747) -- 0:01:07
Average standard deviation of split frequencies: 0.008857
855500 -- [-2014.901] (-2015.814) (-2019.612) (-2020.783) * (-2029.814) (-2017.841) [-2025.050] (-2019.301) -- 0:01:07
856000 -- (-2016.962) (-2020.974) [-2012.560] (-2019.078) * (-2020.621) (-2021.301) (-2024.752) [-2016.326] -- 0:01:07
856500 -- (-2024.709) [-2019.876] (-2015.847) (-2019.746) * (-2026.148) (-2022.511) (-2022.775) [-2013.653] -- 0:01:06
857000 -- (-2019.382) (-2015.835) [-2016.487] (-2018.468) * (-2017.645) (-2024.212) (-2018.177) [-2022.745] -- 0:01:06
857500 -- (-2017.097) (-2025.110) (-2028.179) [-2019.420] * (-2015.883) [-2020.047] (-2017.721) (-2016.562) -- 0:01:06
858000 -- (-2026.739) [-2012.126] (-2018.085) (-2024.271) * (-2017.385) (-2013.819) (-2023.273) [-2016.529] -- 0:01:06
858500 -- (-2012.705) (-2017.912) (-2021.082) [-2025.544] * (-2019.092) (-2025.036) [-2013.329] (-2023.722) -- 0:01:05
859000 -- (-2020.911) [-2013.580] (-2014.878) (-2024.370) * (-2018.406) (-2023.911) (-2018.169) [-2019.236] -- 0:01:05
859500 -- (-2021.848) (-2018.921) [-2019.442] (-2022.528) * (-2020.813) (-2019.815) [-2017.232] (-2021.459) -- 0:01:05
860000 -- (-2012.419) (-2019.015) (-2019.680) [-2021.680] * (-2014.972) (-2025.915) [-2021.350] (-2025.650) -- 0:01:05
Average standard deviation of split frequencies: 0.008855
860500 -- (-2028.110) (-2022.872) (-2020.139) [-2017.023] * (-2020.961) (-2015.085) [-2018.202] (-2028.741) -- 0:01:05
861000 -- (-2017.195) [-2016.663] (-2015.164) (-2021.985) * (-2029.148) (-2029.463) (-2022.101) [-2014.748] -- 0:01:04
861500 -- (-2029.630) [-2012.088] (-2013.707) (-2021.694) * [-2013.921] (-2024.123) (-2021.366) (-2020.941) -- 0:01:04
862000 -- (-2023.495) (-2019.266) (-2021.520) [-2017.472] * (-2025.036) (-2018.678) (-2024.235) [-2012.070] -- 0:01:04
862500 -- [-2022.091] (-2015.462) (-2029.334) (-2019.732) * (-2030.800) [-2017.168] (-2014.563) (-2018.331) -- 0:01:04
863000 -- (-2019.368) [-2015.764] (-2021.300) (-2011.032) * (-2021.993) (-2022.081) [-2016.583] (-2018.819) -- 0:01:03
863500 -- (-2016.206) [-2026.827] (-2019.629) (-2026.002) * (-2016.909) [-2014.908] (-2022.411) (-2017.363) -- 0:01:03
864000 -- (-2023.862) (-2022.349) [-2018.797] (-2013.546) * (-2022.423) (-2025.628) (-2021.609) [-2014.056] -- 0:01:03
864500 -- [-2014.547] (-2024.040) (-2020.130) (-2021.401) * (-2014.064) (-2017.525) (-2014.135) [-2016.630] -- 0:01:03
865000 -- (-2027.348) (-2016.310) (-2029.813) [-2015.416] * (-2026.700) (-2020.245) (-2013.364) [-2015.891] -- 0:01:02
Average standard deviation of split frequencies: 0.008710
865500 -- (-2016.032) [-2017.627] (-2022.589) (-2018.220) * [-2021.686] (-2015.300) (-2025.614) (-2013.742) -- 0:01:02
866000 -- [-2023.820] (-2014.016) (-2022.767) (-2018.727) * [-2015.031] (-2013.944) (-2018.403) (-2014.202) -- 0:01:02
866500 -- (-2021.866) (-2019.322) (-2024.437) [-2018.002] * (-2017.507) [-2013.705] (-2021.031) (-2021.835) -- 0:01:02
867000 -- (-2029.738) (-2019.664) [-2016.506] (-2027.294) * (-2017.772) [-2017.415] (-2022.053) (-2013.801) -- 0:01:01
867500 -- (-2024.549) (-2019.587) [-2017.026] (-2020.870) * (-2024.963) [-2019.468] (-2024.269) (-2028.950) -- 0:01:01
868000 -- (-2023.903) (-2015.643) (-2024.564) [-2016.306] * (-2022.195) (-2020.584) (-2019.673) [-2012.783] -- 0:01:01
868500 -- (-2020.593) [-2010.293] (-2019.143) (-2017.954) * [-2021.090] (-2026.581) (-2023.476) (-2015.869) -- 0:01:01
869000 -- [-2015.534] (-2012.607) (-2033.082) (-2021.587) * (-2021.805) [-2013.011] (-2017.495) (-2013.953) -- 0:01:01
869500 -- [-2013.601] (-2021.474) (-2025.127) (-2016.090) * (-2023.283) [-2011.982] (-2016.978) (-2016.628) -- 0:01:00
870000 -- (-2018.668) (-2022.958) (-2030.560) [-2019.298] * (-2025.300) [-2014.863] (-2020.045) (-2019.862) -- 0:01:00
Average standard deviation of split frequencies: 0.008708
870500 -- (-2019.238) (-2015.102) (-2026.410) [-2019.222] * [-2022.568] (-2016.489) (-2031.870) (-2017.228) -- 0:01:00
871000 -- (-2031.484) (-2016.205) [-2020.923] (-2016.778) * (-2018.283) [-2014.667] (-2020.922) (-2023.939) -- 0:00:59
871500 -- (-2015.881) [-2014.672] (-2013.215) (-2013.968) * (-2020.518) [-2016.292] (-2032.531) (-2019.788) -- 0:00:59
872000 -- (-2020.170) (-2024.259) [-2015.743] (-2016.851) * (-2018.324) [-2026.671] (-2029.816) (-2018.201) -- 0:00:59
872500 -- (-2018.895) [-2020.246] (-2023.451) (-2028.489) * (-2019.974) (-2022.717) [-2012.584] (-2021.009) -- 0:00:59
873000 -- (-2011.679) [-2020.090] (-2018.091) (-2031.765) * (-2027.430) (-2018.668) (-2021.420) [-2017.617] -- 0:00:59
873500 -- (-2010.975) (-2023.223) [-2027.642] (-2036.928) * (-2017.397) (-2015.312) [-2018.687] (-2017.846) -- 0:00:58
874000 -- [-2014.511] (-2017.407) (-2014.698) (-2020.279) * (-2024.502) (-2018.253) (-2015.699) [-2014.923] -- 0:00:58
874500 -- (-2020.951) (-2023.708) (-2020.747) [-2017.977] * (-2016.958) [-2015.812] (-2022.298) (-2019.849) -- 0:00:58
875000 -- (-2025.425) (-2030.438) (-2017.582) [-2009.212] * (-2016.853) (-2014.010) [-2015.120] (-2020.620) -- 0:00:58
Average standard deviation of split frequencies: 0.008386
875500 -- (-2021.487) (-2019.390) [-2010.517] (-2014.643) * (-2021.752) (-2019.906) (-2013.453) [-2015.297] -- 0:00:58
876000 -- (-2018.701) (-2020.509) (-2018.161) [-2012.790] * (-2021.852) (-2020.436) (-2020.709) [-2013.661] -- 0:00:57
876500 -- (-2017.492) (-2017.958) [-2016.598] (-2023.324) * (-2026.251) (-2017.192) [-2022.507] (-2021.473) -- 0:00:57
877000 -- (-2024.547) [-2016.240] (-2017.284) (-2015.433) * (-2018.675) [-2014.695] (-2021.924) (-2016.650) -- 0:00:57
877500 -- (-2016.316) [-2015.385] (-2021.224) (-2014.912) * [-2021.530] (-2020.590) (-2021.961) (-2022.287) -- 0:00:57
878000 -- (-2022.752) (-2013.282) (-2022.510) [-2013.852] * (-2017.658) (-2019.288) [-2018.223] (-2016.133) -- 0:00:56
878500 -- (-2012.379) [-2016.924] (-2017.371) (-2015.182) * [-2010.968] (-2020.668) (-2016.974) (-2021.903) -- 0:00:56
879000 -- [-2011.403] (-2024.033) (-2025.141) (-2020.739) * (-2021.635) (-2019.533) (-2025.639) [-2024.264] -- 0:00:56
879500 -- (-2025.641) (-2020.981) (-2019.761) [-2018.683] * (-2017.325) (-2018.438) [-2021.850] (-2022.318) -- 0:00:56
880000 -- [-2021.180] (-2020.872) (-2020.831) (-2017.388) * (-2024.528) (-2019.069) [-2016.926] (-2023.291) -- 0:00:55
Average standard deviation of split frequencies: 0.008877
880500 -- (-2019.060) (-2013.670) (-2022.776) [-2013.052] * [-2019.243] (-2018.545) (-2016.273) (-2024.639) -- 0:00:55
881000 -- (-2019.269) [-2011.459] (-2017.424) (-2024.198) * (-2019.832) (-2019.934) (-2032.962) [-2019.746] -- 0:00:55
881500 -- (-2024.456) (-2019.669) [-2014.739] (-2023.355) * (-2023.509) (-2014.658) (-2023.504) [-2016.060] -- 0:00:55
882000 -- (-2023.339) (-2017.693) [-2012.995] (-2016.377) * (-2018.877) [-2012.406] (-2022.002) (-2017.257) -- 0:00:54
882500 -- (-2016.313) [-2020.976] (-2021.628) (-2019.904) * [-2015.798] (-2034.754) (-2015.775) (-2025.642) -- 0:00:54
883000 -- (-2011.452) (-2019.695) [-2018.108] (-2022.158) * (-2014.182) (-2023.675) [-2022.085] (-2024.464) -- 0:00:54
883500 -- [-2020.186] (-2024.942) (-2022.714) (-2022.000) * (-2021.813) [-2014.490] (-2014.858) (-2024.146) -- 0:00:54
884000 -- [-2010.423] (-2027.386) (-2030.092) (-2019.306) * (-2019.510) (-2026.737) [-2018.216] (-2022.319) -- 0:00:53
884500 -- (-2019.339) (-2015.643) (-2027.090) [-2017.188] * [-2019.530] (-2016.250) (-2025.097) (-2023.354) -- 0:00:53
885000 -- (-2014.749) (-2018.944) (-2028.280) [-2009.438] * [-2018.091] (-2014.215) (-2026.157) (-2020.351) -- 0:00:53
Average standard deviation of split frequencies: 0.008868
885500 -- (-2019.738) [-2011.054] (-2029.229) (-2011.175) * (-2015.457) [-2018.730] (-2024.977) (-2022.280) -- 0:00:53
886000 -- (-2014.650) [-2015.257] (-2022.945) (-2019.134) * [-2016.044] (-2022.934) (-2018.658) (-2019.721) -- 0:00:53
886500 -- (-2016.393) (-2015.987) (-2017.478) [-2011.868] * (-2025.435) (-2017.508) (-2021.413) [-2012.061] -- 0:00:52
887000 -- [-2015.254] (-2022.328) (-2018.805) (-2016.215) * (-2024.610) [-2020.496] (-2016.080) (-2019.727) -- 0:00:52
887500 -- [-2010.424] (-2022.746) (-2019.840) (-2018.649) * (-2017.692) (-2017.415) (-2019.485) [-2017.903] -- 0:00:52
888000 -- (-2019.873) (-2016.833) (-2029.565) [-2012.971] * (-2020.036) (-2029.243) [-2017.105] (-2024.303) -- 0:00:52
888500 -- (-2027.929) (-2020.295) [-2016.109] (-2021.394) * (-2027.945) (-2019.967) [-2022.189] (-2013.850) -- 0:00:51
889000 -- (-2018.534) (-2021.675) [-2014.246] (-2010.877) * (-2016.838) (-2026.312) (-2018.622) [-2013.837] -- 0:00:51
889500 -- (-2016.346) [-2020.236] (-2017.126) (-2019.519) * (-2015.272) (-2015.945) [-2016.539] (-2022.606) -- 0:00:51
890000 -- (-2014.898) [-2015.042] (-2013.554) (-2020.775) * [-2012.771] (-2018.895) (-2025.616) (-2019.636) -- 0:00:51
Average standard deviation of split frequencies: 0.008424
890500 -- (-2021.101) (-2017.435) (-2018.509) [-2012.512] * (-2018.141) [-2016.937] (-2017.195) (-2015.636) -- 0:00:50
891000 -- (-2015.403) [-2014.203] (-2014.780) (-2020.616) * [-2018.724] (-2021.295) (-2023.757) (-2019.509) -- 0:00:50
891500 -- (-2019.903) (-2014.140) [-2009.952] (-2025.216) * [-2020.245] (-2020.687) (-2011.623) (-2016.814) -- 0:00:50
892000 -- (-2021.153) (-2019.404) (-2018.123) [-2018.861] * (-2025.314) (-2020.642) (-2024.531) [-2023.799] -- 0:00:50
892500 -- (-2013.502) (-2016.268) (-2018.510) [-2019.779] * [-2026.153] (-2021.844) (-2016.263) (-2019.615) -- 0:00:49
893000 -- [-2015.678] (-2018.957) (-2029.186) (-2015.754) * (-2022.140) [-2023.143] (-2027.046) (-2012.879) -- 0:00:49
893500 -- (-2024.185) (-2022.518) (-2020.356) [-2016.444] * (-2015.761) (-2026.097) [-2020.430] (-2010.886) -- 0:00:49
894000 -- (-2019.557) (-2023.478) [-2012.731] (-2019.693) * (-2016.477) (-2025.333) [-2018.513] (-2023.288) -- 0:00:49
894500 -- [-2013.562] (-2021.649) (-2012.331) (-2026.079) * (-2014.988) [-2015.732] (-2014.785) (-2017.923) -- 0:00:49
895000 -- (-2016.532) [-2011.345] (-2013.482) (-2017.744) * [-2012.660] (-2014.563) (-2014.146) (-2016.292) -- 0:00:48
Average standard deviation of split frequencies: 0.008506
895500 -- (-2019.009) (-2013.762) [-2022.380] (-2023.380) * [-2021.178] (-2028.151) (-2017.452) (-2016.406) -- 0:00:48
896000 -- [-2015.256] (-2015.988) (-2011.912) (-2018.013) * (-2021.564) [-2013.187] (-2017.981) (-2014.696) -- 0:00:48
896500 -- [-2014.358] (-2018.887) (-2022.127) (-2026.729) * [-2020.033] (-2016.716) (-2020.494) (-2017.265) -- 0:00:48
897000 -- [-2018.743] (-2019.986) (-2026.066) (-2019.942) * [-2021.951] (-2020.074) (-2014.446) (-2021.700) -- 0:00:47
897500 -- (-2017.374) (-2023.508) [-2016.283] (-2018.081) * (-2025.888) [-2023.813] (-2021.029) (-2021.054) -- 0:00:47
898000 -- (-2019.488) [-2023.561] (-2020.333) (-2020.458) * [-2014.860] (-2019.137) (-2016.425) (-2022.314) -- 0:00:47
898500 -- (-2021.561) (-2023.837) (-2024.044) [-2021.594] * (-2014.400) [-2014.246] (-2022.064) (-2021.195) -- 0:00:47
899000 -- (-2021.982) (-2020.541) [-2010.341] (-2016.060) * [-2016.913] (-2017.500) (-2020.282) (-2018.774) -- 0:00:46
899500 -- (-2022.190) (-2018.940) (-2016.719) [-2014.295] * (-2020.242) [-2017.504] (-2017.102) (-2041.897) -- 0:00:46
900000 -- [-2010.354] (-2015.880) (-2019.465) (-2017.263) * [-2017.170] (-2006.974) (-2019.020) (-2024.841) -- 0:00:46
Average standard deviation of split frequencies: 0.008680
900500 -- (-2019.365) [-2014.885] (-2023.322) (-2018.879) * (-2028.217) (-2015.432) [-2020.150] (-2023.270) -- 0:00:46
901000 -- (-2023.149) (-2031.279) [-2019.798] (-2021.952) * (-2030.318) (-2020.430) [-2016.514] (-2019.631) -- 0:00:46
901500 -- [-2019.854] (-2021.988) (-2024.497) (-2020.571) * (-2021.768) [-2020.336] (-2017.223) (-2024.043) -- 0:00:45
902000 -- (-2029.369) (-2015.594) [-2010.071] (-2021.452) * (-2023.163) (-2018.877) [-2017.113] (-2027.089) -- 0:00:45
902500 -- (-2032.393) [-2017.062] (-2017.646) (-2014.541) * (-2019.892) [-2018.459] (-2014.033) (-2026.809) -- 0:00:45
903000 -- (-2030.953) (-2018.270) [-2010.645] (-2024.750) * (-2019.396) (-2014.840) (-2020.176) [-2020.798] -- 0:00:45
903500 -- (-2024.427) (-2024.389) [-2014.349] (-2023.451) * [-2015.097] (-2016.809) (-2028.523) (-2018.488) -- 0:00:44
904000 -- (-2021.197) (-2022.045) [-2011.429] (-2021.632) * (-2022.760) [-2018.616] (-2022.147) (-2019.949) -- 0:00:44
904500 -- (-2023.563) (-2017.544) [-2017.560] (-2024.588) * (-2015.049) (-2017.384) (-2019.345) [-2024.392] -- 0:00:44
905000 -- (-2015.978) [-2018.445] (-2017.778) (-2024.692) * [-2014.443] (-2023.057) (-2018.744) (-2018.086) -- 0:00:44
Average standard deviation of split frequencies: 0.008932
905500 -- (-2013.027) (-2018.702) (-2017.596) [-2018.302] * (-2021.610) [-2016.537] (-2023.564) (-2018.201) -- 0:00:43
906000 -- (-2014.318) (-2016.925) [-2021.663] (-2017.016) * (-2017.027) (-2023.974) (-2017.070) [-2014.730] -- 0:00:43
906500 -- (-2013.943) [-2020.319] (-2021.519) (-2011.504) * (-2018.923) [-2016.178] (-2017.308) (-2026.541) -- 0:00:43
907000 -- (-2013.386) (-2026.489) [-2015.178] (-2013.626) * (-2021.015) (-2014.882) (-2029.084) [-2016.984] -- 0:00:43
907500 -- (-2019.517) [-2020.683] (-2020.577) (-2021.558) * (-2024.069) [-2013.611] (-2033.044) (-2018.353) -- 0:00:43
908000 -- (-2020.961) [-2027.549] (-2017.907) (-2025.390) * (-2018.459) [-2016.848] (-2020.649) (-2013.014) -- 0:00:42
908500 -- (-2024.632) (-2020.453) [-2018.936] (-2029.786) * (-2019.296) (-2020.279) [-2017.643] (-2021.570) -- 0:00:42
909000 -- (-2018.501) [-2019.436] (-2018.490) (-2019.723) * (-2018.077) (-2018.283) (-2012.871) [-2013.876] -- 0:00:42
909500 -- [-2016.584] (-2019.562) (-2019.267) (-2023.435) * [-2019.729] (-2022.939) (-2018.719) (-2015.221) -- 0:00:42
910000 -- (-2019.460) (-2021.599) (-2021.390) [-2017.621] * [-2019.709] (-2014.626) (-2016.315) (-2016.100) -- 0:00:41
Average standard deviation of split frequencies: 0.009929
910500 -- (-2020.822) (-2018.367) [-2013.969] (-2020.677) * (-2020.983) [-2012.753] (-2020.590) (-2030.954) -- 0:00:41
911000 -- [-2016.687] (-2017.274) (-2014.333) (-2021.401) * (-2019.417) (-2019.590) [-2023.081] (-2018.023) -- 0:00:41
911500 -- [-2025.138] (-2012.718) (-2025.144) (-2016.890) * (-2023.860) (-2020.130) [-2020.559] (-2023.881) -- 0:00:41
912000 -- [-2022.044] (-2023.943) (-2014.288) (-2015.373) * (-2027.144) [-2011.846] (-2022.106) (-2012.322) -- 0:00:40
912500 -- (-2020.116) (-2018.111) (-2022.771) [-2019.690] * (-2023.804) (-2021.341) (-2010.768) [-2012.931] -- 0:00:40
913000 -- [-2022.103] (-2015.123) (-2021.959) (-2016.114) * (-2019.142) [-2020.754] (-2018.944) (-2013.913) -- 0:00:40
913500 -- (-2022.659) [-2017.336] (-2016.372) (-2018.406) * (-2020.805) (-2020.949) [-2016.103] (-2020.408) -- 0:00:40
914000 -- (-2020.372) (-2020.573) (-2020.377) [-2020.724] * (-2021.081) (-2027.618) (-2021.277) [-2016.207] -- 0:00:39
914500 -- (-2023.959) [-2015.149] (-2016.975) (-2017.959) * (-2020.036) [-2016.821] (-2028.863) (-2023.002) -- 0:00:39
915000 -- (-2018.192) [-2017.267] (-2023.445) (-2029.610) * (-2024.888) (-2022.384) (-2016.539) [-2015.885] -- 0:00:39
Average standard deviation of split frequencies: 0.009521
915500 -- [-2015.730] (-2026.682) (-2019.548) (-2016.999) * (-2032.986) (-2024.352) (-2029.067) [-2015.179] -- 0:00:39
916000 -- (-2017.299) (-2024.525) [-2018.960] (-2020.661) * [-2021.486] (-2027.064) (-2017.446) (-2016.333) -- 0:00:39
916500 -- (-2026.085) (-2014.553) (-2017.923) [-2021.220] * [-2014.737] (-2018.537) (-2023.314) (-2018.688) -- 0:00:38
917000 -- [-2014.189] (-2025.219) (-2024.313) (-2017.679) * [-2023.003] (-2019.300) (-2025.855) (-2021.482) -- 0:00:38
917500 -- [-2014.089] (-2015.959) (-2024.488) (-2033.990) * (-2030.452) (-2016.513) [-2013.912] (-2017.396) -- 0:00:38
918000 -- (-2014.881) [-2016.137] (-2019.069) (-2016.740) * (-2013.946) [-2015.111] (-2025.187) (-2016.212) -- 0:00:38
918500 -- [-2013.807] (-2011.165) (-2015.297) (-2017.166) * (-2014.920) (-2024.574) (-2017.440) [-2014.941] -- 0:00:37
919000 -- (-2020.322) [-2020.187] (-2023.406) (-2020.662) * (-2021.485) (-2021.239) (-2018.988) [-2016.108] -- 0:00:37
919500 -- (-2019.779) [-2017.032] (-2018.235) (-2026.957) * (-2028.873) (-2019.551) (-2016.921) [-2011.528] -- 0:00:37
920000 -- (-2020.969) [-2018.801] (-2023.545) (-2017.586) * (-2025.862) (-2024.953) [-2016.078] (-2012.526) -- 0:00:37
Average standard deviation of split frequencies: 0.008832
920500 -- (-2017.600) [-2020.009] (-2024.567) (-2020.810) * (-2024.558) (-2018.139) [-2013.080] (-2019.740) -- 0:00:36
921000 -- (-2018.082) (-2017.613) [-2018.502] (-2015.178) * (-2025.841) (-2017.483) [-2018.368] (-2011.951) -- 0:00:36
921500 -- (-2015.000) (-2015.631) [-2020.919] (-2014.795) * (-2017.564) (-2018.447) (-2021.142) [-2022.930] -- 0:00:36
922000 -- (-2014.779) [-2015.897] (-2018.327) (-2022.634) * (-2026.315) (-2019.004) [-2018.651] (-2021.659) -- 0:00:36
922500 -- [-2016.081] (-2016.929) (-2020.796) (-2025.859) * (-2016.210) (-2024.158) [-2020.897] (-2021.500) -- 0:00:36
923000 -- (-2019.273) (-2014.374) (-2018.502) [-2023.346] * [-2017.430] (-2023.576) (-2018.237) (-2018.850) -- 0:00:35
923500 -- (-2013.352) (-2018.269) [-2023.923] (-2017.409) * (-2015.083) (-2012.517) [-2015.916] (-2020.346) -- 0:00:35
924000 -- (-2018.268) (-2020.911) (-2030.197) [-2017.846] * [-2022.945] (-2021.734) (-2018.451) (-2026.137) -- 0:00:35
924500 -- [-2020.665] (-2024.367) (-2031.681) (-2016.072) * [-2015.520] (-2010.221) (-2016.532) (-2017.296) -- 0:00:35
925000 -- [-2015.969] (-2027.619) (-2021.244) (-2026.175) * (-2017.743) [-2016.466] (-2011.687) (-2017.639) -- 0:00:34
Average standard deviation of split frequencies: 0.009348
925500 -- [-2013.159] (-2017.855) (-2016.840) (-2015.055) * (-2010.852) (-2017.943) [-2016.807] (-2017.991) -- 0:00:34
926000 -- (-2018.178) (-2020.515) [-2020.797] (-2019.438) * (-2020.186) [-2015.255] (-2023.894) (-2023.927) -- 0:00:34
926500 -- (-2020.642) (-2019.264) (-2020.652) [-2017.922] * (-2021.486) [-2025.784] (-2018.341) (-2024.348) -- 0:00:34
927000 -- (-2027.866) (-2013.882) (-2018.769) [-2011.475] * (-2013.631) (-2016.896) [-2014.593] (-2019.658) -- 0:00:33
927500 -- (-2021.928) [-2019.981] (-2019.440) (-2020.194) * (-2019.092) (-2023.429) (-2020.779) [-2016.900] -- 0:00:33
928000 -- (-2016.248) (-2027.146) [-2015.821] (-2017.190) * [-2019.575] (-2016.169) (-2023.812) (-2019.540) -- 0:00:33
928500 -- (-2027.331) (-2016.011) (-2016.803) [-2015.185] * (-2026.707) (-2019.714) [-2019.887] (-2016.611) -- 0:00:33
929000 -- [-2017.027] (-2020.266) (-2015.204) (-2025.600) * (-2020.033) (-2016.556) (-2024.401) [-2007.818] -- 0:00:33
929500 -- (-2027.855) [-2011.425] (-2019.994) (-2025.704) * (-2014.358) (-2017.461) (-2023.342) [-2022.421] -- 0:00:32
930000 -- [-2013.965] (-2014.823) (-2014.477) (-2019.624) * (-2013.783) [-2018.579] (-2018.351) (-2014.356) -- 0:00:32
Average standard deviation of split frequencies: 0.010130
930500 -- (-2019.413) (-2016.080) (-2024.465) [-2012.735] * (-2024.160) [-2015.083] (-2017.863) (-2025.287) -- 0:00:32
931000 -- (-2014.189) (-2015.194) (-2017.308) [-2017.991] * [-2022.746] (-2026.243) (-2015.293) (-2018.677) -- 0:00:32
931500 -- (-2017.883) (-2021.782) [-2018.755] (-2013.581) * (-2017.103) [-2019.548] (-2019.469) (-2018.209) -- 0:00:31
932000 -- [-2020.088] (-2013.863) (-2015.691) (-2012.100) * (-2019.867) (-2034.317) [-2022.483] (-2015.709) -- 0:00:31
932500 -- (-2027.251) (-2021.783) (-2011.764) [-2014.454] * [-2018.313] (-2024.694) (-2013.801) (-2022.431) -- 0:00:31
933000 -- (-2021.377) [-2012.543] (-2016.917) (-2015.171) * (-2020.263) (-2014.496) [-2020.849] (-2026.763) -- 0:00:31
933500 -- (-2022.081) [-2014.592] (-2016.558) (-2021.488) * (-2015.645) [-2018.708] (-2023.300) (-2022.589) -- 0:00:30
934000 -- (-2021.993) (-2021.359) (-2017.557) [-2017.124] * (-2036.744) (-2015.266) [-2013.851] (-2016.582) -- 0:00:30
934500 -- (-2013.642) (-2022.772) [-2012.340] (-2015.621) * (-2019.282) [-2022.635] (-2024.320) (-2016.344) -- 0:00:30
935000 -- [-2015.155] (-2025.632) (-2011.019) (-2018.074) * (-2015.847) (-2016.757) (-2018.787) [-2015.361] -- 0:00:30
Average standard deviation of split frequencies: 0.009981
935500 -- (-2022.228) (-2027.060) (-2013.327) [-2020.552] * (-2013.127) (-2018.095) (-2017.544) [-2014.979] -- 0:00:29
936000 -- (-2020.654) (-2023.625) [-2015.320] (-2016.492) * [-2012.719] (-2009.025) (-2026.639) (-2016.628) -- 0:00:29
936500 -- (-2017.483) (-2022.952) [-2017.000] (-2017.626) * [-2019.691] (-2018.526) (-2024.865) (-2018.381) -- 0:00:29
937000 -- (-2023.425) (-2021.103) (-2016.763) [-2021.927] * [-2012.435] (-2015.721) (-2012.811) (-2023.816) -- 0:00:29
937500 -- (-2016.114) (-2022.263) [-2016.874] (-2014.849) * [-2014.036] (-2021.352) (-2018.864) (-2016.254) -- 0:00:29
938000 -- (-2023.370) [-2014.021] (-2014.256) (-2017.444) * (-2027.360) [-2015.501] (-2022.589) (-2015.061) -- 0:00:28
938500 -- (-2022.552) [-2012.587] (-2015.171) (-2015.408) * (-2020.022) (-2022.068) [-2014.638] (-2014.609) -- 0:00:28
939000 -- (-2019.805) (-2025.315) (-2014.965) [-2013.328] * (-2026.286) (-2020.864) (-2018.834) [-2011.724] -- 0:00:28
939500 -- (-2016.908) (-2021.366) (-2017.134) [-2014.991] * (-2020.069) [-2017.448] (-2024.724) (-2016.649) -- 0:00:28
940000 -- (-2020.100) (-2013.610) (-2015.689) [-2016.732] * [-2018.017] (-2023.542) (-2022.255) (-2016.737) -- 0:00:27
Average standard deviation of split frequencies: 0.009704
940500 -- (-2023.994) (-2015.261) (-2020.205) [-2019.267] * (-2018.473) (-2026.572) (-2016.511) [-2011.916] -- 0:00:27
941000 -- (-2015.102) (-2021.262) [-2014.658] (-2025.177) * (-2027.908) (-2022.238) [-2030.158] (-2028.415) -- 0:00:27
941500 -- (-2013.620) (-2014.561) [-2026.625] (-2018.491) * [-2022.206] (-2023.858) (-2018.450) (-2015.208) -- 0:00:27
942000 -- (-2025.382) [-2014.854] (-2014.915) (-2011.982) * [-2018.600] (-2022.321) (-2022.368) (-2016.424) -- 0:00:26
942500 -- (-2018.417) (-2025.123) [-2014.706] (-2026.139) * [-2014.288] (-2020.951) (-2021.923) (-2025.204) -- 0:00:26
943000 -- (-2024.067) (-2014.554) [-2015.730] (-2017.294) * [-2012.947] (-2019.379) (-2027.708) (-2021.685) -- 0:00:26
943500 -- (-2025.591) (-2018.679) (-2025.460) [-2013.677] * (-2021.260) [-2025.436] (-2024.279) (-2020.210) -- 0:00:26
944000 -- (-2020.895) (-2013.469) [-2020.078] (-2027.845) * (-2023.542) [-2021.811] (-2025.620) (-2016.389) -- 0:00:26
944500 -- (-2014.635) [-2015.342] (-2021.198) (-2022.253) * (-2022.009) (-2013.237) (-2016.612) [-2010.910] -- 0:00:25
945000 -- (-2014.649) (-2019.432) (-2021.027) [-2017.109] * (-2016.685) (-2022.499) [-2011.614] (-2019.329) -- 0:00:25
Average standard deviation of split frequencies: 0.009551
945500 -- (-2013.972) [-2021.810] (-2019.132) (-2016.056) * (-2023.074) [-2015.821] (-2017.436) (-2021.494) -- 0:00:25
946000 -- (-2015.765) [-2015.279] (-2015.921) (-2025.036) * (-2031.973) (-2020.680) [-2019.527] (-2024.161) -- 0:00:25
946500 -- (-2014.878) [-2012.871] (-2021.881) (-2030.035) * (-2019.773) [-2014.291] (-2029.575) (-2015.617) -- 0:00:24
947000 -- [-2017.124] (-2021.622) (-2022.822) (-2031.373) * [-2011.708] (-2013.516) (-2028.394) (-2014.301) -- 0:00:24
947500 -- (-2011.802) (-2018.922) [-2019.524] (-2020.879) * (-2019.183) (-2013.989) (-2021.621) [-2023.125] -- 0:00:24
948000 -- [-2015.011] (-2019.085) (-2022.359) (-2016.256) * (-2015.204) (-2013.805) (-2023.293) [-2014.618] -- 0:00:24
948500 -- (-2018.994) (-2020.622) [-2015.278] (-2018.595) * [-2014.030] (-2021.347) (-2012.448) (-2016.880) -- 0:00:23
949000 -- (-2021.622) (-2018.130) [-2016.771] (-2020.149) * (-2026.780) [-2017.877] (-2018.671) (-2017.138) -- 0:00:23
949500 -- (-2024.950) (-2017.124) (-2022.271) [-2016.096] * (-2017.429) (-2023.740) (-2020.789) [-2018.752] -- 0:00:23
950000 -- (-2021.459) (-2017.652) (-2021.429) [-2015.306] * [-2019.052] (-2014.032) (-2012.884) (-2025.996) -- 0:00:23
Average standard deviation of split frequencies: 0.009752
950500 -- (-2016.563) (-2011.615) [-2017.047] (-2015.273) * (-2019.200) (-2015.959) [-2016.437] (-2015.784) -- 0:00:23
951000 -- [-2015.979] (-2024.940) (-2016.998) (-2014.767) * (-2018.781) (-2015.952) (-2021.452) [-2019.916] -- 0:00:22
951500 -- (-2025.930) [-2018.371] (-2023.268) (-2016.495) * [-2010.007] (-2027.122) (-2018.753) (-2020.054) -- 0:00:22
952000 -- (-2028.340) (-2021.517) (-2013.734) [-2020.739] * [-2019.005] (-2024.231) (-2021.624) (-2019.337) -- 0:00:22
952500 -- (-2019.560) (-2023.504) [-2012.310] (-2027.209) * (-2014.459) (-2013.491) [-2016.251] (-2017.013) -- 0:00:22
953000 -- (-2017.178) [-2021.549] (-2011.453) (-2020.303) * (-2014.703) [-2019.557] (-2021.197) (-2017.797) -- 0:00:21
953500 -- (-2017.836) [-2024.864] (-2022.578) (-2015.458) * (-2013.405) (-2015.968) [-2018.017] (-2017.011) -- 0:00:21
954000 -- (-2028.721) [-2016.371] (-2015.726) (-2019.921) * (-2018.291) [-2019.118] (-2015.594) (-2019.245) -- 0:00:21
954500 -- [-2020.340] (-2022.622) (-2015.485) (-2018.653) * (-2022.309) [-2015.445] (-2017.302) (-2016.029) -- 0:00:21
955000 -- (-2016.815) (-2016.318) [-2020.684] (-2021.288) * [-2021.565] (-2021.832) (-2031.298) (-2018.797) -- 0:00:20
Average standard deviation of split frequencies: 0.010759
955500 -- (-2025.186) (-2022.531) (-2017.481) [-2012.460] * (-2023.987) (-2019.534) (-2014.388) [-2020.175] -- 0:00:20
956000 -- (-2020.713) (-2024.747) (-2024.178) [-2015.476] * (-2015.905) [-2022.393] (-2016.109) (-2025.700) -- 0:00:20
956500 -- [-2014.859] (-2021.175) (-2023.966) (-2012.010) * (-2026.165) (-2014.965) (-2021.244) [-2019.295] -- 0:00:20
957000 -- (-2026.242) (-2022.770) (-2033.189) [-2017.720] * (-2022.195) [-2017.406] (-2017.084) (-2021.338) -- 0:00:19
957500 -- (-2020.978) (-2015.364) (-2024.827) [-2017.063] * [-2014.215] (-2019.539) (-2020.825) (-2023.348) -- 0:00:19
958000 -- (-2023.990) (-2019.995) (-2019.871) [-2016.595] * (-2017.570) (-2024.482) [-2013.690] (-2022.865) -- 0:00:19
958500 -- (-2028.114) [-2014.841] (-2020.787) (-2017.920) * [-2017.720] (-2014.512) (-2018.551) (-2020.638) -- 0:00:19
959000 -- [-2023.641] (-2018.416) (-2024.881) (-2018.742) * (-2022.637) (-2035.705) [-2017.771] (-2025.625) -- 0:00:19
959500 -- (-2026.632) (-2024.409) (-2029.174) [-2022.052] * (-2024.517) (-2023.776) (-2022.746) [-2017.821] -- 0:00:18
960000 -- (-2024.596) [-2015.746] (-2025.529) (-2025.585) * (-2023.503) (-2011.732) (-2015.653) [-2018.895] -- 0:00:18
Average standard deviation of split frequencies: 0.010509
960500 -- (-2019.492) (-2021.460) [-2015.642] (-2023.432) * (-2029.822) [-2015.712] (-2018.952) (-2014.452) -- 0:00:18
961000 -- [-2014.676] (-2015.457) (-2025.105) (-2029.080) * (-2020.900) (-2013.468) (-2023.533) [-2016.250] -- 0:00:18
961500 -- (-2029.050) [-2017.768] (-2016.943) (-2020.868) * (-2016.058) (-2014.011) (-2013.557) [-2015.780] -- 0:00:17
962000 -- (-2015.704) (-2019.576) [-2019.225] (-2028.354) * [-2016.874] (-2016.394) (-2019.272) (-2022.776) -- 0:00:17
962500 -- (-2013.914) (-2020.599) (-2021.798) [-2017.365] * [-2014.686] (-2011.252) (-2019.430) (-2023.270) -- 0:00:17
963000 -- [-2017.309] (-2017.989) (-2023.373) (-2023.616) * (-2017.361) (-2025.642) (-2023.111) [-2019.159] -- 0:00:17
963500 -- (-2015.453) [-2015.081] (-2030.108) (-2017.897) * [-2010.955] (-2022.378) (-2016.383) (-2028.771) -- 0:00:16
964000 -- (-2016.922) (-2027.636) [-2019.768] (-2016.580) * (-2020.037) (-2015.625) [-2015.055] (-2043.858) -- 0:00:16
964500 -- (-2015.418) (-2026.978) (-2018.376) [-2017.332] * [-2012.468] (-2021.755) (-2016.015) (-2020.987) -- 0:00:16
965000 -- (-2027.019) [-2017.609] (-2026.841) (-2026.430) * (-2023.201) (-2020.859) [-2018.820] (-2020.128) -- 0:00:16
Average standard deviation of split frequencies: 0.010411
965500 -- (-2019.047) [-2021.310] (-2022.982) (-2020.755) * (-2024.696) (-2017.818) [-2014.258] (-2018.061) -- 0:00:16
966000 -- (-2024.061) (-2015.413) [-2021.909] (-2018.528) * (-2018.737) (-2027.151) (-2014.419) [-2017.735] -- 0:00:15
966500 -- [-2018.247] (-2016.205) (-2012.087) (-2021.208) * (-2031.795) (-2017.005) [-2014.921] (-2014.995) -- 0:00:15
967000 -- (-2023.671) [-2013.665] (-2015.915) (-2016.516) * [-2020.382] (-2029.787) (-2015.537) (-2019.547) -- 0:00:15
967500 -- [-2015.146] (-2014.932) (-2018.411) (-2014.665) * (-2017.723) (-2021.560) [-2013.199] (-2025.005) -- 0:00:15
968000 -- [-2017.053] (-2012.648) (-2021.893) (-2022.418) * (-2026.165) (-2046.202) [-2013.501] (-2018.619) -- 0:00:14
968500 -- [-2019.052] (-2017.930) (-2012.884) (-2019.360) * [-2019.679] (-2018.622) (-2025.265) (-2014.876) -- 0:00:14
969000 -- (-2027.416) (-2016.890) (-2024.048) [-2023.073] * (-2019.376) (-2020.514) (-2013.610) [-2020.094] -- 0:00:14
969500 -- (-2026.057) [-2018.889] (-2029.947) (-2023.253) * (-2024.358) [-2014.717] (-2023.622) (-2015.385) -- 0:00:14
970000 -- (-2023.585) [-2016.339] (-2018.539) (-2023.373) * [-2020.492] (-2017.173) (-2027.711) (-2015.232) -- 0:00:13
Average standard deviation of split frequencies: 0.010441
970500 -- (-2016.187) (-2018.460) [-2020.512] (-2026.106) * (-2025.168) [-2019.827] (-2022.526) (-2022.217) -- 0:00:13
971000 -- (-2029.840) [-2013.579] (-2015.324) (-2023.572) * (-2016.132) [-2018.706] (-2022.511) (-2017.112) -- 0:00:13
971500 -- (-2015.520) (-2018.220) [-2017.514] (-2022.266) * (-2019.437) (-2022.799) (-2026.126) [-2013.366] -- 0:00:13
972000 -- (-2019.634) (-2025.351) (-2017.660) [-2019.764] * [-2019.778] (-2027.397) (-2021.900) (-2023.199) -- 0:00:13
972500 -- [-2019.160] (-2028.405) (-2021.673) (-2021.257) * (-2014.289) (-2015.632) [-2018.542] (-2025.191) -- 0:00:12
973000 -- [-2013.746] (-2020.500) (-2023.425) (-2017.147) * (-2013.825) [-2017.077] (-2020.163) (-2024.610) -- 0:00:12
973500 -- (-2021.102) (-2016.894) (-2022.313) [-2010.955] * (-2022.087) (-2012.800) (-2020.421) [-2013.936] -- 0:00:12
974000 -- (-2032.156) [-2016.855] (-2023.586) (-2022.294) * (-2020.220) (-2022.443) (-2019.614) [-2014.675] -- 0:00:12
974500 -- (-2017.392) (-2016.650) [-2016.611] (-2023.722) * [-2013.531] (-2016.509) (-2018.985) (-2017.764) -- 0:00:11
975000 -- (-2023.068) [-2016.503] (-2022.842) (-2013.696) * (-2017.629) (-2016.592) (-2012.532) [-2016.609] -- 0:00:11
Average standard deviation of split frequencies: 0.009781
975500 -- [-2012.628] (-2017.694) (-2013.865) (-2029.013) * (-2023.221) (-2026.280) (-2020.384) [-2023.199] -- 0:00:11
976000 -- (-2020.964) (-2017.900) [-2023.164] (-2026.505) * (-2027.386) (-2016.977) (-2022.706) [-2023.459] -- 0:00:11
976500 -- [-2018.151] (-2021.085) (-2022.585) (-2021.516) * [-2022.343] (-2025.868) (-2016.646) (-2024.836) -- 0:00:10
977000 -- (-2019.033) (-2020.304) (-2017.434) [-2018.177] * [-2016.992] (-2023.998) (-2019.042) (-2019.132) -- 0:00:10
977500 -- [-2020.740] (-2027.564) (-2017.477) (-2017.076) * (-2017.743) [-2015.383] (-2023.609) (-2018.554) -- 0:00:10
978000 -- (-2016.021) (-2019.474) [-2018.237] (-2015.862) * [-2012.848] (-2011.074) (-2018.623) (-2019.002) -- 0:00:10
978500 -- [-2017.905] (-2020.976) (-2024.101) (-2026.250) * (-2014.411) [-2011.765] (-2018.364) (-2027.265) -- 0:00:09
979000 -- [-2015.633] (-2024.165) (-2022.414) (-2012.365) * (-2022.200) [-2017.325] (-2018.529) (-2017.341) -- 0:00:09
979500 -- [-2012.311] (-2020.749) (-2027.018) (-2017.608) * [-2015.696] (-2013.910) (-2028.944) (-2017.017) -- 0:00:09
980000 -- [-2026.541] (-2017.968) (-2011.567) (-2017.491) * (-2013.024) (-2032.631) [-2020.168] (-2031.285) -- 0:00:09
Average standard deviation of split frequencies: 0.009534
980500 -- (-2022.481) [-2011.648] (-2013.401) (-2017.502) * (-2012.136) [-2017.863] (-2026.401) (-2016.408) -- 0:00:09
981000 -- (-2017.698) (-2011.649) (-2014.576) [-2018.320] * (-2019.172) [-2016.318] (-2016.536) (-2018.172) -- 0:00:08
981500 -- (-2015.105) [-2012.157] (-2013.390) (-2026.174) * (-2018.890) [-2015.778] (-2020.249) (-2025.079) -- 0:00:08
982000 -- [-2021.298] (-2012.410) (-2012.779) (-2026.475) * (-2019.509) [-2015.547] (-2018.477) (-2018.380) -- 0:00:08
982500 -- [-2015.675] (-2018.892) (-2020.117) (-2020.010) * (-2022.392) [-2015.040] (-2021.438) (-2023.264) -- 0:00:08
983000 -- [-2013.346] (-2016.925) (-2022.958) (-2012.176) * (-2013.918) (-2019.496) [-2018.438] (-2025.634) -- 0:00:07
983500 -- (-2022.744) [-2013.015] (-2015.503) (-2016.709) * [-2018.314] (-2015.717) (-2018.190) (-2022.310) -- 0:00:07
984000 -- [-2014.163] (-2019.037) (-2018.032) (-2022.003) * (-2021.860) (-2018.722) (-2017.514) [-2021.502] -- 0:00:07
984500 -- (-2023.783) (-2022.965) [-2012.574] (-2016.304) * (-2024.121) (-2016.059) [-2010.909] (-2012.379) -- 0:00:07
985000 -- (-2019.260) (-2013.944) [-2014.772] (-2026.798) * (-2017.015) (-2024.055) (-2019.482) [-2013.762] -- 0:00:06
Average standard deviation of split frequencies: 0.009562
985500 -- (-2020.017) (-2014.771) [-2014.971] (-2019.605) * (-2026.422) [-2013.558] (-2022.407) (-2019.505) -- 0:00:06
986000 -- (-2021.691) (-2028.477) (-2018.798) [-2028.085] * (-2017.584) (-2019.769) [-2017.156] (-2018.336) -- 0:00:06
986500 -- (-2015.687) (-2027.513) (-2025.097) [-2027.624] * [-2010.151] (-2025.208) (-2017.024) (-2013.607) -- 0:00:06
987000 -- (-2020.918) (-2028.279) (-2025.509) [-2017.277] * (-2013.414) (-2019.380) [-2017.908] (-2022.176) -- 0:00:06
987500 -- [-2013.990] (-2021.929) (-2013.817) (-2018.016) * [-2011.981] (-2016.917) (-2019.842) (-2017.311) -- 0:00:05
988000 -- [-2016.110] (-2022.400) (-2017.399) (-2028.138) * [-2008.176] (-2014.566) (-2013.623) (-2015.451) -- 0:00:05
988500 -- [-2019.430] (-2016.939) (-2023.991) (-2019.772) * [-2018.350] (-2016.433) (-2021.856) (-2018.418) -- 0:00:05
989000 -- (-2018.500) (-2014.611) (-2015.643) [-2027.089] * (-2020.413) (-2018.742) [-2013.458] (-2020.635) -- 0:00:05
989500 -- (-2013.583) (-2020.749) (-2029.417) [-2022.603] * (-2021.102) (-2025.296) (-2018.215) [-2019.430] -- 0:00:04
990000 -- (-2034.831) [-2017.430] (-2018.472) (-2022.691) * (-2015.479) (-2015.665) [-2018.406] (-2018.893) -- 0:00:04
Average standard deviation of split frequencies: 0.009676
990500 -- (-2030.867) (-2022.148) [-2020.932] (-2022.299) * (-2021.788) (-2016.654) (-2014.428) [-2023.859] -- 0:00:04
991000 -- [-2020.245] (-2022.567) (-2023.800) (-2020.020) * [-2015.053] (-2014.288) (-2016.680) (-2016.648) -- 0:00:04
991500 -- [-2015.096] (-2019.211) (-2020.011) (-2019.571) * (-2024.932) [-2015.207] (-2021.333) (-2026.866) -- 0:00:03
992000 -- (-2016.566) (-2023.078) (-2025.790) [-2024.187] * (-2020.199) (-2020.158) [-2020.577] (-2023.069) -- 0:00:03
992500 -- (-2020.412) (-2022.622) [-2018.768] (-2025.307) * (-2021.016) [-2015.954] (-2018.589) (-2024.436) -- 0:00:03
993000 -- (-2016.642) [-2027.947] (-2030.609) (-2022.765) * (-2022.253) (-2028.440) [-2017.552] (-2017.483) -- 0:00:03
993500 -- (-2021.042) [-2015.651] (-2023.148) (-2021.606) * (-2021.229) (-2019.768) (-2014.907) [-2016.452] -- 0:00:03
994000 -- (-2017.304) [-2017.173] (-2030.266) (-2024.538) * (-2026.456) (-2017.225) [-2018.231] (-2020.300) -- 0:00:02
994500 -- (-2015.250) (-2028.096) [-2027.239] (-2021.934) * [-2011.026] (-2014.378) (-2024.147) (-2019.772) -- 0:00:02
995000 -- (-2015.397) [-2024.311] (-2018.529) (-2022.271) * (-2015.255) (-2018.248) (-2018.640) [-2018.567] -- 0:00:02
Average standard deviation of split frequencies: 0.009703
995500 -- [-2011.807] (-2014.868) (-2024.516) (-2018.558) * (-2017.549) [-2014.149] (-2016.596) (-2016.155) -- 0:00:02
996000 -- (-2019.888) (-2033.684) (-2016.923) [-2021.250] * (-2027.450) [-2018.882] (-2015.508) (-2015.232) -- 0:00:01
996500 -- [-2013.339] (-2018.398) (-2029.137) (-2017.526) * (-2014.793) [-2016.785] (-2012.821) (-2031.428) -- 0:00:01
997000 -- (-2015.127) [-2020.654] (-2012.105) (-2020.492) * (-2012.314) (-2018.326) (-2017.394) [-2022.497] -- 0:00:01
997500 -- (-2017.959) (-2017.307) (-2013.661) [-2015.896] * (-2020.292) (-2023.125) [-2011.807] (-2032.643) -- 0:00:01
998000 -- (-2020.485) (-2025.960) [-2011.549] (-2030.779) * [-2026.667] (-2019.800) (-2019.647) (-2023.333) -- 0:00:00
998500 -- [-2016.506] (-2025.415) (-2013.537) (-2014.581) * (-2017.766) (-2024.969) (-2018.533) [-2016.334] -- 0:00:00
999000 -- (-2019.218) [-2016.859] (-2018.047) (-2022.580) * (-2017.624) (-2020.170) [-2017.720] (-2016.180) -- 0:00:00
999500 -- (-2022.677) (-2016.267) [-2019.642] (-2016.308) * (-2022.051) (-2025.574) [-2012.128] (-2015.887) -- 0:00:00
1000000 -- (-2023.057) (-2021.868) [-2012.753] (-2031.322) * [-2015.735] (-2021.404) (-2016.441) (-2019.575) -- 0:00:00
Average standard deviation of split frequencies: 0.009343
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2023.056975 -- 21.914014
Chain 1 -- -2023.056968 -- 21.914014
Chain 2 -- -2021.867727 -- 23.241510
Chain 2 -- -2021.867727 -- 23.241510
Chain 3 -- -2012.753016 -- 18.202826
Chain 3 -- -2012.753026 -- 18.202826
Chain 4 -- -2031.322417 -- 23.332450
Chain 4 -- -2031.322414 -- 23.332450
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2015.735260 -- 18.829695
Chain 1 -- -2015.735272 -- 18.829695
Chain 2 -- -2021.403786 -- 24.341956
Chain 2 -- -2021.403786 -- 24.341956
Chain 3 -- -2016.440893 -- 22.876598
Chain 3 -- -2016.440889 -- 22.876598
Chain 4 -- -2019.574944 -- 22.524679
Chain 4 -- -2019.574945 -- 22.524679
Analysis completed in 7 mins 45 seconds
Analysis used 464.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2006.61
Likelihood of best state for "cold" chain of run 2 was -2006.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
48.3 % ( 42 %) Dirichlet(Revmat{all})
61.7 % ( 47 %) Slider(Revmat{all})
25.9 % ( 30 %) Dirichlet(Pi{all})
28.2 % ( 28 %) Slider(Pi{all})
42.0 % ( 26 %) Multiplier(Alpha{1,2})
47.2 % ( 28 %) Multiplier(Alpha{3})
62.8 % ( 37 %) Slider(Pinvar{all})
17.9 % ( 17 %) ExtSPR(Tau{all},V{all})
7.9 % ( 6 %) ExtTBR(Tau{all},V{all})
22.4 % ( 19 %) NNI(Tau{all},V{all})
23.5 % ( 20 %) ParsSPR(Tau{all},V{all})
26.4 % ( 21 %) Multiplier(V{all})
31.5 % ( 24 %) Nodeslider(V{all})
25.4 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
47.4 % ( 39 %) Dirichlet(Revmat{all})
61.3 % ( 51 %) Slider(Revmat{all})
26.4 % ( 23 %) Dirichlet(Pi{all})
28.6 % ( 27 %) Slider(Pi{all})
41.3 % ( 20 %) Multiplier(Alpha{1,2})
47.0 % ( 21 %) Multiplier(Alpha{3})
64.1 % ( 27 %) Slider(Pinvar{all})
17.8 % ( 19 %) ExtSPR(Tau{all},V{all})
7.9 % ( 14 %) ExtTBR(Tau{all},V{all})
22.2 % ( 19 %) NNI(Tau{all},V{all})
23.9 % ( 19 %) ParsSPR(Tau{all},V{all})
26.6 % ( 23 %) Multiplier(V{all})
31.6 % ( 35 %) Nodeslider(V{all})
25.5 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.78 0.60 0.45
2 | 166880 0.80 0.63
3 | 167009 167414 0.82
4 | 165747 166232 166718
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.78 0.59 0.44
2 | 166571 0.80 0.63
3 | 166236 166664 0.81
4 | 167498 166312 166719
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2014.59
| 1 |
| |
| 2 2 1 |
| 1 1 |
| 2 2 1 * 11 2 |
|1 1 2 1 2 1 1 21 2 22|
| * 1 1 1 2 21 222 12 11 1 2 2 |
| 2 2 22212 2 2 21** 2 2 2 11 |
| 1 2 22 *12 2 2 2 1 1 2 22 1 2 * |
| 2 1 2 2122 1 1 11 2 1 1 |
| 1 1 12 21 1 2 2 1 |
|2 11 1 1 1 1 1 1|
| |
| 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2020.10
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2013.09 -2026.58
2 -2013.03 -2028.11
--------------------------------------
TOTAL -2013.06 -2027.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.491270 0.002971 0.384460 0.598395 0.487948 1140.48 1320.74 1.000
r(A<->C){all} 0.109884 0.000650 0.060995 0.157733 0.107649 972.10 974.11 1.001
r(A<->G){all} 0.238689 0.001415 0.169356 0.314825 0.236885 900.22 959.23 1.001
r(A<->T){all} 0.132327 0.001136 0.069231 0.199724 0.128943 911.89 986.11 1.000
r(C<->G){all} 0.039563 0.000203 0.013796 0.067283 0.038049 819.01 876.29 1.000
r(C<->T){all} 0.405286 0.002302 0.314696 0.499111 0.406139 706.84 778.93 1.000
r(G<->T){all} 0.074251 0.000526 0.031648 0.119302 0.072666 846.88 931.50 1.000
pi(A){all} 0.253035 0.000226 0.223141 0.281496 0.252947 1085.67 1262.78 1.001
pi(C){all} 0.271081 0.000247 0.241559 0.301340 0.271071 1231.21 1366.11 1.000
pi(G){all} 0.310385 0.000262 0.277411 0.340441 0.310434 1255.58 1298.38 1.000
pi(T){all} 0.165499 0.000163 0.140098 0.190442 0.165074 1142.78 1200.19 1.000
alpha{1,2} 0.182041 0.006366 0.000190 0.319356 0.176080 868.24 891.75 1.000
alpha{3} 1.585450 0.506128 0.496327 2.974763 1.461350 1071.41 1075.76 1.000
pinvar{all} 0.248030 0.014776 0.008907 0.442759 0.254655 837.62 992.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
Key to taxon bipartitions (saved to file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
---------------
1 -- .********
2 -- .*.......
3 -- ..*......
4 -- ...*.....
5 -- ....*....
6 -- .....*...
7 -- ......*..
8 -- .......*.
9 -- ........*
10 -- ...******
11 -- .**......
12 -- .....****
13 -- ...*.****
14 -- .....***.
15 -- ......*.*
16 -- .....*.*.
17 -- ......***
18 -- .....**..
19 -- ......**.
20 -- .....**.*
21 -- .......**
---------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
10 3002 1.000000 0.000000 1.000000 1.000000 2
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 2646 0.881412 0.008480 0.875416 0.887408 2
14 1191 0.396736 0.022141 0.381079 0.412392 2
15 1015 0.338108 0.025910 0.319787 0.356429 2
16 812 0.270486 0.013191 0.261159 0.279813 2
17 793 0.264157 0.002355 0.262492 0.265823 2
18 663 0.220853 0.020257 0.206529 0.235177 2
19 387 0.128914 0.010835 0.121252 0.136576 2
20 357 0.118921 0.003298 0.116589 0.121252 2
21 304 0.101266 0.005653 0.097268 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.010276 0.000027 0.001747 0.020830 0.009441 1.000 2
length{all}[2] 0.003562 0.000007 0.000012 0.008632 0.002983 1.000 2
length{all}[3] 0.002152 0.000005 0.000001 0.006140 0.001489 1.000 2
length{all}[4] 0.027890 0.000085 0.010879 0.045976 0.027227 1.000 2
length{all}[5] 0.034696 0.000109 0.015564 0.055281 0.033674 1.000 2
length{all}[6] 0.047677 0.000149 0.026506 0.072786 0.046486 1.000 2
length{all}[7] 0.092148 0.000396 0.053663 0.132065 0.090391 1.000 2
length{all}[8] 0.067589 0.000217 0.039670 0.096480 0.066289 1.000 2
length{all}[9] 0.075816 0.000292 0.046158 0.110163 0.073963 1.000 2
length{all}[10] 0.035823 0.000106 0.016814 0.056153 0.034736 1.001 2
length{all}[11] 0.018795 0.000047 0.006697 0.032460 0.017974 1.001 2
length{all}[12] 0.046083 0.000176 0.022877 0.072901 0.044746 1.000 2
length{all}[13] 0.013581 0.000072 0.000047 0.029651 0.012410 1.001 2
length{all}[14] 0.012564 0.000063 0.000013 0.027022 0.011489 0.999 2
length{all}[15] 0.009832 0.000051 0.000004 0.023692 0.008546 0.999 2
length{all}[16] 0.007383 0.000037 0.000003 0.019622 0.005602 1.001 2
length{all}[17] 0.006398 0.000024 0.000019 0.015668 0.005183 0.999 2
length{all}[18] 0.006396 0.000027 0.000002 0.016135 0.005018 0.999 2
length{all}[19] 0.004161 0.000014 0.000034 0.011724 0.003050 0.999 2
length{all}[20] 0.006444 0.000029 0.000034 0.017110 0.004902 1.000 2
length{all}[21] 0.006211 0.000041 0.000005 0.018386 0.004365 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009343
Maximum standard deviation of split frequencies = 0.025910
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------ C2 (2)
|-------------------------100-------------------------+
| \------------------ C3 (3)
|
| /------------------------------------ C4 (4)
+ |
| | /------------------ C6 (6)
| /--------88-------+ |
| | | |------------------ C7 (7)
| | \-------100-------+
| | |------------------ C8 (8)
\-------100-------+ |
| \------------------ C9 (9)
|
\------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/---- C1 (1)
|
| /- C2 (2)
|------+
| \- C3 (3)
|
| /---------- C4 (4)
+ |
| | /------------------- C6 (6)
| /----+ |
| | | |------------------------------------ C7 (7)
| | \----------------+
| | |-------------------------- C8 (8)
\-------------+ |
| \------------------------------ C9 (9)
|
\------------- C5 (5)
|------------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (44 trees sampled):
50 % credible set contains 4 trees
90 % credible set contains 17 trees
95 % credible set contains 22 trees
99 % credible set contains 34 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 9 ls = 753
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Sites with gaps or missing data are removed.
96 ambiguity characters in seq. 1
81 ambiguity characters in seq. 2
78 ambiguity characters in seq. 3
75 ambiguity characters in seq. 4
96 ambiguity characters in seq. 5
84 ambiguity characters in seq. 6
87 ambiguity characters in seq. 7
90 ambiguity characters in seq. 8
114 ambiguity characters in seq. 9
51 sites are removed. 10 11 15 16 17 19 139 143 144 145 146 147 156 157 158 163 164 165 166 167 168 169 202 209 210 211 212 213 214 218 219 220 221 222 223 224 225 226 239 240 241 242 243 244 245 246 247 248 249 250 251
Sequences read..
Counting site patterns.. 0:00
124 patterns at 200 / 200 sites (100.0%), 0:00
Counting codons..
288 bytes for distance
121024 bytes for conP
16864 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
302560 bytes for conP, adjusted
0.019054 0.037744 0.004809 0.000214 0.053312 0.014504 0.039833 0.060379 0.105925 0.149826 0.131232 0.125966 0.054846 0.300000 1.300000
ntime & nrate & np: 13 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 15
lnL0 = -1766.028568
Iterating by ming2
Initial: fx= 1766.028568
x= 0.01905 0.03774 0.00481 0.00021 0.05331 0.01450 0.03983 0.06038 0.10592 0.14983 0.13123 0.12597 0.05485 0.30000 1.30000
1 h-m-p 0.0000 0.0000 326.0001 ++ 1765.914977 m 0.0000 20 | 1/15
2 h-m-p 0.0000 0.0000 847.7369 +YYYCCC 1764.335108 5 0.0000 46 | 1/15
3 h-m-p 0.0000 0.0001 711.9036 +YYYCCC 1760.594249 5 0.0000 72 | 1/15
4 h-m-p 0.0000 0.0004 744.8127 +YYYC 1752.296723 3 0.0002 94 | 1/15
5 h-m-p 0.0005 0.0025 197.5324 YCCCC 1749.665622 4 0.0003 119 | 1/15
6 h-m-p 0.0004 0.0021 122.7268 YCCCC 1746.236515 4 0.0008 144 | 1/15
7 h-m-p 0.0003 0.0016 291.3607 +YYYCYCCCC 1725.942324 8 0.0014 175 | 1/15
8 h-m-p 0.0000 0.0001 5081.1811 +CYYYCC 1701.919056 5 0.0001 201 | 1/15
9 h-m-p 0.0000 0.0000 7316.1794 CYCYCC 1696.635388 5 0.0000 228 | 1/15
10 h-m-p 0.0005 0.0023 78.0815 YC 1696.220253 1 0.0002 247 | 1/15
11 h-m-p 0.0016 0.0216 12.3118 CCC 1696.017463 2 0.0015 269 | 1/15
12 h-m-p 0.0020 0.0239 9.6711 YCCC 1695.504425 3 0.0033 292 | 1/15
13 h-m-p 0.0038 0.0189 7.6560 YCCCCC 1692.036108 5 0.0080 319 | 1/15
14 h-m-p 0.0009 0.0045 50.4678 YCYCCC 1681.010613 5 0.0022 345 | 1/15
15 h-m-p 0.0203 0.1015 2.2649 CCCCC 1677.984670 4 0.0272 371 | 1/15
16 h-m-p 0.0023 0.0117 22.6770 +CYYYCC 1640.410889 5 0.0104 397 | 1/15
17 h-m-p 0.9753 4.8764 0.1540 CCCC 1631.685659 3 1.1848 421 | 1/15
18 h-m-p 0.1341 0.6703 0.3345 +CYCCC 1619.156798 4 0.5776 461 | 1/15
19 h-m-p 0.2248 1.1239 0.3971 CCCC 1614.770225 3 0.3509 499 | 1/15
20 h-m-p 0.3719 1.8597 0.2583 YCCCC 1610.536262 4 0.7438 538 | 1/15
21 h-m-p 0.3022 1.5109 0.3749 YCCC 1606.019883 3 0.7036 575 | 1/15
22 h-m-p 1.6000 8.0000 0.0881 YCCC 1602.793539 3 3.7012 612 | 1/15
23 h-m-p 1.2917 6.4586 0.1437 CCC 1601.097412 2 1.3813 648 | 1/15
24 h-m-p 1.0097 5.0483 0.1037 CCCC 1600.164271 3 1.7374 686 | 1/15
25 h-m-p 1.6000 8.0000 0.0694 CCCC 1599.404812 3 2.0347 724 | 1/15
26 h-m-p 1.6000 8.0000 0.0595 CCC 1598.720703 2 1.9353 760 | 1/15
27 h-m-p 1.3909 6.9544 0.0333 CYC 1598.493427 2 1.3441 795 | 1/15
28 h-m-p 1.6000 8.0000 0.0043 CC 1598.469778 1 1.4090 829 | 1/15
29 h-m-p 1.6000 8.0000 0.0012 YC 1598.457423 1 2.8186 862 | 1/15
30 h-m-p 1.6000 8.0000 0.0013 CC 1598.453278 1 2.0492 896 | 1/15
31 h-m-p 1.6000 8.0000 0.0004 +YC 1598.449824 1 4.6055 930 | 1/15
32 h-m-p 1.1179 8.0000 0.0018 ++ 1598.431539 m 8.0000 962 | 1/15
33 h-m-p 1.6000 8.0000 0.0015 CC 1598.413595 1 2.4298 996 | 1/15
34 h-m-p 0.1918 8.0000 0.0185 ++CC 1598.388138 1 4.0216 1032 | 1/15
35 h-m-p 1.6000 8.0000 0.0032 CC 1598.383588 1 1.9480 1066 | 1/15
36 h-m-p 1.6000 8.0000 0.0034 YC 1598.381156 1 2.7084 1099 | 1/15
37 h-m-p 1.6000 8.0000 0.0021 YC 1598.380844 1 1.2468 1132 | 1/15
38 h-m-p 1.6000 8.0000 0.0004 Y 1598.380834 0 1.2130 1164 | 1/15
39 h-m-p 1.6000 8.0000 0.0000 Y 1598.380834 0 1.1628 1196 | 1/15
40 h-m-p 1.3356 8.0000 0.0000 C 1598.380834 0 1.3356 1228 | 1/15
41 h-m-p 1.6000 8.0000 0.0000 ----C 1598.380834 0 0.0016 1264
Out..
lnL = -1598.380834
1265 lfun, 1265 eigenQcodon, 16445 P(t)
Time used: 0:05
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
0.019054 0.037744 0.004809 0.000214 0.053312 0.014504 0.039833 0.060379 0.105925 0.149826 0.131232 0.125966 0.054846 2.481497 0.700642 0.304419
ntime & nrate & np: 13 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.699512
np = 16
lnL0 = -1610.696467
Iterating by ming2
Initial: fx= 1610.696467
x= 0.01905 0.03774 0.00481 0.00021 0.05331 0.01450 0.03983 0.06038 0.10592 0.14983 0.13123 0.12597 0.05485 2.48150 0.70064 0.30442
1 h-m-p 0.0000 0.0000 238.1165 ++ 1610.631595 m 0.0000 21 | 1/16
2 h-m-p 0.0000 0.0000 879.7393 +YYYCCC 1609.229619 5 0.0000 48 | 1/16
3 h-m-p 0.0000 0.0009 390.4197 ++CYYYYC 1582.980616 5 0.0008 75 | 1/16
4 h-m-p 0.0000 0.0002 351.8641 CYCCC 1581.733182 4 0.0001 101 | 1/16
5 h-m-p 0.0003 0.0013 50.3482 YYC 1581.490531 2 0.0002 122 | 1/16
6 h-m-p 0.0004 0.0046 27.2266 YCCC 1581.270453 3 0.0007 146 | 1/16
7 h-m-p 0.0006 0.0028 13.4753 YYC 1581.236980 2 0.0004 167 | 1/16
8 h-m-p 0.0011 0.0528 4.9020 CC 1581.196256 1 0.0017 188 | 1/16
9 h-m-p 0.0010 0.0109 8.3638 CCC 1581.133596 2 0.0011 211 | 1/16
10 h-m-p 0.0008 0.0147 11.8368 YCCC 1580.938723 3 0.0017 235 | 1/16
11 h-m-p 0.0007 0.0111 26.9339 +CYCCC 1578.312298 4 0.0064 263 | 1/16
12 h-m-p 0.0003 0.0017 91.7113 CYCCC 1577.514884 4 0.0006 289 | 1/16
13 h-m-p 0.0011 0.0056 31.7505 YCCC 1577.335342 3 0.0006 313 | 1/16
14 h-m-p 0.0023 0.0114 6.2800 YC 1577.326162 1 0.0004 333 | 1/16
15 h-m-p 0.0018 0.4553 1.4210 ++CC 1577.162473 1 0.0305 356 | 1/16
16 h-m-p 0.0011 0.0436 38.7039 +YCCC 1575.538739 3 0.0107 381 | 1/16
17 h-m-p 1.2277 8.0000 0.3363 YCCC 1575.187909 3 0.6735 405 | 1/16
18 h-m-p 0.5761 3.5667 0.3932 YCC 1575.057073 2 0.3293 442 | 1/16
19 h-m-p 0.6605 3.3027 0.0286 CCC 1575.000104 2 0.7619 480 | 1/16
20 h-m-p 1.0364 8.0000 0.0210 CC 1574.981529 1 0.8811 516 | 1/16
21 h-m-p 1.6000 8.0000 0.0051 YC 1574.979985 1 1.1753 551 | 1/16
22 h-m-p 1.6000 8.0000 0.0009 C 1574.979696 0 1.4936 585 | 1/16
23 h-m-p 1.6000 8.0000 0.0007 C 1574.979560 0 2.0419 619 | 1/16
24 h-m-p 1.6000 8.0000 0.0002 Y 1574.979546 0 1.2298 653 | 1/16
25 h-m-p 1.6000 8.0000 0.0000 C 1574.979546 0 1.4693 687 | 1/16
26 h-m-p 1.6000 8.0000 0.0000 C 1574.979545 0 1.3634 721 | 1/16
27 h-m-p 1.6000 8.0000 0.0000 Y 1574.979545 0 1.2289 755 | 1/16
28 h-m-p 1.6000 8.0000 0.0000 Y 1574.979545 0 1.6000 789 | 1/16
29 h-m-p 1.6000 8.0000 0.0000 C 1574.979545 0 1.6000 823 | 1/16
30 h-m-p 1.6000 8.0000 0.0000 Y 1574.979545 0 0.4000 857 | 1/16
31 h-m-p 0.9723 8.0000 0.0000 --------------Y 1574.979545 0 0.0000 905
Out..
lnL = -1574.979545
906 lfun, 2718 eigenQcodon, 23556 P(t)
Time used: 0:13
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
initial w for M2:NSpselection reset.
0.019054 0.037744 0.004809 0.000214 0.053312 0.014504 0.039833 0.060379 0.105925 0.149826 0.131232 0.125966 0.054846 2.388050 0.878998 0.263736 0.186073 2.329016
ntime & nrate & np: 13 3 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.158946
np = 18
lnL0 = -1623.393491
Iterating by ming2
Initial: fx= 1623.393491
x= 0.01905 0.03774 0.00481 0.00021 0.05331 0.01450 0.03983 0.06038 0.10592 0.14983 0.13123 0.12597 0.05485 2.38805 0.87900 0.26374 0.18607 2.32902
1 h-m-p 0.0000 0.0000 238.7471 ++ 1623.319833 m 0.0000 23 | 1/18
2 h-m-p 0.0000 0.0000 737.2849 +YYYCCC 1621.584902 5 0.0000 52 | 1/18
3 h-m-p 0.0001 0.0004 165.4844 +YYYCC 1618.340517 4 0.0003 79 | 1/18
4 h-m-p 0.0000 0.0002 894.6253 +YCYCCC 1613.224382 5 0.0001 109 | 1/18
5 h-m-p 0.0000 0.0001 1020.1231 ++ 1607.069287 m 0.0001 130 | 2/18
6 h-m-p 0.0005 0.0025 69.5796 YCYCCC 1605.368358 5 0.0012 159 | 2/18
7 h-m-p 0.0002 0.0029 386.4425 +YCCC 1601.424847 3 0.0007 186 | 2/18
8 h-m-p 0.0004 0.0021 529.1387 CYC 1597.923284 2 0.0004 210 | 2/18
9 h-m-p 0.0004 0.0018 109.0650 CYCCC 1596.600260 4 0.0007 238 | 1/18
10 h-m-p 0.0003 0.0015 259.4055 CYCCC 1594.929642 4 0.0002 266 | 1/18
11 h-m-p 0.0003 0.0030 183.2926 +YCCC 1592.343655 3 0.0010 293 | 1/18
12 h-m-p 0.0020 0.0099 70.7352 YCCC 1591.242717 3 0.0013 319 | 1/18
13 h-m-p 0.0009 0.0044 32.6575 YYCC 1591.024053 3 0.0007 344 | 1/18
14 h-m-p 0.0018 0.0376 12.0416 +YYC 1590.320409 2 0.0056 368 | 1/18
15 h-m-p 0.0040 0.0719 17.0884 +CYCCCC 1582.134829 5 0.0280 399 | 1/18
16 h-m-p 0.3961 3.5721 1.2086 YCCCC 1575.470665 4 0.6593 427 | 1/18
17 h-m-p 0.7166 3.5831 1.0019 YCCC 1574.887690 3 0.3851 453 | 1/18
18 h-m-p 0.4637 5.4134 0.8322 CCC 1574.555445 2 0.3526 478 | 1/18
19 h-m-p 0.9163 4.5815 0.2566 CCC 1574.263923 2 0.9320 520 | 1/18
20 h-m-p 1.6000 8.0000 0.0653 YC 1574.169167 1 0.6568 559 | 1/18
21 h-m-p 0.3347 8.0000 0.1281 +YC 1574.140702 1 0.8957 599 | 1/18
22 h-m-p 1.2432 8.0000 0.0923 YC 1574.123957 1 0.6139 638 | 1/18
23 h-m-p 1.5084 8.0000 0.0376 CC 1574.111838 1 1.2948 678 | 1/18
24 h-m-p 1.4144 8.0000 0.0344 YC 1574.107527 1 1.0025 717 | 1/18
25 h-m-p 0.8964 8.0000 0.0385 YC 1574.104435 1 1.9849 756 | 1/18
26 h-m-p 1.5029 8.0000 0.0508 CC 1574.102180 1 2.0075 796 | 1/18
27 h-m-p 1.1859 8.0000 0.0860 YC 1574.098026 1 2.7181 835 | 1/18
28 h-m-p 1.0444 8.0000 0.2237 CYCC 1574.088376 3 2.1076 878 | 1/18
29 h-m-p 0.8822 8.0000 0.5345 CCCC 1574.070741 3 1.0955 922 | 1/18
30 h-m-p 1.6000 8.0000 0.1702 CC 1574.056658 1 0.5136 962 | 1/18
31 h-m-p 0.1151 8.0000 0.7596 +YCCC 1574.024231 3 1.0199 1006 | 1/18
32 h-m-p 1.6000 8.0000 0.1930 CC 1574.000268 1 1.3577 1046 | 1/18
33 h-m-p 1.0223 8.0000 0.2563 CCC 1573.988723 2 1.6786 1088 | 1/18
34 h-m-p 1.6000 8.0000 0.1206 YC 1573.978051 1 0.9248 1127 | 1/18
35 h-m-p 0.4980 8.0000 0.2240 +YC 1573.968369 1 1.5199 1167 | 1/18
36 h-m-p 1.6000 8.0000 0.0360 YC 1573.963793 1 2.7586 1206 | 1/18
37 h-m-p 0.9991 8.0000 0.0995 +YC 1573.959662 1 2.6459 1246 | 1/18
38 h-m-p 1.6000 8.0000 0.0344 C 1573.957928 0 1.5045 1284 | 1/18
39 h-m-p 0.9155 8.0000 0.0566 CC 1573.957541 1 1.2142 1324 | 1/18
40 h-m-p 1.6000 8.0000 0.0053 C 1573.957518 0 1.4751 1362 | 1/18
41 h-m-p 1.6000 8.0000 0.0012 C 1573.957516 0 1.4312 1400 | 1/18
42 h-m-p 1.6000 8.0000 0.0002 Y 1573.957516 0 1.1783 1438 | 1/18
43 h-m-p 1.6000 8.0000 0.0001 C 1573.957516 0 1.3011 1476 | 1/18
44 h-m-p 1.6000 8.0000 0.0000 C 1573.957516 0 0.4000 1514 | 1/18
45 h-m-p 0.7698 8.0000 0.0000 C 1573.957516 0 0.1924 1552 | 1/18
46 h-m-p 0.2188 8.0000 0.0000 Y 1573.957516 0 0.0547 1590 | 1/18
47 h-m-p 0.0655 8.0000 0.0000 Y 1573.957516 0 0.0164 1628 | 1/18
48 h-m-p 0.0160 8.0000 0.0000 ----C 1573.957516 0 0.0000 1670
Out..
lnL = -1573.957516
1671 lfun, 6684 eigenQcodon, 65169 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1581.907371 S = -1492.287223 -82.034180
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 124 patterns 0:33
did 20 / 124 patterns 0:33
did 30 / 124 patterns 0:33
did 40 / 124 patterns 0:34
did 50 / 124 patterns 0:34
did 60 / 124 patterns 0:34
did 70 / 124 patterns 0:34
did 80 / 124 patterns 0:34
did 90 / 124 patterns 0:34
did 100 / 124 patterns 0:34
did 110 / 124 patterns 0:34
did 120 / 124 patterns 0:34
did 124 / 124 patterns 0:34
Time used: 0:34
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
0.019054 0.037744 0.004809 0.000214 0.053312 0.014504 0.039833 0.060379 0.105925 0.149826 0.131232 0.125966 0.054846 2.409161 0.062503 0.014820 0.090551 0.211423 0.362773
ntime & nrate & np: 13 4 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 8.701248
np = 19
lnL0 = -1595.699341
Iterating by ming2
Initial: fx= 1595.699341
x= 0.01905 0.03774 0.00481 0.00021 0.05331 0.01450 0.03983 0.06038 0.10592 0.14983 0.13123 0.12597 0.05485 2.40916 0.06250 0.01482 0.09055 0.21142 0.36277
1 h-m-p 0.0000 0.0000 225.2131 ++ 1595.643229 m 0.0000 24 | 1/19
2 h-m-p 0.0000 0.0000 269.1284 YCYCCC 1595.294382 5 0.0000 54 | 1/19
3 h-m-p 0.0000 0.0007 179.8672 +++ 1590.402092 m 0.0007 77 | 2/19
4 h-m-p 0.0006 0.0031 75.2689 YCCC 1588.452239 3 0.0014 104 | 2/19
5 h-m-p 0.0001 0.0004 285.2670 ++ 1585.679625 m 0.0004 126 | 3/19
6 h-m-p 0.0019 0.0957 36.5011 CYC 1585.195136 2 0.0022 151 | 3/19
7 h-m-p 0.0002 0.0010 70.2662 CCCC 1585.005795 3 0.0003 179 | 3/19
8 h-m-p 0.0012 0.0087 20.2603 CCCC 1584.707980 3 0.0012 207 | 3/19
9 h-m-p 0.0012 0.0096 20.5878 YCCCC 1583.458685 4 0.0027 236 | 3/19
10 h-m-p 0.0006 0.0029 71.6245 YCCC 1582.849968 3 0.0004 263 | 3/19
11 h-m-p 0.0015 0.0095 20.0296 YC 1582.709721 1 0.0007 286 | 3/19
12 h-m-p 0.0009 0.0183 15.6831 CC 1582.636572 1 0.0008 310 | 3/19
13 h-m-p 0.0020 0.1929 6.3448 +YCCC 1582.347093 3 0.0126 338 | 3/19
14 h-m-p 0.0007 0.0134 121.1089 YCCC 1581.693570 3 0.0015 365 | 3/19
15 h-m-p 0.0021 0.0124 85.0299 YYC 1581.105141 2 0.0018 389 | 3/19
16 h-m-p 0.0520 0.2602 1.5738 +YYCCCC 1578.934514 5 0.1651 420 | 2/19
17 h-m-p 0.0080 1.0687 32.5941 -CYC 1578.630951 2 0.0006 446 | 2/19
18 h-m-p 0.0192 1.7551 1.0937 ++YCCCC 1576.422500 4 0.5801 477 | 1/19
19 h-m-p 0.0020 0.0098 136.3138 CCC 1576.202542 2 0.0005 503 | 1/19
20 h-m-p 0.0663 2.1954 0.9536 +CCCC 1575.665032 3 0.3579 532 | 1/19
21 h-m-p 0.4558 2.2790 0.4215 CCCC 1575.215012 3 0.7016 578 | 1/19
22 h-m-p 0.4298 2.1489 0.5464 CCC 1574.815395 2 0.5025 622 | 1/19
23 h-m-p 0.9382 8.0000 0.2926 CCC 1574.566084 2 0.7235 666 | 1/19
24 h-m-p 0.8576 4.9143 0.2469 YCC 1574.461570 2 0.5485 709 | 1/19
25 h-m-p 0.5722 8.0000 0.2366 YCCC 1574.222030 3 1.2315 754 | 1/19
26 h-m-p 1.6000 8.0000 0.0623 CYC 1574.143568 2 1.8147 797 | 1/19
27 h-m-p 1.6000 8.0000 0.0360 YC 1574.137689 1 1.1736 838 | 1/19
28 h-m-p 1.6000 8.0000 0.0062 C 1574.136758 0 1.4313 878 | 1/19
29 h-m-p 1.6000 8.0000 0.0044 C 1574.136428 0 1.5008 918 | 1/19
30 h-m-p 1.6000 8.0000 0.0016 YC 1574.136261 1 2.7696 959 | 1/19
31 h-m-p 1.5262 8.0000 0.0029 ++ 1574.135427 m 8.0000 999 | 1/19
32 h-m-p 0.5890 8.0000 0.0400 +Y 1574.133897 0 2.3560 1040 | 1/19
33 h-m-p 1.6000 8.0000 0.0172 YC 1574.131975 1 2.9950 1081 | 1/19
34 h-m-p 1.2991 8.0000 0.0398 YC 1574.131730 1 0.8317 1122 | 1/19
35 h-m-p 1.6000 8.0000 0.0045 C 1574.131704 0 1.3352 1162 | 1/19
36 h-m-p 1.6000 8.0000 0.0025 C 1574.131701 0 1.3414 1202 | 1/19
37 h-m-p 1.6000 8.0000 0.0002 Y 1574.131701 0 1.0783 1242 | 1/19
38 h-m-p 1.6000 8.0000 0.0001 Y 1574.131701 0 0.9262 1282 | 1/19
39 h-m-p 1.6000 8.0000 0.0000 Y 1574.131701 0 0.9661 1322 | 1/19
40 h-m-p 1.6000 8.0000 0.0000 C 1574.131701 0 1.6000 1362 | 1/19
41 h-m-p 1.6000 8.0000 0.0000 C 1574.131701 0 1.6000 1402 | 1/19
42 h-m-p 1.6000 8.0000 0.0000 ------Y 1574.131701 0 0.0001 1448
Out..
lnL = -1574.131701
1449 lfun, 5796 eigenQcodon, 56511 P(t)
Time used: 0:52
Model 7: beta
TREE # 1
(1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
0.019054 0.037744 0.004809 0.000214 0.053312 0.014504 0.039833 0.060379 0.105925 0.149826 0.131232 0.125966 0.054846 2.439895 0.942968 1.067294
ntime & nrate & np: 13 1 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 6.057026
np = 16
lnL0 = -1607.750957
Iterating by ming2
Initial: fx= 1607.750957
x= 0.01905 0.03774 0.00481 0.00021 0.05331 0.01450 0.03983 0.06038 0.10592 0.14983 0.13123 0.12597 0.05485 2.43990 0.94297 1.06729
1 h-m-p 0.0000 0.0000 217.1305 ++ 1607.696757 m 0.0000 21 | 1/16
2 h-m-p 0.0000 0.0000 339.0399 YCYCCC 1607.263147 5 0.0000 48 | 1/16
3 h-m-p 0.0001 0.0027 75.3894 +CCCC 1606.314148 3 0.0005 74 | 1/16
4 h-m-p 0.0004 0.0037 96.0253 YCCC 1604.412012 3 0.0010 98 | 1/16
5 h-m-p 0.0003 0.0015 184.9660 +YYCCCC 1600.278260 5 0.0010 126 | 1/16
6 h-m-p 0.0001 0.0005 1761.6922 YCYCCC 1588.270619 5 0.0003 154 | 1/16
7 h-m-p 0.0001 0.0007 488.1868 YYCC 1587.242351 3 0.0001 177 | 1/16
8 h-m-p 0.0003 0.0014 56.5287 CCCC 1587.009475 3 0.0003 202 | 1/16
9 h-m-p 0.0009 0.0096 18.8635 CCC 1586.875884 2 0.0010 225 | 1/16
10 h-m-p 0.0011 0.0195 16.7783 YCCC 1586.676809 3 0.0022 249 | 1/16
11 h-m-p 0.0006 0.0042 65.9348 CCC 1586.454525 2 0.0007 272 | 1/16
12 h-m-p 0.0009 0.0112 47.4568 +YCC 1585.782957 2 0.0031 295 | 1/16
13 h-m-p 0.0005 0.0026 78.3800 YCC 1585.677532 2 0.0003 317 | 1/16
14 h-m-p 0.0028 0.0257 8.3312 YC 1585.642388 1 0.0012 337 | 1/16
15 h-m-p 0.0242 0.5757 0.4200 ++CYCCC 1582.284951 4 0.4477 365 | 1/16
16 h-m-p 0.3169 2.4452 0.5933 CCCC 1580.872430 3 0.2940 405 | 1/16
17 h-m-p 0.4324 4.8151 0.4035 +YYYCYYCCCC 1578.530437 9 2.8824 454 | 1/16
18 h-m-p 0.0523 0.2615 2.6298 CYYCCC 1577.831246 5 0.1159 497 | 1/16
19 h-m-p 0.0960 0.4802 1.1760 CYCYCC 1577.013291 5 0.1950 524 | 1/16
20 h-m-p 0.1468 1.7758 1.5613 YCCCC 1576.284563 4 0.2935 550 | 1/16
21 h-m-p 0.8073 4.0367 0.1480 CCC 1575.857449 2 0.8347 573 | 1/16
22 h-m-p 1.6000 8.0000 0.0462 YYC 1575.763082 2 1.3246 609 | 1/16
23 h-m-p 1.6000 8.0000 0.0345 YC 1575.745210 1 0.9515 644 | 1/16
24 h-m-p 1.4974 8.0000 0.0219 YC 1575.739282 1 0.8874 679 | 1/16
25 h-m-p 1.6000 8.0000 0.0035 YC 1575.738790 1 1.0758 714 | 1/16
26 h-m-p 1.6000 8.0000 0.0003 C 1575.738717 0 1.7245 748 | 1/16
27 h-m-p 1.6000 8.0000 0.0001 Y 1575.738712 0 1.1597 782 | 1/16
28 h-m-p 1.6000 8.0000 0.0000 C 1575.738712 0 1.3522 816 | 1/16
29 h-m-p 1.6000 8.0000 0.0000 Y 1575.738712 0 1.1289 850 | 1/16
30 h-m-p 1.6000 8.0000 0.0000 C 1575.738712 0 1.3731 884 | 1/16
31 h-m-p 1.6000 8.0000 0.0000 ----Y 1575.738712 0 0.0016 922
Out..
lnL = -1575.738712
923 lfun, 10153 eigenQcodon, 119990 P(t)
Time used: 1:28
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
initial w for M8:NSbetaw>1 reset.
0.019054 0.037744 0.004809 0.000214 0.053312 0.014504 0.039833 0.060379 0.105925 0.149826 0.131232 0.125966 0.054846 2.374057 0.900000 1.091300 1.180709 2.396835
ntime & nrate & np: 13 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 4.952130
np = 18
lnL0 = -1614.216330
Iterating by ming2
Initial: fx= 1614.216330
x= 0.01905 0.03774 0.00481 0.00021 0.05331 0.01450 0.03983 0.06038 0.10592 0.14983 0.13123 0.12597 0.05485 2.37406 0.90000 1.09130 1.18071 2.39683
1 h-m-p 0.0000 0.0000 238.6583 ++ 1614.147687 m 0.0000 23 | 1/18
2 h-m-p 0.0000 0.0000 748.8963 +YYYCCC 1612.812928 5 0.0000 52 | 1/18
3 h-m-p 0.0001 0.0006 172.3553 +CYCCC 1609.120174 4 0.0004 81 | 1/18
4 h-m-p 0.0000 0.0001 300.9674 +YCCC 1608.208120 3 0.0001 108 | 1/18
5 h-m-p 0.0001 0.0003 100.3818 YCCC 1607.787089 3 0.0001 134 | 1/18
6 h-m-p 0.0003 0.0017 58.0507 +YCCCC 1606.912291 4 0.0007 163 | 1/18
7 h-m-p 0.0001 0.0007 372.2574 ++ 1600.401580 m 0.0007 184 | 1/18
8 h-m-p 0.0001 0.0004 2729.7366 YCYCCCC 1589.122318 6 0.0002 215 | 1/18
9 h-m-p 0.0000 0.0002 2350.8490 CYCCCC 1585.816384 5 0.0001 245 | 1/18
10 h-m-p 0.0021 0.0107 26.1401 CCC 1585.650716 2 0.0007 270 | 1/18
11 h-m-p 0.0006 0.0066 28.1607 CCC 1585.463731 2 0.0009 295 | 1/18
12 h-m-p 0.0003 0.0150 83.7314 ++YYYYC 1582.920130 4 0.0047 322 | 1/18
13 h-m-p 0.0005 0.0034 820.2044 CCCC 1580.828383 3 0.0004 349 | 1/18
14 h-m-p 0.0034 0.0171 19.4228 -CYC 1580.804485 2 0.0003 374 | 1/18
15 h-m-p 0.0007 0.0589 7.5278 YC 1580.779785 1 0.0011 396 | 1/18
16 h-m-p 0.0060 3.0202 1.3432 +++CCC 1578.101990 2 0.5527 424 | 1/18
17 h-m-p 0.3758 2.3870 1.9755 YCCCC 1577.374199 4 0.2295 452 | 1/18
18 h-m-p 1.0052 5.0261 0.0980 CCCC 1576.826587 3 1.2834 479 | 1/18
19 h-m-p 0.2229 4.3011 0.5643 +YYYC 1576.340403 3 0.8720 521 | 1/18
20 h-m-p 1.6000 8.0000 0.0794 CYC 1575.932391 2 1.9411 562 | 1/18
21 h-m-p 0.3198 3.5797 0.4822 +CCCC 1575.474001 3 1.3242 607 | 1/18
22 h-m-p 1.1917 5.9585 0.1384 CCCC 1574.928782 3 1.6132 651 | 1/18
23 h-m-p 1.2377 8.0000 0.1804 YCCC 1574.511534 3 2.5532 694 | 1/18
24 h-m-p 1.6000 8.0000 0.2024 YC 1574.339994 1 0.9420 733 | 1/18
25 h-m-p 1.1670 7.9541 0.1634 CC 1574.273795 1 1.1825 773 | 1/18
26 h-m-p 1.6000 8.0000 0.0176 CC 1574.270685 1 1.3852 813 | 1/18
27 h-m-p 1.6000 8.0000 0.0035 C 1574.270113 0 1.4649 851 | 1/18
28 h-m-p 1.6000 8.0000 0.0029 YC 1574.269797 1 0.9766 890 | 1/18
29 h-m-p 0.9022 8.0000 0.0031 +YC 1574.269624 1 2.4459 930 | 1/18
30 h-m-p 1.6000 8.0000 0.0030 ++ 1574.269298 m 8.0000 968 | 1/18
31 h-m-p 1.6000 8.0000 0.0148 ++ 1574.267778 m 8.0000 1006 | 1/18
32 h-m-p 1.0805 8.0000 0.1093 ++ 1574.256538 m 8.0000 1044 | 1/18
33 h-m-p 1.6000 8.0000 0.4235 CCC 1574.246214 2 1.6959 1086 | 1/18
34 h-m-p 1.6000 8.0000 0.1241 CC 1574.240872 1 0.5686 1126 | 1/18
35 h-m-p 0.2536 8.0000 0.2782 +YC 1574.234797 1 1.8152 1166 | 1/18
36 h-m-p 1.3003 8.0000 0.3884 YC 1574.222600 1 3.2432 1205 | 1/18
37 h-m-p 1.6000 8.0000 0.3261 YCC 1574.211181 2 2.5314 1246 | 1/18
38 h-m-p 0.3952 8.0000 2.0890 YC 1574.198778 1 0.9764 1285 | 1/18
39 h-m-p 1.5251 8.0000 1.3374 CC 1574.188856 1 1.9215 1308 | 1/18
40 h-m-p 1.6000 8.0000 0.8145 YCC 1574.178784 2 2.6514 1332 | 1/18
41 h-m-p 0.6395 8.0000 3.3769 YC 1574.169860 1 1.4484 1371 | 1/18
42 h-m-p 1.6000 8.0000 2.8467 CCC 1574.161907 2 2.3251 1396 | 1/18
43 h-m-p 1.6000 8.0000 3.3138 YC 1574.153882 1 2.9872 1418 | 1/18
44 h-m-p 1.6000 8.0000 5.2525 YC 1574.149099 1 2.6758 1440 | 1/18
45 h-m-p 1.6000 8.0000 5.9758 YC 1574.145654 1 2.8069 1462 | 1/18
46 h-m-p 0.4876 2.4381 13.8883 +CC 1574.142879 1 1.7568 1486 | 1/18
47 h-m-p 0.1462 0.7309 12.9459 ++ 1574.142029 m 0.7309 1507 | 2/18
48 h-m-p 0.1578 8.0000 3.3801 ---------------.. | 2/18
49 h-m-p 0.0002 0.1159 0.7824 Y 1574.141981 0 0.0002 1562 | 2/18
50 h-m-p 0.0003 0.1471 0.6171 Y 1574.141965 0 0.0001 1599 | 2/18
51 h-m-p 0.0001 0.0189 1.3903 C 1574.141947 0 0.0001 1636 | 2/18
52 h-m-p 0.0004 0.1417 0.2209 Y 1574.141941 0 0.0003 1657 | 2/18
53 h-m-p 0.0008 0.4112 0.2229 C 1574.141939 0 0.0002 1694 | 2/18
54 h-m-p 0.0053 2.6647 0.0954 C 1574.141935 0 0.0013 1731 | 2/18
55 h-m-p 0.0093 4.6349 0.1703 C 1574.141920 0 0.0031 1768 | 2/18
56 h-m-p 0.0060 3.0148 0.7954 YC 1574.141848 1 0.0035 1806 | 2/18
57 h-m-p 0.0008 0.2313 3.5474 C 1574.141766 0 0.0009 1843 | 2/18
58 h-m-p 0.0010 0.5242 4.4977 C 1574.141664 0 0.0009 1864 | 2/18
59 h-m-p 0.0114 5.6754 1.0119 -Y 1574.141631 0 0.0013 1886 | 2/18
60 h-m-p 0.0076 1.6612 0.1692 -C 1574.141629 0 0.0007 1908 | 2/18
61 h-m-p 0.0153 7.6390 0.0763 -Y 1574.141627 0 0.0017 1946 | 2/18
62 h-m-p 0.0160 8.0000 0.1772 +Y 1574.141487 0 0.0527 1984 | 2/18
63 h-m-p 0.0012 0.6226 7.6990 ++C 1574.139171 0 0.0199 2023 | 2/18
64 h-m-p 1.6000 8.0000 0.0232 -Y 1574.139137 0 0.1823 2045 | 2/18
65 h-m-p 1.6000 8.0000 0.0005 Y 1574.139136 0 0.9811 2082 | 2/18
66 h-m-p 1.6000 8.0000 0.0000 C 1574.139136 0 1.6000 2119 | 2/18
67 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/18
68 h-m-p 0.0160 8.0000 0.0043 ------------- | 2/18
69 h-m-p 0.0160 8.0000 0.0043 -------------
Out..
lnL = -1574.139136
2267 lfun, 27204 eigenQcodon, 324181 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1581.827019 S = -1492.247346 -82.778006
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 124 patterns 3:07
did 20 / 124 patterns 3:07
did 30 / 124 patterns 3:08
did 40 / 124 patterns 3:08
did 50 / 124 patterns 3:08
did 60 / 124 patterns 3:08
did 70 / 124 patterns 3:08
did 80 / 124 patterns 3:09
did 90 / 124 patterns 3:09
did 100 / 124 patterns 3:09
did 110 / 124 patterns 3:09
did 120 / 124 patterns 3:09
did 124 / 124 patterns 3:09
Time used: 3:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=9, Len=251
D_melanogaster_bun-PB MKTETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
D_sechellia_bun-PB MKAETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
D_simulans_bun-PB MKAETGSNNN-NTTV--VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
D_yakuba_bun-PB MKTETGSNNNNNNTT--GGNMDFDMYPSISGKQQDPVREVVMKYIDYFLP
D_erecta_bun-PB MKTETGSNNNHNNTI--V-NMDFDMYPSISGKQQDPVREVVMKYIDYFLP
D_takahashii_bun-PB MKTETGSNN--NNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
D_biarmipes_bun-PB MKTETGSNNN-NNT---GRKMDFDMYPSLSGKQQDPVREVVMKYIDYFLP
D_eugracilis_bun-PB MKTETGSNNNINNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
D_rhopaloa_bun-PB MKAETGSNNNNNINT--VSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP
**:****** * . :********:*********************
D_melanogaster_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
D_sechellia_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
D_simulans_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
D_yakuba_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
D_erecta_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
D_takahashii_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
D_biarmipes_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
D_eugracilis_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMEKINKL
D_rhopaloa_bun-PB DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL
********************************************:*****
D_melanogaster_bun-PB ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
D_sechellia_bun-PB ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
D_simulans_bun-PB ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA
D_yakuba_bun-PB ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAAVQSAVAPAAA
D_erecta_bun-PB ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
D_takahashii_bun-PB ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA
D_biarmipes_bun-PB ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVASAAA
D_eugracilis_bun-PB ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AAT-----TAA
D_rhopaloa_bun-PB ELENNILKSNIPQETLQQLQMQLQVAAPPATPAIQAAP-AVQSAVA-AAA
****.***************:***:************* *. :**
D_melanogaster_bun-PB GQAVQ---QQAAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
D_sechellia_bun-PB GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
D_simulans_bun-PB GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
D_yakuba_bun-PB GQAVQ---QQAAGAVAVAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE
D_erecta_bun-PB GQAVQ---QQQA--AGGAVAVTGVATSPASAAVPTSIPNGSAENGSSAVE
D_takahashii_bun-PB GQAVQGGQQQTAG----AVAVTGVATSPASAVIPTIIPNGSAENGGSAVE
D_biarmipes_bun-PB GQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVPTIIPNGSAENGGSAVE
D_eugracilis_bun-PB GQAVQGGQQQTAG----TVAVTGLATSPASAVVPTSIPNGSAENGGSAVE
D_rhopaloa_bun-PB GQAAQGG-QVAAG------AVTGVATSPASAVAPTTIPNGSAENGGSAVK
***.* * * **:*:*******. ** *********.***:
D_melanogaster_bun-PB SAAVSVEQQ--VQQVTS-----AAAAAASVVTANGPMSooooooo-----
D_sechellia_bun-PB TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSoo----------
D_simulans_bun-PB TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMSo-----------
D_yakuba_bun-PB S-AVSVEQQ--VQQVTSA----AAAAAAAAVTANGPMS------------
D_erecta_bun-PB S-AVSVEQQ--VQQVTS-------AAAAAVVTANGPMSooooooo-----
D_takahashii_bun-PB SAAVSVEQQQQQQ-VTS-------AAATAVTTTNGPMSooo---------
D_biarmipes_bun-PB LSAAAAEQ----QQVAS-------AAAGAATTTNGPMSoooo--------
D_eugracilis_bun-PB SVVVSVEQQQQQQQVTS-------AAATAVTTTNGPMSooooo-------
D_rhopaloa_bun-PB S-AVAVEQQ----QVTS---------AAAVPTANGPMSoooooooooooo
..:.** *:* * :. *:*****
D_melanogaster_bun-PB -
D_sechellia_bun-PB -
D_simulans_bun-PB -
D_yakuba_bun-PB -
D_erecta_bun-PB -
D_takahashii_bun-PB -
D_biarmipes_bun-PB -
D_eugracilis_bun-PB -
D_rhopaloa_bun-PB o
>D_melanogaster_bun-PB ATGAAAACTGAAACCGGCAGCAATAATAAT---AATACCACA-------- -GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACACTGCA GCAGCTGCAGTTGCAGCTACAACTCGCCGCACCGCCGGCCACGCCCGCCA TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG GGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGA----------- -GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG TCAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC A---------------GCAGCGGCAGCAGCAGCATCGGTAGTCACAGCCA ATGGTCCCATGTCC------------------------------------ --- >D_sechellia_bun-PB ATGAAAGCTGAAACCGGCAGCAATAATAAT---AATACCACA-------- -GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTTTGCCA GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA GCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCA TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG GGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA----------- -GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC CCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAG ACAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC AGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCA ATGGTCCCATGTCC------------------------------------ --- >D_simulans_bun-PB ATGAAAGCTGAAACCGGCAGCAATAATAAT---AATACCACAGTG----- -GTCGTCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA GATGCATCTGGAACTAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTGAAAGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTCGAGAACAGCATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA GCAGCTGCAGTTGCAGCTTCAACTAGCCGCCCCGCCGGCCACGCCCGCCA TTCAAGCGGCACCG---GCGGTACAAAGTGTCGTTGCTCCAGCTGCCGCG GGTCAGGCAGTTCAA---------CAGCAGTCCGCTGGA----------- -GCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC CCACGAGCATTCCCAACGGCAGTGCCGAGAACGGCAGCAGTGCAGTCGAG ACAGCAGCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC AGCAGCGGCAGCAGCAGCAGCGGCAGCGGCAGCATCGGTGGTCACAGCCA ATGGTCCCATGTCC------------------------------------ --- >D_yakuba_bun-PB ATGAAAACAGAAACCGGCAGCAATAATAATAACAATAATACTACT----- -GGCGGCAATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTCTGCCA GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTCGAGAACAACATTCTCAAGTCGAACATACCGCAGGAGACACTGCA GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCGCCGGCCACGCCCGCCA TTCAAGCGGCACCGGCGGCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCG GGTCAGGCAGTTCAG---------CAGCAGGCCGCTGGAGCGGTTGCGGT AGCGGTGGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGTGGTAC CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG TCA---GCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACTTC AGCA------------GCGGCAGCGGCGGCAGCAGCGGCAGTCACTGCAA ACGGTCCCATGTCC------------------------------------ --- >D_erecta_bun-PB ATGAAAACTGAAACCGGCAGCAATAATAATCATAATAATACCATC----- -GTC---AATATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGATCCCGTTCGCGAGGTCGTTATGAAATATATCGATTACTTTCTGCCA GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAGCAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACACTGCA GCAGCTGCAGATGCAGCTTCAGATCGCCGCCCCGCCGGCCACGCCCGCCA TTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCAGCTGCCGCG GGTCAGGCAGTTCAG---------CAGCAGCAGGCC------GCTGGAGG AGCGGTAGCGGTAACGGGTGTGGCCACCAGTCCAGCGTCCGCGGCGGTAC CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGCAGCAGTGCAGTCGAG TCA---GCGGTATCGGTGGAGCAGCAG------GTGCAGCAGGTGACATC A---------------------GCAGCGGCGGCAGCAGTGGTCACAGCCA ATGGTCCCATGTCC------------------------------------ --- >D_takahashii_bun-PB ATGAAAACCGAAACCGGCAGCAATAAC------AACAATAATAACAATAC CGTCAGCAAAATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGACCCTGTTCGCGAAGTTGTTATGAAATACATTGATTACTTTCTGCCA GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTCGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCA TCCAAGCGGCGCCG---GCGGTACAGAGTGCCGTTGCTCCGGCTGCCGCG GGTCAGGCAGTTCAGGGTGGCCAGCAGCAGACCGCTGGT----------- -GCGGTTGCGGTAACAGGAGTGGCCACCAGTCCAGCGTCCGCGGTGATCC CAACGATCATTCCCAATGGCAGCGCCGAGAACGGCGGCAGTGCTGTCGAG TCAGCGGCGGTATCGGTGGAGCAGCAGCAGCAGCAGCAG---GTGACGTC A---------------------GCAGCGGCAACAGCGGTAACCACGACCA ACGGTCCCATGTCC------------------------------------ --- >D_biarmipes_bun-PB ATGAAAACTGAAACCGGCAGCAATAACAAC---AATAATACC-------- -GGCAGGAAAATGGATTTCGATATGTATCCAAGCCTTTCGGGCAAGCAAC AGGATCCCGTTCGCGAAGTAGTTATGAAATATATCGATTACTTTCTGCCA GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTGAAGGAGCGCATCTCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA GCAGCTGCAGATGCAGCTCCAGATCGCCGCCCCCCCGGCCACGCCCGCCA TCCAGGCGGCGCCG---GCGGTGCAGAGTGCCGTCGCCTCGGCTGCCGCG GGTCAGGCAGTTCAGGCCGGTCAGCAGCAGGCCGCTGGAGCGGTGGCGGT GGCGGTCGCGGTGGCGGGCGTGGCCACCAGCCCCGCCTCCGCGGTGGTCC CCACGATCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCGAG CTGTCAGCGGCAGCGGCGGAGCAG------------CAGCAGGTGGCGTC G---------------------GCAGCGGCTGGAGCGGCAACCACGACCA ACGGCCCCATGTCC------------------------------------ --- >D_eugracilis_bun-PB ATGAAAACTGAAACTGGTAGCAATAACAACATTAATAATAATAATAACAC CGTCAGCAAAATGGACTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGATCCCGTTCGCGAAGTTGTTATGAAATATATCGATTACTTTCTGCCA GATGCATCTGGAACAAGTGCAGTTGCGATTGATAACAAAATCGAACAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTGCTAAAAGAGCGCATCTCCGAGCTGATGGAAAAGATCAACAAGCTG GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA GCAGTTGCAGATGCAGCTACAGATTGCCGCCCCCCCGGCCACGCCAGCCA TTCAAGCGGCGCCG---GCGGCAACG---------------ACTGCCGCG GGTCAGGCAGTACAGGGCGGTCAGCAGCAGACCGCTGGA----------- -ACGGTAGCGGTAACGGGATTAGCCACCAGTCCAGCGTCAGCGGTGGTCC CCACGAGCATTCCCAACGGCAGCGCCGAGAACGGTGGCAGTGCAGTCGAG TCAGTAGTGGTATCGGTAGAGCAGCAGCAGCAGCAGCAACAGGTGACGTC A---------------------GCAGCGGCAACAGCGGTAACCACAACCA ATGGTCCCATGTCC------------------------------------ --- >D_rhopaloa_bun-PB ATGAAAGCTGAAACCGGCAGCAATAACAACAATAATATTAATACC----- -GTCAGCAAAATGGATTTCGATATGTATCCAAGTATTTCGGGCAAGCAAC AGGATCCCGTTCGCGAAGTCGTTATGAAATATATCGATTACTTTTTGCCA GATGCATCTGGAACAAGTGCAGTTGCGATTGACAACAAAATCGAGCAGGC AATGGATCTGGTCAAGTCGCATCTCATGATAGCGGTGCGCGAGGAGGTGG AAGTTCTGAAGGAGCGCATATCCGAGCTGATGGACAAGATCAACAAGCTG GAGCTGGAGAACAACATTCTCAAGTCGAACATCCCGCAGGAGACGCTGCA GCAGTTGCAGATGCAGCTCCAAGTGGCCGCCCCCCCGGCCACGCCCGCCA TTCAGGCGGCGCCG---GCGGTACAGAGTGCCGTTGCC---GCTGCCGCG GGTCAGGCAGCGCAGGGCGGC---CAGGTGGCCGCCGGA----------- -------GCGGTAACGGGAGTTGCCACCAGCCCAGCGTCCGCAGTGGCGC CCACGACCATTCCCAACGGCAGCGCCGAGAACGGCGGCAGTGCAGTCAAG TCA---GCGGTGGCGGTGGAGCAGCAG------------CAGGTGACGTC A---------------------------GCAGCAGCGGTACCCACAGCAA ACGGTCCCATGTCC------------------------------------ ---
>D_melanogaster_bun-PB MKTETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA GQAVQ---QQAAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE SAAVSVEQQ--VQQVTS-----AAAAAASVVTANGPMS >D_sechellia_bun-PB MKAETGSNNN-NTT---VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMS >D_simulans_bun-PB MKAETGSNNN-NTTV--VVNMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAP-AVQSVVAPAAA GQAVQ---QQSAG----AVAVTGVATSPASAVVPTSIPNGSAENGSSAVE TAAVSVEQQ--VQQVTSAAAAAAAAAAASVVTANGPMS >D_yakuba_bun-PB MKTETGSNNNNNNTT--GGNMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAPAAVQSAVAPAAA GQAVQ---QQAAGAVAVAVAVTGVATSPASAVVPTSIPNGSAENGSSAVE S-AVSVEQQ--VQQVTSA----AAAAAAAAVTANGPMS >D_erecta_bun-PB MKTETGSNNNHNNTI--V-NMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA GQAVQ---QQQA--AGGAVAVTGVATSPASAAVPTSIPNGSAENGSSAVE S-AVSVEQQ--VQQVTS-------AAAAAVVTANGPMS >D_takahashii_bun-PB MKTETGSNN--NNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVAPAAA GQAVQGGQQQTAG----AVAVTGVATSPASAVIPTIIPNGSAENGGSAVE SAAVSVEQQQQQQ-VTS-------AAATAVTTTNGPMS >D_biarmipes_bun-PB MKTETGSNNN-NNT---GRKMDFDMYPSLSGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AVQSAVASAAA GQAVQAGQQQAAGAVAVAVAVAGVATSPASAVVPTIIPNGSAENGGSAVE LSAAAAEQ----QQVAS-------AAAGAATTTNGPMS >D_eugracilis_bun-PB MKTETGSNNNINNNNNTVSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMEKINKL ELENNILKSNIPQETLQQLQMQLQIAAPPATPAIQAAP-AAT-----TAA GQAVQGGQQQTAG----TVAVTGLATSPASAVVPTSIPNGSAENGGSAVE SVVVSVEQQQQQQQVTS-------AAATAVTTTNGPMS >D_rhopaloa_bun-PB MKAETGSNNNNNINT--VSKMDFDMYPSISGKQQDPVREVVMKYIDYFLP DASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKL ELENNILKSNIPQETLQQLQMQLQVAAPPATPAIQAAP-AVQSAVA-AAA GQAAQGG-QVAAG------AVTGVATSPASAVAPTTIPNGSAENGGSAVK S-AVAVEQQ----QVTS---------AAAVPTANGPMS
#NEXUS
[ID: 2933161341]
begin taxa;
dimensions ntax=9;
taxlabels
D_melanogaster_bun-PB
D_sechellia_bun-PB
D_simulans_bun-PB
D_yakuba_bun-PB
D_erecta_bun-PB
D_takahashii_bun-PB
D_biarmipes_bun-PB
D_eugracilis_bun-PB
D_rhopaloa_bun-PB
;
end;
begin trees;
translate
1 D_melanogaster_bun-PB,
2 D_sechellia_bun-PB,
3 D_simulans_bun-PB,
4 D_yakuba_bun-PB,
5 D_erecta_bun-PB,
6 D_takahashii_bun-PB,
7 D_biarmipes_bun-PB,
8 D_eugracilis_bun-PB,
9 D_rhopaloa_bun-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.009440843,(2:0.002983487,3:0.00148924)1.000:0.01797378,((4:0.02722675,(6:0.04648623,7:0.09039107,8:0.06628913,9:0.07396304)1.000:0.04474569)0.881:0.01241032,5:0.03367352)1.000:0.03473554);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.009440843,(2:0.002983487,3:0.00148924):0.01797378,((4:0.02722675,(6:0.04648623,7:0.09039107,8:0.06628913,9:0.07396304):0.04474569):0.01241032,5:0.03367352):0.03473554);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2013.09 -2026.58
2 -2013.03 -2028.11
--------------------------------------
TOTAL -2013.06 -2027.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/28/bun-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.491270 0.002971 0.384460 0.598395 0.487948 1140.48 1320.74 1.000
r(A<->C){all} 0.109884 0.000650 0.060995 0.157733 0.107649 972.10 974.11 1.001
r(A<->G){all} 0.238689 0.001415 0.169356 0.314825 0.236885 900.22 959.23 1.001
r(A<->T){all} 0.132327 0.001136 0.069231 0.199724 0.128943 911.89 986.11 1.000
r(C<->G){all} 0.039563 0.000203 0.013796 0.067283 0.038049 819.01 876.29 1.000
r(C<->T){all} 0.405286 0.002302 0.314696 0.499111 0.406139 706.84 778.93 1.000
r(G<->T){all} 0.074251 0.000526 0.031648 0.119302 0.072666 846.88 931.50 1.000
pi(A){all} 0.253035 0.000226 0.223141 0.281496 0.252947 1085.67 1262.78 1.001
pi(C){all} 0.271081 0.000247 0.241559 0.301340 0.271071 1231.21 1366.11 1.000
pi(G){all} 0.310385 0.000262 0.277411 0.340441 0.310434 1255.58 1298.38 1.000
pi(T){all} 0.165499 0.000163 0.140098 0.190442 0.165074 1142.78 1200.19 1.000
alpha{1,2} 0.182041 0.006366 0.000190 0.319356 0.176080 868.24 891.75 1.000
alpha{3} 1.585450 0.506128 0.496327 2.974763 1.461350 1071.41 1075.76 1.000
pinvar{all} 0.248030 0.014776 0.008907 0.442759 0.254655 837.62 992.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/28/bun-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 9 ls = 200
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 3 4 4 3 3 3 | TAC 1 1 1 1 1 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 2 1 1 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 2 1 0 0 0 | TCG 5 5 5 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 1 0 1 0 | Pro CCT 0 0 0 0 0 1 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 4 3 3 4 3 4 | CCC 5 5 5 5 5 4 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 2 1 1 0 0 0 | CCA 3 3 3 3 3 4 | Gln CAA 4 5 5 2 1 2 | CGA 0 0 0 0 0 0
CTG 6 6 7 7 7 7 | CCG 4 4 4 4 4 3 | CAG 12 11 11 14 16 14 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 2 1 1 3 1 0 | Asn AAT 5 5 5 5 6 4 | Ser AGT 4 5 5 4 4 4
ATC 5 5 5 5 6 7 | ACC 3 3 3 2 3 6 | AAC 6 6 6 8 7 9 | AGC 5 4 4 4 4 2
ATA 1 1 1 2 1 2 | ACA 4 4 4 3 4 3 | Lys AAA 4 4 4 3 3 4 | Arg AGA 0 0 0 0 0 0
Met ATG 8 8 8 9 9 9 | ACG 3 4 4 3 3 5 | AAG 5 5 5 6 6 6 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 5 | Ala GCT 2 3 3 2 1 3 | Asp GAT 7 7 7 7 7 6 | Gly GGT 3 3 3 3 3 2
GTC 5 5 5 4 5 3 | GCC 8 8 8 8 9 7 | GAC 1 1 1 1 1 2 | GGC 4 4 4 5 4 5
GTA 5 4 4 4 4 4 | GCA 9 8 8 10 7 5 | Glu GAA 3 3 3 3 2 4 | GGA 1 1 1 1 1 2
GTG 7 8 8 7 7 7 | GCG 9 9 9 10 12 11 | GAG 11 11 11 11 12 10 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------
Phe TTT 1 1 1 | Ser TCT 1 1 1 | Tyr TAT 2 2 2 | Cys TGT 0 0 0
TTC 1 1 1 | TCC 3 2 3 | TAC 1 1 1 | TGC 0 0 0
Leu TTA 0 1 0 | TCA 0 3 2 | *** TAA 0 0 0 | *** TGA 0 0 0
TTG 0 1 2 | TCG 4 4 3 | TAG 0 0 0 | Trp TGG 0 0 0
--------------------------------------------------------------------------------------
Leu CTT 1 0 0 | Pro CCT 0 0 0 | His CAT 1 1 1 | Arg CGT 0 0 0
CTC 3 2 3 | CCC 7 5 7 | CAC 0 0 0 | CGC 3 3 3
CTA 0 2 0 | CCA 2 4 3 | Gln CAA 1 2 2 | CGA 0 0 0
CTG 9 6 6 | CCG 3 3 3 | CAG 15 13 13 | CGG 0 0 0
--------------------------------------------------------------------------------------
Ile ATT 3 6 6 | Thr ACT 1 3 0 | Asn AAT 3 5 3 | Ser AGT 2 4 3
ATC 8 5 4 | ACC 5 4 3 | AAC 9 8 9 | AGC 4 3 3
ATA 1 1 2 | ACA 1 3 2 | Lys AAA 4 5 4 | Arg AGA 0 0 0
Met ATG 9 9 9 | ACG 4 6 5 | AAG 6 5 7 | AGG 0 0 0
--------------------------------------------------------------------------------------
Val GTT 4 4 5 | Ala GCT 3 1 2 | Asp GAT 7 6 6 | Gly GGT 1 4 2
GTC 3 4 4 | GCC 9 7 9 | GAC 1 1 2 | GGC 8 3 5
GTA 1 5 3 | GCA 7 7 9 | Glu GAA 4 5 3 | GGA 2 2 2
GTG 8 6 8 | GCG 14 10 13 | GAG 10 10 10 | GGG 0 0 0
--------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_bun-PB
position 1: T:0.08500 C:0.22000 A:0.30000 G:0.39500
position 2: T:0.27500 C:0.31500 A:0.31000 G:0.10000
position 3: T:0.18500 C:0.27000 A:0.19000 G:0.35500
Average T:0.18167 C:0.26833 A:0.26667 G:0.28333
#2: D_sechellia_bun-PB
position 1: T:0.09000 C:0.21500 A:0.30000 G:0.39500
position 2: T:0.27500 C:0.31500 A:0.31000 G:0.10000
position 3: T:0.19500 C:0.26500 A:0.17500 G:0.36500
Average T:0.18667 C:0.26500 A:0.26167 G:0.28667
#3: D_simulans_bun-PB
position 1: T:0.08500 C:0.22000 A:0.30000 G:0.39500
position 2: T:0.27500 C:0.31500 A:0.31000 G:0.10000
position 3: T:0.19500 C:0.26500 A:0.17500 G:0.36500
Average T:0.18500 C:0.26667 A:0.26167 G:0.28667
#4: D_yakuba_bun-PB
position 1: T:0.07500 C:0.21500 A:0.31000 G:0.40000
position 2: T:0.26500 C:0.31500 A:0.32000 G:0.10000
position 3: T:0.19000 C:0.27000 A:0.16500 G:0.37500
Average T:0.17667 C:0.26667 A:0.26500 G:0.29167
#5: D_erecta_bun-PB
position 1: T:0.07500 C:0.22000 A:0.31000 G:0.39500
position 2: T:0.27000 C:0.31000 A:0.32500 G:0.09500
position 3: T:0.18500 C:0.27500 A:0.14000 G:0.40000
Average T:0.17667 C:0.26833 A:0.25833 G:0.29667
#6: D_takahashii_bun-PB
position 1: T:0.07500 C:0.21500 A:0.33000 G:0.38000
position 2: T:0.27500 C:0.31000 A:0.32500 G:0.09000
position 3: T:0.17000 C:0.29000 A:0.16000 G:0.38000
Average T:0.17333 C:0.27167 A:0.27167 G:0.28333
#7: D_biarmipes_bun-PB
position 1: T:0.06500 C:0.22500 A:0.30000 G:0.41000
position 2: T:0.26000 C:0.32000 A:0.32000 G:0.10000
position 3: T:0.15000 C:0.32500 A:0.11500 G:0.41000
Average T:0.15833 C:0.29000 A:0.24500 G:0.30667
#8: D_eugracilis_bun-PB
position 1: T:0.08500 C:0.20500 A:0.33500 G:0.37500
position 2: T:0.27000 C:0.31500 A:0.32000 G:0.09500
position 3: T:0.19000 C:0.24500 A:0.20000 G:0.36500
Average T:0.18167 C:0.25500 A:0.28500 G:0.27833
#9: D_rhopaloa_bun-PB
position 1: T:0.08000 C:0.20500 A:0.30000 G:0.41500
position 2: T:0.27000 C:0.32500 A:0.31500 G:0.09000
position 3: T:0.16000 C:0.28500 A:0.16000 G:0.39500
Average T:0.17000 C:0.27167 A:0.25833 G:0.30000
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 9 | Ser S TCT 9 | Tyr Y TAT 17 | Cys C TGT 0
TTC 9 | TCC 28 | TAC 10 | TGC 0
Leu L TTA 1 | TCA 15 | *** * TAA 0 | *** * TGA 0
TTG 7 | TCG 38 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 4 | Pro P CCT 1 | His H CAT 9 | Arg R CGT 0
CTC 29 | CCC 48 | CAC 0 | CGC 27
CTA 6 | CCA 28 | Gln Q CAA 24 | CGA 0
CTG 61 | CCG 32 | CAG 119 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 45 | Thr T ACT 12 | Asn N AAT 41 | Ser S AGT 35
ATC 50 | ACC 32 | AAC 68 | AGC 33
ATA 12 | ACA 28 | Lys K AAA 35 | Arg R AGA 0
Met M ATG 78 | ACG 37 | AAG 51 | AGG 0
------------------------------------------------------------------------------
Val V GTT 38 | Ala A GCT 20 | Asp D GAT 60 | Gly G GGT 24
GTC 38 | GCC 73 | GAC 11 | GGC 42
GTA 34 | GCA 70 | Glu E GAA 30 | GGA 13
GTG 66 | GCG 97 | GAG 96 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.07944 C:0.21556 A:0.30944 G:0.39556
position 2: T:0.27056 C:0.31556 A:0.31722 G:0.09667
position 3: T:0.18000 C:0.27667 A:0.16444 G:0.37889
Average T:0.17667 C:0.26926 A:0.26370 G:0.29037
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_bun-PB
D_sechellia_bun-PB 0.1034 (0.0066 0.0642)
D_simulans_bun-PB 0.1172 (0.0066 0.0567)-1.0000 (0.0000 0.0069)
D_yakuba_bun-PB 0.1402 (0.0156 0.1109) 0.1550 (0.0223 0.1440) 0.1650 (0.0223 0.1353)
D_erecta_bun-PB 0.1535 (0.0189 0.1233) 0.1777 (0.0234 0.1318) 0.1900 (0.0234 0.1234) 0.1047 (0.0122 0.1162)
D_takahashii_bun-PB 0.1367 (0.0349 0.2554) 0.1432 (0.0395 0.2759) 0.1490 (0.0395 0.2653) 0.1427 (0.0268 0.1879) 0.1123 (0.0279 0.2487)
D_biarmipes_bun-PB 0.1793 (0.0490 0.2730) 0.1923 (0.0552 0.2872) 0.1998 (0.0553 0.2765) 0.1494 (0.0326 0.2182) 0.2028 (0.0453 0.2233) 0.1560 (0.0326 0.2089)
D_eugracilis_bun-PB 0.2239 (0.0466 0.2080) 0.2084 (0.0512 0.2458) 0.2174 (0.0513 0.2358) 0.1644 (0.0383 0.2330) 0.1591 (0.0394 0.2479) 0.0861 (0.0200 0.2329) 0.1918 (0.0489 0.2549)
D_rhopaloa_bun-PB 0.1712 (0.0419 0.2448) 0.1872 (0.0442 0.2361) 0.1806 (0.0442 0.2449) 0.2061 (0.0395 0.1916) 0.2000 (0.0429 0.2147) 0.1522 (0.0356 0.2342) 0.2168 (0.0501 0.2310) 0.2345 (0.0500 0.2134)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
lnL(ntime: 13 np: 15): -1598.380834 +0.000000
10..1 10..11 11..2 11..3 10..12 12..13 13..4 13..14 14..6 14..7 14..8 14..9 12..5
0.014713 0.042893 0.005117 0.000004 0.061089 0.009818 0.038940 0.085824 0.096576 0.160161 0.135783 0.163444 0.063215 2.481497 0.181102
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87758
(1: 0.014713, (2: 0.005117, 3: 0.000004): 0.042893, ((4: 0.038940, (6: 0.096576, 7: 0.160161, 8: 0.135783, 9: 0.163444): 0.085824): 0.009818, 5: 0.063215): 0.061089);
(D_melanogaster_bun-PB: 0.014713, (D_sechellia_bun-PB: 0.005117, D_simulans_bun-PB: 0.000004): 0.042893, ((D_yakuba_bun-PB: 0.038940, (D_takahashii_bun-PB: 0.096576, D_biarmipes_bun-PB: 0.160161, D_eugracilis_bun-PB: 0.135783, D_rhopaloa_bun-PB: 0.163444): 0.085824): 0.009818, D_erecta_bun-PB: 0.063215): 0.061089);
Detailed output identifying parameters
kappa (ts/tv) = 2.48150
omega (dN/dS) = 0.18110
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.015 438.1 161.9 0.1811 0.0022 0.0122 1.0 2.0
10..11 0.043 438.1 161.9 0.1811 0.0064 0.0356 2.8 5.8
11..2 0.005 438.1 161.9 0.1811 0.0008 0.0042 0.3 0.7
11..3 0.000 438.1 161.9 0.1811 0.0000 0.0000 0.0 0.0
10..12 0.061 438.1 161.9 0.1811 0.0092 0.0506 4.0 8.2
12..13 0.010 438.1 161.9 0.1811 0.0015 0.0081 0.6 1.3
13..4 0.039 438.1 161.9 0.1811 0.0058 0.0323 2.6 5.2
13..14 0.086 438.1 161.9 0.1811 0.0129 0.0712 5.6 11.5
14..6 0.097 438.1 161.9 0.1811 0.0145 0.0801 6.4 13.0
14..7 0.160 438.1 161.9 0.1811 0.0240 0.1328 10.5 21.5
14..8 0.136 438.1 161.9 0.1811 0.0204 0.1126 8.9 18.2
14..9 0.163 438.1 161.9 0.1811 0.0245 0.1355 10.8 21.9
12..5 0.063 438.1 161.9 0.1811 0.0095 0.0524 4.2 8.5
tree length for dN: 0.1318
tree length for dS: 0.7276
Time used: 0:05
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
lnL(ntime: 13 np: 16): -1574.979545 +0.000000
10..1 10..11 11..2 11..3 10..12 12..13 13..4 13..14 14..6 14..7 14..8 14..9 12..5
0.015312 0.044686 0.005283 0.000004 0.063762 0.010292 0.040295 0.089032 0.099317 0.169988 0.140678 0.171533 0.065359 2.388050 0.840230 0.034282
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.91554
(1: 0.015312, (2: 0.005283, 3: 0.000004): 0.044686, ((4: 0.040295, (6: 0.099317, 7: 0.169988, 8: 0.140678, 9: 0.171533): 0.089032): 0.010292, 5: 0.065359): 0.063762);
(D_melanogaster_bun-PB: 0.015312, (D_sechellia_bun-PB: 0.005283, D_simulans_bun-PB: 0.000004): 0.044686, ((D_yakuba_bun-PB: 0.040295, (D_takahashii_bun-PB: 0.099317, D_biarmipes_bun-PB: 0.169988, D_eugracilis_bun-PB: 0.140678, D_rhopaloa_bun-PB: 0.171533): 0.089032): 0.010292, D_erecta_bun-PB: 0.065359): 0.063762);
Detailed output identifying parameters
kappa (ts/tv) = 2.38805
dN/dS (w) for site classes (K=2)
p: 0.84023 0.15977
w: 0.03428 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.015 438.7 161.3 0.1886 0.0024 0.0125 1.0 2.0
10..11 0.045 438.7 161.3 0.1886 0.0069 0.0366 3.0 5.9
11..2 0.005 438.7 161.3 0.1886 0.0008 0.0043 0.4 0.7
11..3 0.000 438.7 161.3 0.1886 0.0000 0.0000 0.0 0.0
10..12 0.064 438.7 161.3 0.1886 0.0099 0.0523 4.3 8.4
12..13 0.010 438.7 161.3 0.1886 0.0016 0.0084 0.7 1.4
13..4 0.040 438.7 161.3 0.1886 0.0062 0.0330 2.7 5.3
13..14 0.089 438.7 161.3 0.1886 0.0138 0.0730 6.0 11.8
14..6 0.099 438.7 161.3 0.1886 0.0153 0.0814 6.7 13.1
14..7 0.170 438.7 161.3 0.1886 0.0263 0.1393 11.5 22.5
14..8 0.141 438.7 161.3 0.1886 0.0217 0.1153 9.5 18.6
14..9 0.172 438.7 161.3 0.1886 0.0265 0.1406 11.6 22.7
12..5 0.065 438.7 161.3 0.1886 0.0101 0.0536 4.4 8.6
Time used: 0:13
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
lnL(ntime: 13 np: 18): -1573.957516 +0.000000
10..1 10..11 11..2 11..3 10..12 12..13 13..4 13..14 14..6 14..7 14..8 14..9 12..5
0.015941 0.045311 0.005359 0.000004 0.065282 0.010903 0.041131 0.092250 0.098911 0.175896 0.141083 0.177772 0.066053 2.409161 0.845909 0.143259 0.038328 4.287498
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.93590
(1: 0.015941, (2: 0.005359, 3: 0.000004): 0.045311, ((4: 0.041131, (6: 0.098911, 7: 0.175896, 8: 0.141083, 9: 0.177772): 0.092250): 0.010903, 5: 0.066053): 0.065282);
(D_melanogaster_bun-PB: 0.015941, (D_sechellia_bun-PB: 0.005359, D_simulans_bun-PB: 0.000004): 0.045311, ((D_yakuba_bun-PB: 0.041131, (D_takahashii_bun-PB: 0.098911, D_biarmipes_bun-PB: 0.175896, D_eugracilis_bun-PB: 0.141083, D_rhopaloa_bun-PB: 0.177772): 0.092250): 0.010903, D_erecta_bun-PB: 0.066053): 0.065282);
Detailed output identifying parameters
kappa (ts/tv) = 2.40916
dN/dS (w) for site classes (K=3)
p: 0.84591 0.14326 0.01083
w: 0.03833 1.00000 4.28750
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.016 438.5 161.5 0.2221 0.0027 0.0123 1.2 2.0
10..11 0.045 438.5 161.5 0.2221 0.0078 0.0350 3.4 5.7
11..2 0.005 438.5 161.5 0.2221 0.0009 0.0041 0.4 0.7
11..3 0.000 438.5 161.5 0.2221 0.0000 0.0000 0.0 0.0
10..12 0.065 438.5 161.5 0.2221 0.0112 0.0504 4.9 8.1
12..13 0.011 438.5 161.5 0.2221 0.0019 0.0084 0.8 1.4
13..4 0.041 438.5 161.5 0.2221 0.0071 0.0318 3.1 5.1
13..14 0.092 438.5 161.5 0.2221 0.0158 0.0713 6.9 11.5
14..6 0.099 438.5 161.5 0.2221 0.0170 0.0764 7.4 12.3
14..7 0.176 438.5 161.5 0.2221 0.0302 0.1359 13.2 21.9
14..8 0.141 438.5 161.5 0.2221 0.0242 0.1090 10.6 17.6
14..9 0.178 438.5 161.5 0.2221 0.0305 0.1373 13.4 22.2
12..5 0.066 438.5 161.5 0.2221 0.0113 0.0510 5.0 8.2
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PB)
Pr(w>1) post mean +- SE for w
146 A 0.854 3.806
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PB)
Pr(w>1) post mean +- SE for w
146 A 0.871 2.720 +- 1.818
179 S 0.678 2.256 +- 1.655
190 A 0.634 2.081 +- 1.484
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.399 0.291 0.132 0.069 0.040 0.025 0.017 0.012 0.009 0.007
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.005
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.011 0.541
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.089 0.323 0.029
sum of density on p0-p1 = 1.000000
Time used: 0:34
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
lnL(ntime: 13 np: 19): -1574.131701 +0.000000
10..1 10..11 11..2 11..3 10..12 12..13 13..4 13..14 14..6 14..7 14..8 14..9 12..5
0.015635 0.045183 0.005338 0.000004 0.064624 0.010660 0.040816 0.090351 0.100194 0.173795 0.142011 0.174987 0.066001 2.439895 0.139738 0.744814 0.051479 0.051481 1.518778
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.92960
(1: 0.015635, (2: 0.005338, 3: 0.000004): 0.045183, ((4: 0.040816, (6: 0.100194, 7: 0.173795, 8: 0.142011, 9: 0.174987): 0.090351): 0.010660, 5: 0.066001): 0.064624);
(D_melanogaster_bun-PB: 0.015635, (D_sechellia_bun-PB: 0.005338, D_simulans_bun-PB: 0.000004): 0.045183, ((D_yakuba_bun-PB: 0.040816, (D_takahashii_bun-PB: 0.100194, D_biarmipes_bun-PB: 0.173795, D_eugracilis_bun-PB: 0.142011, D_rhopaloa_bun-PB: 0.174987): 0.090351): 0.010660, D_erecta_bun-PB: 0.066001): 0.064624);
Detailed output identifying parameters
kappa (ts/tv) = 2.43990
dN/dS (w) for site classes (K=3)
p: 0.13974 0.74481 0.11545
w: 0.05148 0.05148 1.51878
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.016 438.4 161.6 0.2209 0.0027 0.0121 1.2 2.0
10..11 0.045 438.4 161.6 0.2209 0.0077 0.0350 3.4 5.7
11..2 0.005 438.4 161.6 0.2209 0.0009 0.0041 0.4 0.7
11..3 0.000 438.4 161.6 0.2209 0.0000 0.0000 0.0 0.0
10..12 0.065 438.4 161.6 0.2209 0.0110 0.0500 4.8 8.1
12..13 0.011 438.4 161.6 0.2209 0.0018 0.0082 0.8 1.3
13..4 0.041 438.4 161.6 0.2209 0.0070 0.0316 3.1 5.1
13..14 0.090 438.4 161.6 0.2209 0.0154 0.0699 6.8 11.3
14..6 0.100 438.4 161.6 0.2209 0.0171 0.0775 7.5 12.5
14..7 0.174 438.4 161.6 0.2209 0.0297 0.1345 13.0 21.7
14..8 0.142 438.4 161.6 0.2209 0.0243 0.1099 10.6 17.8
14..9 0.175 438.4 161.6 0.2209 0.0299 0.1354 13.1 21.9
12..5 0.066 438.4 161.6 0.2209 0.0113 0.0511 4.9 8.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PB)
Pr(w>1) post mean +- SE for w
3 T 0.960* 1.460
11 T 0.944 1.436
12 T 0.952* 1.448
13 V 0.933 1.420
119 L 0.962* 1.463
135 Q 0.944 1.436
145 Q 0.937 1.426
146 A 1.000** 1.519
161 V 0.932 1.419
164 S 0.998** 1.516
179 S 0.997** 1.514
182 S 0.945 1.438
190 A 0.999** 1.517
192 V 0.961* 1.461
193 V 0.998** 1.515
195 A 0.933 1.420
Time used: 0:52
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
lnL(ntime: 13 np: 16): -1575.738712 +0.000000
10..1 10..11 11..2 11..3 10..12 12..13 13..4 13..14 14..6 14..7 14..8 14..9 12..5
0.015280 0.044593 0.005278 0.000004 0.063532 0.010277 0.040031 0.088525 0.098842 0.168464 0.140157 0.170241 0.065094 2.374057 0.060565 0.256197
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.91032
(1: 0.015280, (2: 0.005278, 3: 0.000004): 0.044593, ((4: 0.040031, (6: 0.098842, 7: 0.168464, 8: 0.140157, 9: 0.170241): 0.088525): 0.010277, 5: 0.065094): 0.063532);
(D_melanogaster_bun-PB: 0.015280, (D_sechellia_bun-PB: 0.005278, D_simulans_bun-PB: 0.000004): 0.044593, ((D_yakuba_bun-PB: 0.040031, (D_takahashii_bun-PB: 0.098842, D_biarmipes_bun-PB: 0.168464, D_eugracilis_bun-PB: 0.140157, D_rhopaloa_bun-PB: 0.170241): 0.088525): 0.010277, D_erecta_bun-PB: 0.065094): 0.063532);
Detailed output identifying parameters
kappa (ts/tv) = 2.37406
Parameters in M7 (beta):
p = 0.06057 q = 0.25620
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00004 0.00122 0.01894 0.17804 0.71928 0.99511
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.015 438.7 161.3 0.1913 0.0024 0.0125 1.0 2.0
10..11 0.045 438.7 161.3 0.1913 0.0070 0.0364 3.1 5.9
11..2 0.005 438.7 161.3 0.1913 0.0008 0.0043 0.4 0.7
11..3 0.000 438.7 161.3 0.1913 0.0000 0.0000 0.0 0.0
10..12 0.064 438.7 161.3 0.1913 0.0099 0.0518 4.3 8.4
12..13 0.010 438.7 161.3 0.1913 0.0016 0.0084 0.7 1.4
13..4 0.040 438.7 161.3 0.1913 0.0062 0.0327 2.7 5.3
13..14 0.089 438.7 161.3 0.1913 0.0138 0.0722 6.1 11.6
14..6 0.099 438.7 161.3 0.1913 0.0154 0.0806 6.8 13.0
14..7 0.168 438.7 161.3 0.1913 0.0263 0.1374 11.5 22.2
14..8 0.140 438.7 161.3 0.1913 0.0219 0.1143 9.6 18.4
14..9 0.170 438.7 161.3 0.1913 0.0266 0.1389 11.7 22.4
12..5 0.065 438.7 161.3 0.1913 0.0102 0.0531 4.5 8.6
Time used: 1:28
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, (6, 7, 8, 9)), 5)); MP score: 147
check convergence..
lnL(ntime: 13 np: 18): -1574.139136 +0.000000
10..1 10..11 11..2 11..3 10..12 12..13 13..4 13..14 14..6 14..7 14..8 14..9 12..5
0.015634 0.045179 0.005338 0.000004 0.064617 0.010659 0.040808 0.090347 0.100173 0.173769 0.141983 0.174975 0.065994 2.439150 0.885672 5.518187 99.000000 1.525142
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.92948
(1: 0.015634, (2: 0.005338, 3: 0.000004): 0.045179, ((4: 0.040808, (6: 0.100173, 7: 0.173769, 8: 0.141983, 9: 0.174975): 0.090347): 0.010659, 5: 0.065994): 0.064617);
(D_melanogaster_bun-PB: 0.015634, (D_sechellia_bun-PB: 0.005338, D_simulans_bun-PB: 0.000004): 0.045179, ((D_yakuba_bun-PB: 0.040808, (D_takahashii_bun-PB: 0.100173, D_biarmipes_bun-PB: 0.173769, D_eugracilis_bun-PB: 0.141983, D_rhopaloa_bun-PB: 0.174975): 0.090347): 0.010659, D_erecta_bun-PB: 0.065994): 0.064617);
Detailed output identifying parameters
kappa (ts/tv) = 2.43915
Parameters in M8 (beta&w>1):
p0 = 0.88567 p = 5.51819 q = 99.00000
(p1 = 0.11433) w = 1.52514
dN/dS (w) for site classes (K=11)
p: 0.08857 0.08857 0.08857 0.08857 0.08857 0.08857 0.08857 0.08857 0.08857 0.08857 0.11433
w: 0.02245 0.03094 0.03691 0.04219 0.04733 0.05268 0.05858 0.06562 0.07512 0.09283 1.52514
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
10..1 0.016 438.4 161.6 0.2208 0.0027 0.0121 1.2 2.0
10..11 0.045 438.4 161.6 0.2208 0.0077 0.0350 3.4 5.7
11..2 0.005 438.4 161.6 0.2208 0.0009 0.0041 0.4 0.7
11..3 0.000 438.4 161.6 0.2208 0.0000 0.0000 0.0 0.0
10..12 0.065 438.4 161.6 0.2208 0.0110 0.0500 4.8 8.1
12..13 0.011 438.4 161.6 0.2208 0.0018 0.0082 0.8 1.3
13..4 0.041 438.4 161.6 0.2208 0.0070 0.0316 3.1 5.1
13..14 0.090 438.4 161.6 0.2208 0.0154 0.0699 6.8 11.3
14..6 0.100 438.4 161.6 0.2208 0.0171 0.0775 7.5 12.5
14..7 0.174 438.4 161.6 0.2208 0.0297 0.1345 13.0 21.7
14..8 0.142 438.4 161.6 0.2208 0.0243 0.1099 10.6 17.8
14..9 0.175 438.4 161.6 0.2208 0.0299 0.1354 13.1 21.9
12..5 0.066 438.4 161.6 0.2208 0.0113 0.0511 4.9 8.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PB)
Pr(w>1) post mean +- SE for w
3 T 0.953* 1.457
11 T 0.934 1.429
12 T 0.944 1.443
13 V 0.922 1.411
119 L 0.955* 1.459
135 Q 0.934 1.429
145 Q 0.926 1.418
146 A 1.000** 1.525
161 V 0.921 1.410
164 S 0.997** 1.521
179 S 0.996** 1.519
182 S 0.936 1.431
190 A 0.998** 1.523
192 V 0.954* 1.458
193 V 0.996** 1.520
195 A 0.921 1.411
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_bun-PB)
Pr(w>1) post mean +- SE for w
3 T 0.532 1.454 +- 1.009
146 A 0.972* 2.336 +- 0.868
164 S 0.758 1.923 +- 0.960
179 S 0.867 2.166 +- 0.975
190 A 0.859 2.144 +- 0.963
192 V 0.539 1.471 +- 1.016
193 V 0.717 1.843 +- 0.973
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.072 0.928
p : 0.948 0.051 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.024 0.107 0.161 0.166 0.151 0.135 0.128 0.128
ws: 0.340 0.509 0.117 0.023 0.006 0.002 0.001 0.001 0.000 0.000
Time used: 3:10
Model 1: NearlyNeutral -1574.979545 Model 2: PositiveSelection -1573.957516 Model 0: one-ratio -1598.380834 Model 3: discrete -1574.131701 Model 7: beta -1575.738712 Model 8: beta&w>1 -1574.139136 Model 0 vs 1 46.80257800000027 Model 2 vs 1 2.04405799999995 Model 8 vs 7 3.19915200000014
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
