Bsg-PI - ClustalW2

--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 18 11:25:41 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/27/Bsg-PI/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2170.37         -2182.12
2      -2170.31         -2182.62
--------------------------------------
TOTAL    -2170.34         -2182.40
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.296725    0.000675    0.245401    0.344745    0.295780   1344.42   1422.71    1.000
r(A<->C){all}   0.120200    0.000650    0.070784    0.168646    0.119392    909.09    987.91    1.000
r(A<->G){all}   0.239513    0.001193    0.175024    0.307715    0.238396    923.33    927.48    1.000
r(A<->T){all}   0.135747    0.000721    0.084164    0.188177    0.134125   1025.45   1038.76    1.001
r(C<->G){all}   0.117920    0.000676    0.071020    0.172710    0.115986   1160.32   1180.84    1.000
r(C<->T){all}   0.309875    0.001541    0.234620    0.387386    0.309105    923.16    940.72    1.000
r(G<->T){all}   0.076746    0.000445    0.039363    0.120003    0.075351   1191.63   1224.99    1.001
pi(A){all}      0.278964    0.000226    0.250224    0.308742    0.278930   1311.63   1345.58    1.000
pi(C){all}      0.232562    0.000190    0.206309    0.259725    0.232253   1174.23   1238.77    1.000
pi(G){all}      0.248120    0.000211    0.218584    0.274629    0.247951   1136.20   1147.11    1.000
pi(T){all}      0.240354    0.000204    0.213288    0.268990    0.240204   1352.34   1353.81    1.000
alpha{1,2}      0.622238    0.104769    0.166565    1.267592    0.544318   1483.16   1488.64    1.000
alpha{3}        1.225757    0.381416    0.367951    2.461108    1.109182   1501.00   1501.00    1.000
pinvar{all}     0.142587    0.010385    0.000038    0.337315    0.125752   1273.30   1327.26    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2058.257957
Model 2: PositiveSelection	-2049.661589
Model 0: one-ratio	-2091.170808
Model 3: discrete	-2049.661589
Model 7: beta	-2058.259997
Model 8: beta&w>1	-2049.661589


Model 0 vs 1	65.82570200000009

Model 2 vs 1	17.192735999999968

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      1.000**       2.171
     7 A      1.000**       2.171
     8 S      1.000**       2.171
     9 A      1.000**       2.171
    10 L      1.000**       2.171
    11 S      1.000**       2.171
    12 F      1.000**       2.171
    13 L      1.000**       2.171
    20 Y      1.000**       2.171
    34 A      1.000**       2.171
    35 E      1.000**       2.171
    44 R      1.000**       2.171
    45 S      1.000**       2.171
    55 G      1.000**       2.171
    57 P      1.000**       2.171
    58 G      1.000**       2.171
    59 V      1.000**       2.171
    63 K      1.000**       2.171
    66 G      1.000**       2.171
    68 A      1.000**       2.171
    71 D      1.000**       2.171
    73 P      1.000**       2.171
    76 R      1.000**       2.171
    81 L      1.000**       2.171
    83 A      1.000**       2.171
    84 D      1.000**       2.171
    95 T      1.000**       2.171
    96 N      1.000**       2.171
   100 K      1.000**       2.171
   104 E      1.000**       2.171
   105 F      1.000**       2.171
   106 D      1.000**       2.171
   107 G      1.000**       2.171
   108 V      1.000**       2.171
   109 S      1.000**       2.171
   110 K      1.000**       2.171
   111 E      1.000**       2.171
   113 E      1.000**       2.171
   119 V      1.000**       2.171
   139 S      1.000**       2.171
   144 K      1.000**       2.171
   146 E      1.000**       2.171
   148 T      1.000**       2.171
   152 A      1.000**       2.171
   159 A      1.000**       2.171
   163 F      1.000**       2.171
   164 I      1.000**       2.171
   165 L      1.000**       2.171
   167 P      1.000**       2.171
   168 N      1.000**       2.171
   169 G      1.000**       2.171
   178 D      1.000**       2.171
   183 D      1.000**       2.171
   187 E      1.000**       2.171
   191 I      1.000**       2.171
   193 R      1.000**       2.171
   197 N      1.000**       2.171
   198 V      1.000**       2.171
   199 Y      1.000**       2.171
   200 G      1.000**       2.171
   201 G      1.000**       2.171
   203 T      1.000**       2.171
   205 T      1.000**       2.171
   206 P      1.000**       2.171
   208 S      1.000**       2.171
   210 V      1.000**       2.171
   213 V      1.000**       2.171
   217 G      1.000**       2.171

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      0.593         1.868 +- 1.097
     7 A      0.805         2.401 +- 0.837
     8 S      0.927         2.669 +- 0.696
     9 A      0.799         2.388 +- 0.840
    10 L      0.566         1.802 +- 1.105
    11 S      0.920         2.657 +- 0.721
    13 L      0.806         2.403 +- 0.835
    20 Y      0.575         1.824 +- 1.103
    34 A      0.766         2.315 +- 0.865
    35 E      0.748         2.275 +- 0.874
    44 R      0.551         1.764 +- 1.108
    45 S      0.971*        2.763 +- 0.627
    55 G      0.801         2.393 +- 0.843
    57 P      0.612         1.915 +- 1.091
    66 G      0.761         2.304 +- 0.863
    68 A      0.804         2.398 +- 0.837
    71 D      0.770         2.325 +- 0.862
    73 P      0.600         1.885 +- 1.095
    76 R      0.828         2.454 +- 0.822
    81 L      0.722         2.186 +- 1.018
    83 A      0.944         2.707 +- 0.674
    95 T      0.844         2.490 +- 0.807
    96 N      0.943         2.703 +- 0.672
   100 K      0.981*        2.783 +- 0.603
   104 E      0.779         2.344 +- 0.855
   105 F      0.786         2.360 +- 0.852
   106 D      0.867         2.534 +- 0.764
   107 G      0.591         1.864 +- 1.098
   108 V      0.749         2.278 +- 0.872
   109 S      0.548         1.758 +- 1.109
   110 K      0.644         1.999 +- 1.048
   111 E      0.933         2.683 +- 0.689
   113 E      0.806         2.402 +- 0.836
   144 K      0.972*        2.765 +- 0.622
   146 E      0.524         1.699 +- 1.113
   148 T      0.856         2.514 +- 0.795
   159 A      0.926         2.666 +- 0.700
   163 F      0.793         2.374 +- 0.844
   165 L      0.515         1.676 +- 1.114
   167 P      0.654         2.017 +- 1.072
   169 G      0.808         2.409 +- 0.834
   183 D      0.895         2.597 +- 0.738
   193 R      0.802         2.380 +- 0.925
   198 V      0.887         2.580 +- 0.747
   199 Y      0.808         2.407 +- 0.834
   200 G      0.527         1.706 +- 1.112
   201 G      0.922         2.658 +- 0.705
   203 T      0.893         2.593 +- 0.737
   205 T      0.809         2.410 +- 0.834
   206 P      0.598         1.879 +- 1.096
   208 S      0.764         2.310 +- 0.861
   210 V      0.970*        2.761 +- 0.626
   213 V      0.510         1.662 +- 1.122


Model 8 vs 7	17.19681600000058

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      1.000**       2.171
     7 A      1.000**       2.171
     8 S      1.000**       2.171
     9 A      1.000**       2.171
    10 L      1.000**       2.171
    11 S      1.000**       2.171
    12 F      1.000**       2.171
    13 L      1.000**       2.171
    20 Y      1.000**       2.171
    34 A      1.000**       2.171
    35 E      1.000**       2.171
    44 R      1.000**       2.171
    45 S      1.000**       2.171
    55 G      1.000**       2.171
    57 P      1.000**       2.171
    58 G      1.000**       2.171
    59 V      1.000**       2.171
    63 K      1.000**       2.171
    66 G      1.000**       2.171
    68 A      1.000**       2.171
    71 D      1.000**       2.171
    73 P      1.000**       2.171
    76 R      1.000**       2.171
    81 L      1.000**       2.171
    83 A      1.000**       2.171
    84 D      1.000**       2.171
    95 T      1.000**       2.171
    96 N      1.000**       2.171
   100 K      1.000**       2.171
   104 E      1.000**       2.171
   105 F      1.000**       2.171
   106 D      1.000**       2.171
   107 G      1.000**       2.171
   108 V      1.000**       2.171
   109 S      1.000**       2.171
   110 K      1.000**       2.171
   111 E      1.000**       2.171
   113 E      1.000**       2.171
   119 V      1.000**       2.171
   139 S      1.000**       2.171
   144 K      1.000**       2.171
   146 E      1.000**       2.171
   148 T      1.000**       2.171
   152 A      1.000**       2.171
   159 A      1.000**       2.171
   163 F      1.000**       2.171
   164 I      1.000**       2.171
   165 L      1.000**       2.171
   167 P      1.000**       2.171
   168 N      1.000**       2.171
   169 G      1.000**       2.171
   178 D      1.000**       2.171
   183 D      1.000**       2.171
   187 E      1.000**       2.171
   191 I      1.000**       2.171
   193 R      1.000**       2.171
   197 N      1.000**       2.171
   198 V      1.000**       2.171
   199 Y      1.000**       2.171
   200 G      1.000**       2.171
   201 G      1.000**       2.171
   203 T      1.000**       2.171
   205 T      1.000**       2.171
   206 P      1.000**       2.171
   208 S      1.000**       2.171
   210 V      1.000**       2.171
   213 V      1.000**       2.171
   217 G      1.000**       2.171

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      0.667         1.858 +- 1.109
     7 A      0.906         2.447 +- 0.691
     8 S      0.980*        2.615 +- 0.469
     9 A      0.903         2.439 +- 0.698
    10 L      0.638         1.789 +- 1.128
    11 S      0.969*        2.592 +- 0.516
    12 F      0.524         1.510 +- 1.165
    13 L      0.908         2.450 +- 0.687
    20 Y      0.648         1.812 +- 1.122
    34 A      0.878         2.381 +- 0.751
    35 E      0.865         2.350 +- 0.775
    44 R      0.622         1.749 +- 1.136
    45 S      0.993**       2.643 +- 0.419
    55 G      0.902         2.437 +- 0.702
    57 P      0.686         1.906 +- 1.094
    58 G      0.509         1.473 +- 1.166
    59 V      0.564         1.607 +- 1.160
    63 K      0.534         1.534 +- 1.164
    66 G      0.877         2.379 +- 0.750
    68 A      0.906         2.446 +- 0.692
    71 D      0.881         2.389 +- 0.745
    73 P      0.674         1.876 +- 1.104
    76 R      0.920         2.479 +- 0.661
    81 L      0.797         2.178 +- 0.965
    83 A      0.985*        2.626 +- 0.451
    95 T      0.930         2.502 +- 0.635
    96 N      0.985*        2.627 +- 0.448
   100 K      0.996**       2.650 +- 0.404
   104 E      0.889         2.406 +- 0.729
   105 F      0.893         2.415 +- 0.722
   106 D      0.957*        2.563 +- 0.541
   107 G      0.665         1.854 +- 1.110
   108 V      0.866         2.354 +- 0.772
   109 S      0.619         1.742 +- 1.138
   110 K      0.730         2.014 +- 1.040
   111 E      0.981*        2.619 +- 0.463
   113 E      0.907         2.449 +- 0.688
   119 V      0.547         1.566 +- 1.163
   144 K      0.994**       2.646 +- 0.412
   146 E      0.593         1.678 +- 1.149
   148 T      0.937         2.518 +- 0.615
   152 A      0.555         1.584 +- 1.162
   159 A      0.979*        2.613 +- 0.472
   163 F      0.899         2.430 +- 0.706
   165 L      0.583         1.653 +- 1.153
   167 P      0.728         2.009 +- 1.056
   169 G      0.909         2.453 +- 0.685
   183 D      0.967*        2.588 +- 0.510
   187 E      0.556         1.587 +- 1.160
   193 R      0.873         2.363 +- 0.819
   198 V      0.964*        2.581 +- 0.520
   199 Y      0.909         2.453 +- 0.685
   200 G      0.596         1.686 +- 1.148
   201 G      0.977*        2.610 +- 0.477
   203 T      0.967*        2.588 +- 0.509
   205 T      0.909         2.454 +- 0.684
   206 P      0.672         1.870 +- 1.105
   208 S      0.879         2.383 +- 0.747
   210 V      0.994**       2.645 +- 0.415
   213 V      0.574         1.632 +- 1.159

>C1
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
NVYGGNTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR
NKSELEESDTDPQEQ
>C2
MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVHGGNTTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR
NKSELEESDTDPQEQ
>C3
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVYGGNTTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR
NKSELEESDTDPQEQ
>C4
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD
GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFGNVTLTNDTDRVIVKPDNGVPNAILTLDNVTLDDRGEYKCTGKNAAN
EYAKNTTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEKRRN
KSELEESDTDPQEQo
>C5
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
DAFGGNNTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR
NKSELEESDTDPQEQ
>C6
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS
CNVKDTPGVLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDDGL
YSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLSWT
FGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAAND
YGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR
NKSELEESDTDPQEQ
>C7
MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS
CNVKEDTSSVLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDDG
DYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLIW
TFGNVTLTNSTDRFVLKPENNVPNAILTLDNVTLQDRGEYKCIGRNAAND
YGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR
NKSELEESDTDPQEQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 

C1              MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS
C2              MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS
C3              MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS
C4              MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
C5              MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
C6              MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS
C7              MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS
                *****  . :   ****** *************  ********: *****

C1              CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD
C2              CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD
C3              CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
C4              CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD
C5              CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
C6              CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD
C7              CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD
                **** .*.. :***:**.* **:*.** ****:*  **********..**

C1              GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
C2              GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
C3              GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT
C4              GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
C5              GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
C6              GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS
C7              GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI
                * ***. .  :: * *****:*******************:**** *:* 

C1              WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
C2              WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
C3              WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
C4              WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA
C5              WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
C6              WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA
C7              WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA
                ***.****** *** ::*.  :.********:****:***:*** *:***

C1              NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
C2              NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
C3              NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
C4              NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK
C5              DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
C6              NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
C7              NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
                : .. *  .*: * * **:***.***************************

C1              RRNKSELEESDTDPQEQ-
C2              RRNKSELEESDTDPQEQ-
C3              RRNKSELEESDTDPQEQ-
C4              RRNKSELEESDTDPQEQo
C5              RRNKSELEESDTDPQEQ-
C6              RRNKSELEESDTDPQEQ-
C7              RRNKSELEESDTDPQEQ-
                ***************** 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 ns       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  265 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  265 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11760]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [11760]--->[11602]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/27/Bsg-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.400 Mb, Max= 30.799 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C2
MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C3
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C4
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD
GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA
NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQo
>C5
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C6
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS
CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD
GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS
WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA
NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C7
MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS
CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD
GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI
WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA
NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-

FORMAT of file /tmp/tmp5396945050589792575aln Not Supported[FATAL:T-COFFEE]
>C1
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C2
MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C3
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C4
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD
GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA
NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQo
>C5
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C6
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS
CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD
GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS
WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA
NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
>C7
MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS
CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD
GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI
WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA
NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ-
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:268 S:99 BS:268
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES 
BOT	    0    1	 93.21 C1	 C2	 93.21
TOP	    1    0	 93.21 C2	 C1	 93.21
BOT	    0    2	 97.36 C1	 C3	 97.36
TOP	    2    0	 97.36 C3	 C1	 97.36
BOT	    0    3	 88.64 C1	 C4	 88.64
TOP	    3    0	 88.64 C4	 C1	 88.64
BOT	    0    4	 96.60 C1	 C5	 96.60
TOP	    4    0	 96.60 C5	 C1	 96.60
BOT	    0    5	 85.93 C1	 C6	 85.93
TOP	    5    0	 85.93 C6	 C1	 85.93
BOT	    0    6	 86.69 C1	 C7	 86.69
TOP	    6    0	 86.69 C7	 C1	 86.69
BOT	    1    2	 94.72 C2	 C3	 94.72
TOP	    2    1	 94.72 C3	 C2	 94.72
BOT	    1    3	 84.47 C2	 C4	 84.47
TOP	    3    1	 84.47 C4	 C2	 84.47
BOT	    1    4	 91.70 C2	 C5	 91.70
TOP	    4    1	 91.70 C5	 C2	 91.70
BOT	    1    5	 81.75 C2	 C6	 81.75
TOP	    5    1	 81.75 C6	 C2	 81.75
BOT	    1    6	 84.03 C2	 C7	 84.03
TOP	    6    1	 84.03 C7	 C2	 84.03
BOT	    2    3	 87.50 C3	 C4	 87.50
TOP	    3    2	 87.50 C4	 C3	 87.50
BOT	    2    4	 94.72 C3	 C5	 94.72
TOP	    4    2	 94.72 C5	 C3	 94.72
BOT	    2    5	 85.55 C3	 C6	 85.55
TOP	    5    2	 85.55 C6	 C3	 85.55
BOT	    2    6	 87.07 C3	 C7	 87.07
TOP	    6    2	 87.07 C7	 C3	 87.07
BOT	    3    4	 88.64 C4	 C5	 88.64
TOP	    4    3	 88.64 C5	 C4	 88.64
BOT	    3    5	 82.82 C4	 C6	 82.82
TOP	    5    3	 82.82 C6	 C4	 82.82
BOT	    3    6	 82.44 C4	 C7	 82.44
TOP	    6    3	 82.44 C7	 C4	 82.44
BOT	    4    5	 85.55 C5	 C6	 85.55
TOP	    5    4	 85.55 C6	 C5	 85.55
BOT	    4    6	 87.07 C5	 C7	 87.07
TOP	    6    4	 87.07 C7	 C5	 87.07
BOT	    5    6	 87.88 C6	 C7	 87.88
TOP	    6    5	 87.88 C7	 C6	 87.88
AVG	 0	 C1	  *	 91.40
AVG	 1	 C2	  *	 88.31
AVG	 2	 C3	  *	 91.15
AVG	 3	 C4	  *	 85.75
AVG	 4	 C5	  *	 90.71
AVG	 5	 C6	  *	 84.91
AVG	 6	 C7	  *	 85.86
TOT	 TOT	  *	 88.30
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
C2              ATGGAGGCAAAATTCTGGCTAGCGCTCTTTCATTCCTCCTCGATATTTTT
C3              ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
C4              ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
C5              ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
C6              ATGGAGGCGAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
C7              ATGGAGGCAAAATTCTTGGCTGGCGCTCTTTCATTCCTCTCGATATTTTT
                ********.******* *  :.      ** .:* *  ************

C1              AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
C2              AGCAATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG
C3              AGCGATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG
C4              AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
C5              AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
C6              AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA
C7              AGCGATTAATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA
                ***.***:******************** ********************.

C1              CCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
C2              CCATGCATCAAATGAAATTTTACGACATCAGATCGCCACTCGTTCTCAGC
C3              CCAAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
C4              TCGAACATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
C5              TCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
C6              TCGAGCATCAAATGAAATTTTACGACATCAGACACCCGCTGGTTCTCAGC
C7              TCGAGCATCAAATGAAATTTTACGACATCAAAACGCCGCTGGTTCTCAGC
                 *.:.*************************.* . **.** *********

C1              TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
C2              TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
C3              TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
C4              TGCAACGTGAAAGACAGTACGCCGGGCGGCCTGCTCATATGGAGAAAGAA
C5              TGCAACGTGAAAGACGGTACGCCAGGCGGCGTGCTCATATGGAAAAAGAA
C6              TGCAACGTGAAA---GACACGCCGGGC---GTGCTTATATGGAAAAAGAA
C7              TGCAACGTGAAAGAAGATACGTCGAGC---GTTCTTATATGGAAAAAGAA
                ************   .. *** *..**    * ** *******.******

C1              CGGCACCGCTGTGACGGATGTACCTTCTCTCAGAGGTCGCTTTAAGTTAA
C2              CGGCACCGCTGTGACGGAGGTACCTTCTCTAATAGGTCGCTTTAAGTTAA
C3              CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA
C4              CGGCACCGTTGTGACGGAAGTAGCTTCTCTAAGAGGTCGCTTTAAGTTAA
C5              CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA
C6              CAACACCGATGTGACGCAGGTGCCTTCGCTGAAAGGTCGCTTTAAGCTAA
C7              CGGCACCGCTGTGACGGAGGTGCCTTCGCTAAAGGGTCGCTTTAAGATAA
                *..***** ******* * **. **** ** * .************ ***

C1              TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT
C2              TCCCAGACGAGAATAAGTTCATCATCGATAAGACGGATACGAACGACGAT
C3              TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT
C4              TCCCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGACCGACGAT
C5              TCGCAGACGAGAACAAGTTTATCATCGATAAGACGGATACGAACGACGAT
C6              TCGAAGCCGAGAACAAGTTCATCATCGACAAGACGGACGCATCCGACGAT
C7              TCGCAGCCGAGAATAAGTTCATCATCGACAAGACGGATGTAAGCGATGAT
                ** .**.****** ***** ******** ******** . .: *** ***

C1              GGCAAATACAGTTGCGAGTTTGACGGCGTGTCCAAGGAAATCGAAGTAAT
C2              GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT
C3              GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT
C4              GGCGAATACAGTTGCGAGTACAGTGGAGAGACCAAGAAAATCGAAGTAAT
C5              GGCAAATACAGTTGCGAGTTCGACGGAGTGTCCAAGGAAATCGAAGTGAT
C6              GGTCTTTACAGTTGCTCGATCAACGAAGAGTCCCGGAATATCACAGTGAT
C7              GGCGATTACAGTTGCGAGATCGACGGAGAGTCCAAGATAATCAAAGTGAT
                **  ::********* .*:: .. *..*:*:**..*.::***..***.**

C1              TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
C2              TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
C3              TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
C4              TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
C5              TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
C6              TGCCCGCGTTATTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
C7              TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGAG
                **********.*****.*******************************:*

C1              AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAAACCAGAGTTGACA
C2              AAAAGATGTCGGTGACCTGCAGTGTTGTGGGTACCAAACCAGAGTTGACA
C3              AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAATCCAGAGTTGACA
C4              AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCACAGTTGACA
C5              AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCTCAGTTGACA
C6              AGAAGATGTCGGTGACCTGCAGCGTTGTTGGTACCGATCCCCAGTTGTCA
C7              AGAAGATGTCGGTGACTTGCACCGTTGTGGGTACCGCACCACAGTTGATA
                *.************** ****  ***** **:***..:**  *****: *

C1              TGGACCTTTGCCAATGTAACGCTGACAAATGCCACAGATCGCTTCATTCT
C2              TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT
C3              TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT
C4              TGGACCTTTGGCAATGTAACGCTGACAAACGACACAGATCGCGTCATCGT
C5              TGGACCTTTGCCAATGTAACGCTGACAAACGGCACAGATCGCTTCATCCT
C6              TGGACCTTTGGCAATGTAACGCTGACAAACTCCACAGATCGTTACATCCT
C7              TGGACTTTTGGCAATGTAACGCTGACAAACTCAACGGATCGCTTCGTCCT
                ***** **** ******************   .**.*****  :*.*  *

C1              CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGATAATG
C2              CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG
C3              CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG
C4              CAAACCAGAT---AATGGTGTTCCTAACGCCATTCTGACACTGGACAATG
C5              CAAACCAGACGATAATGGTGTTCCCAACGCCATTCTGACACTGGATAATG
C6              CAAGGCGGACGAGGACAATGTCCCCAACGCCATTCTGACATTGGACAATG
C7              CAAACCA---GAAAACAATGTCCCCAACGCCATTCTGACACTGGACAATG
                ***. *.      .* ..*** ** *************** **** ****

C1              TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
C2              TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
C3              TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
C4              TGACATTGGACGACAGAGGCGAATACAAATGCACTGGAAAAAATGCGGCC
C5              TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
C6              TGACATTGGACGACAGAGGCGACTACAAATGCATTGGACGCAATGCGGCC
C7              TGACATTGCAAGACAGAGGCGAGTACAAATGCATTGGACGCAATGCGGCC
                ******** *.*********** ********** ****...*********

C1              AATGTCTACGGTGGGAAC------ACCACCACTCCTGCCAGCGACGTCAC
C2              AATGTCCACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACTTCAC
C3              AATGTCTACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACGTCAC
C4              AATGAATACGCTAAGAAC------ACCACTACTCTTGCCACCGACGCCAC
C5              GATGCCTTCGGTGGGAAC------AACACCACTCCTGCCAGCGACTTCAC
C6              AATGACTACGGTGTGAATGGCACCAACACCGCCCCTGCCATCGACGTCAC
C7              AATGACTATGGTGTGAACGGCACCAGCACTGCTCCTGCCAGCGACTTCAC
                .*** . : * *. ***       * *** .* * ***** ****  ***

C1              AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
C2              AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
C3              AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
C4              AACTCTTCGTGTTAAGAGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
C5              AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
C6              AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
C7              AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
                **** * *********.*********************************

C1              TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
C2              TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
C3              TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
C4              TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
C5              TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
C6              TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTACGAGAAG
C7              TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTATGAGAAG
                **************************************** ** ******

C1              CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
C2              CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
C3              CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
C4              CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
C5              CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
C6              CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
C7              CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCTCAAGAACA
                ***************************************** ********

C1              G---
C2              G---
C3              G---
C4              G---
C5              G---
C6              G---
C7              G---
                *   



>C1
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
CCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGATGTACCTTCTCTCAGAGGTCGCTTTAAGTTAA
TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTTGACGGCGTGTCCAAGGAAATCGAAGTAAT
TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAAACCAGAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAATGCCACAGATCGCTTCATTCT
CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGATAATG
TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
AATGTCTACGGTGGGAAC------ACCACCACTCCTGCCAGCGACGTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>C2
ATGGAGGCAAAATTCTGGCTAGCGCTCTTTCATTCCTCCTCGATATTTTT
AGCAATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG
CCATGCATCAAATGAAATTTTACGACATCAGATCGCCACTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTACCTTCTCTAATAGGTCGCTTTAAGTTAA
TCCCAGACGAGAATAAGTTCATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT
TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AAAAGATGTCGGTGACCTGCAGTGTTGTGGGTACCAAACCAGAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT
CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG
TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
AATGTCCACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACTTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>C3
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG
CCAAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA
TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT
TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAATCCAGAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT
CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG
TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
AATGTCTACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACGTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>C4
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
TCGAACATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACAGTACGCCGGGCGGCCTGCTCATATGGAGAAAGAA
CGGCACCGTTGTGACGGAAGTAGCTTCTCTAAGAGGTCGCTTTAAGTTAA
TCCCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGACCGACGAT
GGCGAATACAGTTGCGAGTACAGTGGAGAGACCAAGAAAATCGAAGTAAT
TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCACAGTTGACA
TGGACCTTTGGCAATGTAACGCTGACAAACGACACAGATCGCGTCATCGT
CAAACCAGAT---AATGGTGTTCCTAACGCCATTCTGACACTGGACAATG
TGACATTGGACGACAGAGGCGAATACAAATGCACTGGAAAAAATGCGGCC
AATGAATACGCTAAGAAC------ACCACTACTCTTGCCACCGACGCCAC
AACTCTTCGTGTTAAGAGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>C5
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
TCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCAGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA
TCGCAGACGAGAACAAGTTTATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTCGACGGAGTGTCCAAGGAAATCGAAGTGAT
TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCTCAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAACGGCACAGATCGCTTCATCCT
CAAACCAGACGATAATGGTGTTCCCAACGCCATTCTGACACTGGATAATG
TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
GATGCCTTCGGTGGGAAC------AACACCACTCCTGCCAGCGACTTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>C6
ATGGAGGCGAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA
TCGAGCATCAAATGAAATTTTACGACATCAGACACCCGCTGGTTCTCAGC
TGCAACGTGAAA---GACACGCCGGGC---GTGCTTATATGGAAAAAGAA
CAACACCGATGTGACGCAGGTGCCTTCGCTGAAAGGTCGCTTTAAGCTAA
TCGAAGCCGAGAACAAGTTCATCATCGACAAGACGGACGCATCCGACGAT
GGTCTTTACAGTTGCTCGATCAACGAAGAGTCCCGGAATATCACAGTGAT
TGCCCGCGTTATTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AGAAGATGTCGGTGACCTGCAGCGTTGTTGGTACCGATCCCCAGTTGTCA
TGGACCTTTGGCAATGTAACGCTGACAAACTCCACAGATCGTTACATCCT
CAAGGCGGACGAGGACAATGTCCCCAACGCCATTCTGACATTGGACAATG
TGACATTGGACGACAGAGGCGACTACAAATGCATTGGACGCAATGCGGCC
AATGACTACGGTGTGAATGGCACCAACACCGCCCCTGCCATCGACGTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTACGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>C7
ATGGAGGCAAAATTCTTGGCTGGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTAATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA
TCGAGCATCAAATGAAATTTTACGACATCAAAACGCCGCTGGTTCTCAGC
TGCAACGTGAAAGAAGATACGTCGAGC---GTTCTTATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTGCCTTCGCTAAAGGGTCGCTTTAAGATAA
TCGCAGCCGAGAATAAGTTCATCATCGACAAGACGGATGTAAGCGATGAT
GGCGATTACAGTTGCGAGATCGACGGAGAGTCCAAGATAATCAAAGTGAT
TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGAG
AGAAGATGTCGGTGACTTGCACCGTTGTGGGTACCGCACCACAGTTGATA
TGGACTTTTGGCAATGTAACGCTGACAAACTCAACGGATCGCTTCGTCCT
CAAACCA---GAAAACAATGTCCCCAACGCCATTCTGACACTGGACAATG
TGACATTGCAAGACAGAGGCGAGTACAAATGCATTGGACGCAATGCGGCC
AATGACTATGGTGTGAACGGCACCAGCACTGCTCCTGCCAGCGACTTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCTCAAGAACA
G---
>C1
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
NVYGGNooTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>C2
MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVHGGNooTTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>C3
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVYGGNooTTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>C4
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD
GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFGNVTLTNDTDRVIVKPDoNGVPNAILTLDNVTLDDRGEYKCTGKNAA
NEYAKNooTTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>C5
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
DAFGGNooNTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>C6
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS
CNVKoDTPGoVLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD
GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS
WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA
NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>C7
MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS
CNVKEDTSSoVLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD
GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI
WTFGNVTLTNSTDRFVLKPoENNVPNAILTLDNVTLQDRGEYKCIGRNAA
NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 7 taxa and 804 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479467836
      Setting output file names to "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 809390388
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8781855650
      Seed = 383033687
      Swapseed = 1479467836
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 50 unique site patterns
      Division 2 has 48 unique site patterns
      Division 3 has 56 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2681.062997 -- -24.557203
         Chain 2 -- -2709.228202 -- -24.557203
         Chain 3 -- -2610.687687 -- -24.557203
         Chain 4 -- -2709.459878 -- -24.557203

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2710.098709 -- -24.557203
         Chain 2 -- -2715.676906 -- -24.557203
         Chain 3 -- -2733.034151 -- -24.557203
         Chain 4 -- -2731.775893 -- -24.557203


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2681.063] (-2709.228) (-2610.688) (-2709.460) * [-2710.099] (-2715.677) (-2733.034) (-2731.776) 
        500 -- [-2185.020] (-2195.796) (-2188.380) (-2184.074) * (-2186.458) [-2186.864] (-2191.697) (-2192.223) -- 0:33:19
       1000 -- (-2183.177) [-2184.393] (-2179.839) (-2178.155) * (-2182.841) (-2179.663) (-2180.695) [-2182.177] -- 0:16:39
       1500 -- (-2180.272) (-2188.923) (-2180.140) [-2176.564] * (-2173.379) (-2172.495) [-2178.194] (-2177.997) -- 0:11:05
       2000 -- (-2171.859) (-2177.863) (-2175.391) [-2173.641] * [-2175.540] (-2176.542) (-2180.952) (-2171.260) -- 0:08:19
       2500 -- (-2168.277) (-2184.380) [-2177.019] (-2184.096) * (-2175.401) (-2181.509) (-2180.808) [-2169.065] -- 0:06:39
       3000 -- (-2180.349) (-2178.353) [-2172.164] (-2175.093) * (-2175.613) [-2175.464] (-2180.246) (-2173.367) -- 0:11:04
       3500 -- (-2170.670) (-2173.804) (-2170.322) [-2177.355] * [-2172.007] (-2174.850) (-2182.844) (-2177.180) -- 0:09:29
       4000 -- (-2174.331) [-2172.354] (-2181.800) (-2177.955) * (-2179.118) [-2169.245] (-2189.391) (-2181.392) -- 0:08:18
       4500 -- (-2179.990) (-2173.120) (-2182.165) [-2169.493] * (-2175.963) (-2175.968) (-2176.749) [-2180.116] -- 0:07:22
       5000 -- (-2176.624) [-2173.546] (-2180.569) (-2168.952) * [-2171.940] (-2167.702) (-2170.652) (-2180.414) -- 0:06:38

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-2174.385) [-2174.404] (-2175.162) (-2175.071) * (-2186.122) (-2175.985) (-2177.439) [-2172.932] -- 0:06:01
       6000 -- (-2178.225) (-2172.807) (-2175.335) [-2172.670] * [-2172.209] (-2173.259) (-2178.542) (-2181.600) -- 0:05:31
       6500 -- (-2171.426) (-2171.186) (-2178.714) [-2174.650] * (-2175.244) [-2172.245] (-2176.392) (-2180.390) -- 0:07:38
       7000 -- (-2179.151) (-2173.688) [-2176.717] (-2171.879) * (-2173.550) [-2172.513] (-2175.135) (-2175.148) -- 0:07:05
       7500 -- [-2172.296] (-2173.432) (-2175.808) (-2177.230) * (-2173.460) (-2188.062) [-2174.909] (-2172.220) -- 0:06:37
       8000 -- (-2171.286) [-2171.971] (-2177.361) (-2177.187) * (-2175.131) [-2170.262] (-2185.060) (-2171.390) -- 0:06:12
       8500 -- (-2172.667) [-2170.944] (-2180.023) (-2169.236) * [-2170.523] (-2174.085) (-2175.889) (-2176.618) -- 0:05:49
       9000 -- (-2169.874) (-2171.090) [-2170.042] (-2172.543) * (-2173.860) (-2174.441) (-2174.248) [-2174.192] -- 0:05:30
       9500 -- [-2175.638] (-2172.800) (-2173.899) (-2176.520) * (-2178.742) [-2167.498] (-2181.334) (-2178.689) -- 0:06:57
      10000 -- (-2176.752) (-2171.280) [-2171.519] (-2183.698) * (-2170.759) [-2169.077] (-2175.515) (-2176.547) -- 0:06:36

      Average standard deviation of split frequencies: 0.044194

      10500 -- [-2172.587] (-2174.009) (-2175.063) (-2174.508) * [-2170.004] (-2174.777) (-2178.480) (-2171.120) -- 0:06:16
      11000 -- (-2171.420) [-2170.667] (-2173.048) (-2169.700) * [-2175.612] (-2173.761) (-2172.952) (-2171.186) -- 0:05:59
      11500 -- [-2176.367] (-2172.289) (-2173.694) (-2171.735) * (-2179.716) (-2174.473) (-2171.125) [-2172.401] -- 0:05:43
      12000 -- (-2174.981) (-2171.675) (-2173.796) [-2172.905] * (-2173.759) (-2168.520) [-2170.457] (-2178.166) -- 0:05:29
      12500 -- (-2171.275) (-2169.988) (-2171.335) [-2172.548] * (-2174.447) [-2170.422] (-2171.654) (-2174.570) -- 0:06:35
      13000 -- (-2175.696) (-2171.590) (-2175.648) [-2170.672] * (-2169.910) [-2171.234] (-2171.740) (-2175.176) -- 0:06:19
      13500 -- (-2176.677) [-2171.870] (-2175.658) (-2176.709) * (-2182.920) (-2172.348) (-2173.237) [-2172.391] -- 0:06:05
      14000 -- (-2175.968) (-2178.165) [-2171.660] (-2177.739) * (-2171.250) (-2175.774) (-2167.773) [-2169.637] -- 0:05:52
      14500 -- (-2177.130) (-2172.587) (-2173.850) [-2170.025] * (-2171.219) [-2173.188] (-2172.307) (-2168.060) -- 0:05:39
      15000 -- [-2180.887] (-2174.418) (-2176.675) (-2178.464) * (-2177.859) (-2172.695) (-2173.358) [-2169.739] -- 0:05:28

      Average standard deviation of split frequencies: 0.017678

      15500 -- (-2170.655) [-2169.610] (-2174.956) (-2173.876) * (-2171.134) (-2172.944) [-2176.883] (-2175.079) -- 0:05:17
      16000 -- (-2176.444) (-2173.515) (-2172.074) [-2182.797] * (-2171.935) (-2173.040) [-2175.250] (-2174.220) -- 0:06:09
      16500 -- [-2168.562] (-2174.388) (-2173.604) (-2181.512) * (-2174.289) (-2177.439) (-2174.760) [-2171.779] -- 0:05:57
      17000 -- (-2176.319) (-2172.583) (-2174.181) [-2182.748] * [-2170.662] (-2175.100) (-2177.642) (-2172.679) -- 0:05:46
      17500 -- (-2174.981) [-2173.266] (-2174.981) (-2177.418) * (-2178.771) [-2171.989] (-2172.423) (-2171.586) -- 0:05:36
      18000 -- (-2171.322) (-2178.001) [-2172.937] (-2175.492) * (-2179.048) (-2171.790) [-2175.426] (-2173.717) -- 0:05:27
      18500 -- (-2174.085) [-2170.905] (-2178.856) (-2175.878) * (-2174.050) [-2168.814] (-2176.184) (-2175.166) -- 0:05:18
      19000 -- (-2173.649) (-2173.045) [-2178.954] (-2181.443) * (-2181.472) [-2173.713] (-2168.470) (-2172.188) -- 0:06:01
      19500 -- (-2179.294) (-2175.287) (-2178.863) [-2169.907] * (-2176.313) (-2172.842) [-2169.641] (-2183.288) -- 0:05:51
      20000 -- (-2169.017) (-2168.090) (-2180.243) [-2172.598] * (-2180.070) [-2172.260] (-2175.113) (-2170.990) -- 0:05:43

      Average standard deviation of split frequencies: 0.009124

      20500 -- (-2173.951) [-2174.872] (-2180.835) (-2172.263) * [-2175.849] (-2180.707) (-2169.831) (-2170.735) -- 0:05:34
      21000 -- (-2171.492) (-2174.461) [-2172.082] (-2176.174) * (-2175.641) [-2169.113] (-2177.101) (-2173.922) -- 0:05:26
      21500 -- (-2176.402) [-2169.629] (-2168.797) (-2169.094) * (-2176.095) [-2172.414] (-2176.054) (-2172.753) -- 0:05:18
      22000 -- [-2174.082] (-2168.601) (-2179.129) (-2173.003) * (-2176.452) [-2181.767] (-2175.342) (-2174.990) -- 0:05:55
      22500 -- (-2188.282) (-2174.161) [-2180.594] (-2169.680) * (-2183.293) [-2170.475] (-2174.699) (-2169.044) -- 0:05:47
      23000 -- (-2180.830) [-2176.707] (-2176.032) (-2179.718) * (-2176.291) (-2170.552) (-2181.690) [-2171.758] -- 0:05:39
      23500 -- (-2177.647) (-2171.629) (-2174.782) [-2169.345] * (-2169.106) (-2176.220) (-2178.289) [-2168.918] -- 0:05:32
      24000 -- (-2175.757) (-2171.712) [-2171.270] (-2182.538) * (-2177.535) (-2171.536) [-2171.358] (-2178.173) -- 0:05:25
      24500 -- (-2182.702) [-2171.352] (-2178.451) (-2170.347) * (-2179.519) (-2177.539) [-2169.657] (-2172.152) -- 0:05:18
      25000 -- (-2187.068) (-2173.675) [-2174.417] (-2178.476) * (-2174.216) (-2173.221) [-2173.145] (-2171.004) -- 0:05:12

      Average standard deviation of split frequencies: 0.024175

      25500 -- (-2175.433) (-2169.627) [-2171.564] (-2174.985) * (-2171.593) (-2170.677) [-2169.844] (-2172.519) -- 0:05:43
      26000 -- (-2184.540) [-2175.307] (-2172.578) (-2173.750) * [-2173.848] (-2172.359) (-2168.339) (-2172.853) -- 0:05:37
      26500 -- (-2180.773) (-2172.672) (-2170.006) [-2174.044] * (-2175.624) [-2170.163] (-2175.659) (-2179.526) -- 0:05:30
      27000 -- [-2172.877] (-2178.253) (-2172.717) (-2172.042) * (-2179.416) [-2176.455] (-2180.157) (-2174.528) -- 0:05:24
      27500 -- (-2180.122) [-2171.925] (-2169.601) (-2173.957) * (-2174.937) (-2175.817) (-2179.725) [-2174.340] -- 0:05:18
      28000 -- (-2183.379) (-2172.968) [-2170.701] (-2173.243) * (-2178.675) (-2183.456) (-2175.077) [-2169.310] -- 0:05:12
      28500 -- (-2184.646) (-2174.322) (-2177.467) [-2171.692] * (-2170.328) (-2178.826) [-2174.876] (-2178.352) -- 0:05:40
      29000 -- (-2182.479) [-2176.981] (-2169.416) (-2168.393) * [-2169.540] (-2172.999) (-2182.146) (-2171.673) -- 0:05:34
      29500 -- (-2176.843) [-2174.059] (-2172.286) (-2170.540) * [-2169.303] (-2175.361) (-2179.781) (-2169.188) -- 0:05:28
      30000 -- (-2180.200) [-2172.612] (-2176.290) (-2178.025) * (-2177.105) (-2170.170) (-2180.319) [-2171.218] -- 0:05:23

      Average standard deviation of split frequencies: 0.020496

      30500 -- (-2174.269) (-2174.114) [-2169.476] (-2176.312) * (-2172.589) (-2172.293) [-2177.522] (-2168.738) -- 0:05:17
      31000 -- (-2180.363) [-2167.815] (-2175.428) (-2173.227) * (-2178.906) (-2182.177) (-2171.373) [-2179.178] -- 0:05:12
      31500 -- [-2171.000] (-2183.762) (-2172.640) (-2176.872) * (-2171.889) [-2175.289] (-2177.460) (-2170.720) -- 0:05:38
      32000 -- (-2171.879) [-2174.763] (-2178.128) (-2178.645) * (-2171.252) (-2174.441) (-2173.830) [-2169.450] -- 0:05:32
      32500 -- [-2178.270] (-2171.603) (-2174.153) (-2172.365) * (-2180.973) [-2174.574] (-2171.314) (-2182.517) -- 0:05:27
      33000 -- (-2174.875) (-2177.902) [-2173.579] (-2176.198) * (-2171.185) (-2171.516) [-2180.616] (-2176.892) -- 0:05:22
      33500 -- (-2170.122) (-2177.132) (-2176.841) [-2169.056] * (-2170.641) (-2174.609) [-2174.253] (-2184.128) -- 0:05:17
      34000 -- (-2177.709) (-2177.366) (-2173.836) [-2170.379] * (-2170.541) (-2175.706) [-2168.722] (-2177.310) -- 0:05:12
      34500 -- [-2172.700] (-2174.223) (-2185.467) (-2171.159) * (-2177.565) [-2169.676] (-2172.530) (-2172.528) -- 0:05:07
      35000 -- [-2172.433] (-2176.972) (-2180.569) (-2173.787) * [-2174.069] (-2170.569) (-2173.827) (-2181.506) -- 0:05:30

      Average standard deviation of split frequencies: 0.021824

      35500 -- (-2173.995) (-2181.854) (-2178.006) [-2171.935] * (-2181.486) (-2173.232) [-2171.303] (-2174.786) -- 0:05:26
      36000 -- (-2174.770) (-2176.515) (-2180.779) [-2172.230] * (-2171.720) [-2173.256] (-2179.020) (-2178.699) -- 0:05:21
      36500 -- (-2175.626) [-2176.994] (-2180.301) (-2175.738) * (-2172.521) (-2174.765) [-2173.133] (-2178.872) -- 0:05:16
      37000 -- (-2172.231) (-2176.766) (-2178.033) [-2170.884] * (-2177.868) (-2170.782) (-2173.673) [-2176.786] -- 0:05:12
      37500 -- (-2168.884) (-2178.714) [-2177.789] (-2178.234) * [-2174.696] (-2168.605) (-2181.728) (-2179.886) -- 0:05:08
      38000 -- (-2176.146) (-2178.751) [-2169.607] (-2174.634) * (-2179.081) [-2173.075] (-2176.190) (-2188.347) -- 0:05:29
      38500 -- (-2180.804) [-2175.226] (-2175.040) (-2173.323) * [-2174.805] (-2170.843) (-2175.160) (-2173.042) -- 0:05:24
      39000 -- (-2171.034) [-2174.818] (-2173.610) (-2177.136) * (-2171.463) [-2172.652] (-2173.411) (-2182.067) -- 0:05:20
      39500 -- (-2172.009) (-2172.973) (-2180.394) [-2170.902] * (-2170.726) [-2173.199] (-2196.380) (-2177.556) -- 0:05:16
      40000 -- (-2184.287) (-2175.792) [-2175.917] (-2171.974) * [-2170.707] (-2174.248) (-2186.367) (-2180.748) -- 0:05:12

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-2173.664) (-2173.840) [-2170.054] (-2177.006) * [-2179.116] (-2190.493) (-2176.214) (-2178.325) -- 0:05:07
      41000 -- (-2177.299) (-2181.385) [-2179.099] (-2182.682) * [-2178.841] (-2170.687) (-2175.703) (-2172.656) -- 0:05:27
      41500 -- (-2178.478) (-2175.412) [-2171.078] (-2175.780) * (-2170.998) (-2178.402) (-2174.921) [-2174.600] -- 0:05:23
      42000 -- (-2174.903) (-2178.862) [-2175.939] (-2175.892) * (-2176.147) [-2169.381] (-2172.874) (-2178.754) -- 0:05:19
      42500 -- [-2177.011] (-2170.845) (-2174.974) (-2174.609) * [-2171.070] (-2174.575) (-2178.979) (-2172.001) -- 0:05:15
      43000 -- [-2174.457] (-2184.235) (-2174.871) (-2173.884) * [-2174.040] (-2170.256) (-2175.377) (-2178.914) -- 0:05:11
      43500 -- [-2170.906] (-2179.245) (-2177.079) (-2176.929) * (-2175.309) (-2180.050) [-2175.508] (-2175.906) -- 0:05:07
      44000 -- (-2169.949) [-2176.498] (-2179.733) (-2180.544) * (-2177.914) (-2177.931) [-2172.701] (-2175.792) -- 0:05:04
      44500 -- (-2173.509) (-2173.662) [-2170.615] (-2168.724) * (-2178.808) [-2174.678] (-2174.251) (-2182.248) -- 0:05:22
      45000 -- (-2172.580) [-2172.198] (-2177.492) (-2168.354) * (-2171.122) (-2178.712) [-2178.771] (-2173.600) -- 0:05:18

      Average standard deviation of split frequencies: 0.020496

      45500 -- (-2179.886) (-2183.005) (-2175.861) [-2172.322] * [-2174.366] (-2178.810) (-2177.554) (-2169.507) -- 0:05:14
      46000 -- (-2179.355) (-2175.518) [-2171.608] (-2174.707) * (-2169.393) (-2179.777) [-2171.533] (-2176.558) -- 0:05:11
      46500 -- (-2172.688) (-2177.157) [-2165.422] (-2173.412) * (-2170.345) (-2177.776) (-2172.385) [-2176.874] -- 0:05:07
      47000 -- (-2174.533) (-2177.327) [-2172.351] (-2171.767) * (-2171.983) (-2180.434) (-2174.650) [-2176.890] -- 0:05:04
      47500 -- [-2170.417] (-2187.702) (-2174.449) (-2180.344) * [-2172.483] (-2180.008) (-2174.031) (-2173.652) -- 0:05:20
      48000 -- (-2177.274) (-2179.638) (-2173.587) [-2175.362] * (-2176.757) (-2174.817) (-2176.305) [-2169.698] -- 0:05:17
      48500 -- (-2172.269) (-2173.837) (-2173.650) [-2182.469] * [-2183.402] (-2180.750) (-2179.116) (-2174.396) -- 0:05:13
      49000 -- [-2175.816] (-2175.091) (-2171.436) (-2186.151) * (-2172.878) [-2180.144] (-2175.723) (-2176.164) -- 0:05:10
      49500 -- (-2179.027) [-2169.224] (-2174.162) (-2181.554) * (-2179.504) [-2169.432] (-2170.794) (-2176.861) -- 0:05:07
      50000 -- [-2172.736] (-2175.179) (-2176.599) (-2183.868) * (-2179.032) (-2175.542) [-2170.945] (-2174.068) -- 0:05:04

      Average standard deviation of split frequencies: 0.018608

      50500 -- [-2169.921] (-2169.682) (-2174.916) (-2181.060) * (-2183.108) (-2172.119) (-2178.265) [-2174.465] -- 0:05:19
      51000 -- (-2173.985) (-2171.492) [-2175.400] (-2180.083) * [-2179.067] (-2176.800) (-2172.609) (-2172.738) -- 0:05:16
      51500 -- (-2173.352) (-2170.564) [-2171.629] (-2172.880) * (-2175.142) (-2177.230) [-2170.283] (-2178.624) -- 0:05:13
      52000 -- (-2172.946) (-2186.295) (-2188.991) [-2169.595] * (-2172.089) (-2168.303) (-2177.430) [-2171.998] -- 0:05:09
      52500 -- (-2172.323) (-2174.891) (-2190.813) [-2173.168] * (-2174.615) [-2174.929] (-2174.933) (-2170.966) -- 0:05:06
      53000 -- (-2173.611) (-2183.416) [-2178.068] (-2170.204) * (-2173.002) (-2180.971) (-2177.654) [-2179.160] -- 0:05:03
      53500 -- [-2171.857] (-2172.539) (-2176.605) (-2176.900) * (-2175.510) (-2178.352) (-2173.171) [-2176.468] -- 0:05:00
      54000 -- (-2173.972) [-2172.092] (-2178.959) (-2182.210) * (-2176.514) (-2175.006) [-2178.384] (-2175.620) -- 0:05:15
      54500 -- (-2172.733) [-2169.828] (-2176.522) (-2174.856) * (-2172.787) (-2172.490) [-2171.971] (-2176.901) -- 0:05:12
      55000 -- [-2175.725] (-2170.058) (-2182.802) (-2174.963) * (-2174.884) [-2177.608] (-2175.649) (-2173.564) -- 0:05:09

      Average standard deviation of split frequencies: 0.014030

      55500 -- (-2180.107) [-2172.061] (-2174.892) (-2173.024) * [-2169.969] (-2181.272) (-2171.925) (-2173.120) -- 0:05:06
      56000 -- (-2176.918) [-2171.697] (-2177.615) (-2180.593) * (-2174.397) [-2176.819] (-2173.881) (-2176.924) -- 0:05:03
      56500 -- (-2174.133) (-2171.735) (-2175.565) [-2174.945] * (-2181.729) (-2176.805) (-2175.682) [-2175.641] -- 0:05:00
      57000 -- (-2177.152) [-2172.863] (-2175.789) (-2174.445) * (-2180.525) (-2175.663) (-2178.383) [-2176.161] -- 0:05:14
      57500 -- [-2179.119] (-2171.376) (-2170.555) (-2170.311) * (-2179.068) (-2169.374) (-2171.035) [-2170.015] -- 0:05:11
      58000 -- [-2169.474] (-2173.032) (-2170.819) (-2171.355) * (-2186.250) [-2169.637] (-2171.664) (-2177.868) -- 0:05:08
      58500 -- (-2177.262) [-2172.810] (-2174.774) (-2173.214) * [-2180.553] (-2175.529) (-2179.611) (-2176.150) -- 0:05:05
      59000 -- (-2174.813) (-2174.274) [-2172.737] (-2174.629) * (-2175.150) (-2175.711) [-2176.381] (-2171.912) -- 0:05:03
      59500 -- (-2176.530) (-2176.535) (-2175.626) [-2174.587] * (-2172.749) (-2179.667) [-2171.837] (-2175.778) -- 0:05:00
      60000 -- [-2174.590] (-2172.508) (-2178.043) (-2177.659) * (-2168.847) (-2185.847) [-2169.097] (-2176.102) -- 0:05:13

      Average standard deviation of split frequencies: 0.012951

      60500 -- (-2170.452) [-2170.814] (-2187.811) (-2176.601) * (-2172.594) [-2180.074] (-2174.344) (-2176.358) -- 0:05:10
      61000 -- [-2174.840] (-2178.587) (-2178.376) (-2178.132) * [-2172.025] (-2177.086) (-2178.959) (-2168.595) -- 0:05:07
      61500 -- (-2174.756) (-2173.388) (-2176.863) [-2173.038] * [-2175.051] (-2176.783) (-2170.226) (-2180.973) -- 0:05:05
      62000 -- [-2169.442] (-2175.560) (-2173.178) (-2178.218) * (-2168.771) [-2169.997] (-2176.065) (-2173.352) -- 0:05:02
      62500 -- (-2177.237) (-2187.614) [-2180.726] (-2184.776) * [-2172.923] (-2176.295) (-2176.956) (-2168.320) -- 0:05:00
      63000 -- [-2175.365] (-2182.716) (-2170.601) (-2178.917) * (-2171.685) [-2178.550] (-2177.087) (-2172.918) -- 0:04:57
      63500 -- (-2174.996) (-2181.105) [-2179.657] (-2171.543) * (-2178.235) [-2174.996] (-2184.724) (-2177.123) -- 0:05:09
      64000 -- (-2177.464) (-2179.853) (-2169.983) [-2170.616] * [-2174.980] (-2178.500) (-2175.122) (-2171.741) -- 0:05:07
      64500 -- (-2173.719) (-2167.084) (-2180.474) [-2172.930] * (-2177.926) (-2175.822) (-2176.459) [-2170.774] -- 0:05:04
      65000 -- (-2169.028) [-2172.591] (-2174.425) (-2172.253) * (-2178.769) (-2186.423) (-2181.753) [-2177.500] -- 0:05:02

      Average standard deviation of split frequencies: 0.014285

      65500 -- (-2173.795) (-2175.860) [-2178.954] (-2172.573) * (-2173.692) (-2182.239) (-2169.276) [-2172.669] -- 0:04:59
      66000 -- (-2180.787) [-2182.759] (-2170.885) (-2170.691) * (-2177.516) (-2174.399) [-2171.846] (-2173.242) -- 0:04:57
      66500 -- (-2171.682) [-2180.607] (-2175.879) (-2179.670) * (-2172.435) [-2180.284] (-2170.415) (-2174.549) -- 0:05:08
      67000 -- (-2182.817) (-2177.758) (-2175.790) [-2182.490] * (-2170.114) (-2179.580) (-2178.530) [-2170.983] -- 0:05:06
      67500 -- (-2177.271) (-2173.882) [-2171.711] (-2175.112) * (-2175.879) [-2176.244] (-2179.544) (-2173.373) -- 0:05:03
      68000 -- (-2181.678) (-2171.808) (-2173.664) [-2171.432] * (-2173.271) (-2175.282) (-2175.896) [-2171.516] -- 0:05:01
      68500 -- (-2173.376) (-2175.584) [-2174.633] (-2176.441) * (-2181.324) (-2171.418) (-2183.053) [-2170.794] -- 0:04:59
      69000 -- (-2173.811) (-2185.124) (-2176.091) [-2175.287] * (-2181.577) [-2171.436] (-2184.155) (-2177.770) -- 0:04:56
      69500 -- (-2178.050) (-2171.946) [-2171.862] (-2179.677) * (-2182.525) (-2174.435) [-2172.552] (-2181.438) -- 0:05:07
      70000 -- (-2187.166) [-2174.274] (-2176.324) (-2179.026) * (-2178.299) [-2184.827] (-2175.990) (-2174.594) -- 0:05:05

      Average standard deviation of split frequencies: 0.018678

      70500 -- (-2187.907) (-2170.358) (-2173.538) [-2170.974] * (-2177.343) [-2176.001] (-2176.411) (-2175.047) -- 0:05:03
      71000 -- (-2171.107) (-2172.809) [-2176.431] (-2175.004) * (-2175.924) [-2174.174] (-2173.310) (-2174.795) -- 0:05:00
      71500 -- [-2173.516] (-2173.651) (-2176.838) (-2170.342) * (-2188.860) (-2177.690) (-2170.412) [-2174.430] -- 0:04:58
      72000 -- (-2181.033) (-2173.100) [-2173.593] (-2174.476) * (-2169.868) [-2176.790] (-2177.112) (-2177.262) -- 0:04:56
      72500 -- (-2179.030) [-2172.658] (-2174.132) (-2173.092) * (-2170.064) (-2188.061) (-2175.626) [-2178.008] -- 0:05:07
      73000 -- (-2175.177) (-2176.264) (-2171.547) [-2168.101] * (-2172.613) [-2175.613] (-2173.107) (-2178.191) -- 0:05:04
      73500 -- (-2182.850) [-2179.643] (-2171.366) (-2170.489) * (-2182.790) (-2176.708) [-2170.098] (-2175.234) -- 0:05:02
      74000 -- (-2173.723) [-2177.793] (-2175.764) (-2177.623) * (-2177.191) (-2171.994) [-2172.912] (-2171.291) -- 0:05:00
      74500 -- (-2170.493) [-2172.002] (-2181.733) (-2178.422) * (-2179.730) (-2177.103) [-2169.734] (-2180.299) -- 0:04:58
      75000 -- (-2172.850) [-2178.196] (-2175.923) (-2171.713) * (-2176.434) (-2179.611) (-2181.602) [-2172.494] -- 0:04:56

      Average standard deviation of split frequencies: 0.022743

      75500 -- (-2179.575) (-2179.853) (-2171.251) [-2169.171] * (-2174.350) (-2173.462) (-2173.573) [-2170.834] -- 0:04:53
      76000 -- [-2176.801] (-2175.414) (-2177.335) (-2171.568) * (-2180.507) (-2172.194) (-2172.770) [-2174.785] -- 0:05:03
      76500 -- (-2172.946) [-2172.592] (-2172.430) (-2172.404) * (-2169.670) (-2172.915) (-2172.459) [-2172.364] -- 0:05:01
      77000 -- (-2177.683) (-2172.164) (-2181.159) [-2180.481] * (-2175.181) (-2174.402) [-2172.397] (-2172.838) -- 0:04:59
      77500 -- [-2170.553] (-2169.688) (-2172.667) (-2171.368) * [-2171.196] (-2178.559) (-2170.330) (-2168.145) -- 0:04:57
      78000 -- (-2185.329) [-2173.902] (-2173.109) (-2180.305) * (-2174.688) (-2184.673) (-2173.876) [-2175.525] -- 0:04:55
      78500 -- (-2186.970) [-2172.226] (-2174.739) (-2171.136) * (-2176.923) [-2173.153] (-2176.801) (-2177.123) -- 0:04:53
      79000 -- (-2182.162) (-2173.197) [-2173.572] (-2176.217) * (-2176.303) (-2169.670) (-2174.049) [-2171.533] -- 0:05:03
      79500 -- (-2175.218) (-2172.476) [-2175.620] (-2170.927) * (-2174.366) (-2172.217) (-2173.437) [-2184.606] -- 0:05:01
      80000 -- (-2179.151) (-2175.764) [-2179.254] (-2172.674) * [-2167.467] (-2180.544) (-2168.972) (-2182.479) -- 0:04:59

      Average standard deviation of split frequencies: 0.023375

      80500 -- (-2178.739) [-2168.044] (-2179.005) (-2173.581) * (-2175.115) [-2175.514] (-2176.153) (-2184.317) -- 0:04:56
      81000 -- (-2180.798) (-2172.850) [-2179.120] (-2180.567) * (-2176.673) (-2173.108) [-2167.467] (-2172.005) -- 0:04:54
      81500 -- (-2174.877) [-2179.690] (-2179.156) (-2184.641) * (-2174.268) (-2168.592) (-2178.448) [-2175.470] -- 0:04:53
      82000 -- (-2179.624) (-2183.980) (-2177.593) [-2169.322] * (-2170.458) (-2175.941) (-2179.726) [-2169.958] -- 0:05:02
      82500 -- (-2175.015) (-2184.331) [-2178.407] (-2170.205) * (-2170.863) (-2172.133) (-2173.458) [-2169.284] -- 0:05:00
      83000 -- [-2177.082] (-2175.404) (-2176.528) (-2169.842) * (-2174.268) (-2172.172) [-2174.495] (-2171.281) -- 0:04:58
      83500 -- [-2171.648] (-2171.169) (-2175.119) (-2174.439) * (-2173.319) [-2176.660] (-2174.013) (-2172.842) -- 0:04:56
      84000 -- [-2173.109] (-2172.344) (-2169.915) (-2174.245) * (-2173.165) (-2180.560) [-2171.315] (-2172.334) -- 0:04:54
      84500 -- (-2173.047) [-2176.203] (-2170.478) (-2174.197) * [-2171.472] (-2174.519) (-2175.955) (-2173.079) -- 0:04:52
      85000 -- (-2175.798) (-2172.766) [-2176.890] (-2177.934) * [-2179.893] (-2174.000) (-2172.872) (-2170.142) -- 0:04:50

      Average standard deviation of split frequencies: 0.021926

      85500 -- (-2169.811) (-2170.497) [-2175.753] (-2176.588) * [-2182.644] (-2170.695) (-2178.280) (-2173.401) -- 0:04:59
      86000 -- (-2178.734) (-2173.408) [-2179.227] (-2171.356) * [-2176.640] (-2172.164) (-2174.722) (-2174.782) -- 0:04:57
      86500 -- (-2171.550) (-2180.684) (-2178.186) [-2171.332] * (-2180.390) [-2170.708] (-2182.264) (-2169.653) -- 0:04:55
      87000 -- [-2170.491] (-2170.853) (-2187.403) (-2173.942) * (-2182.320) [-2174.537] (-2179.729) (-2172.748) -- 0:04:53
      87500 -- (-2175.967) (-2167.717) (-2172.480) [-2169.311] * (-2177.247) [-2170.392] (-2184.539) (-2171.610) -- 0:04:52
      88000 -- (-2174.621) [-2175.909] (-2179.381) (-2180.966) * (-2173.554) [-2174.038] (-2179.386) (-2171.809) -- 0:04:50
      88500 -- (-2171.409) (-2176.923) (-2174.163) [-2173.004] * (-2173.375) (-2178.743) (-2173.866) [-2176.723] -- 0:04:58
      89000 -- (-2181.490) [-2173.168] (-2173.019) (-2172.302) * (-2179.802) (-2177.186) [-2185.619] (-2175.626) -- 0:04:56
      89500 -- (-2177.315) (-2177.784) (-2176.334) [-2174.328] * (-2175.250) (-2174.272) [-2179.627] (-2175.280) -- 0:04:55
      90000 -- [-2175.733] (-2177.369) (-2180.631) (-2174.853) * (-2171.609) [-2173.324] (-2180.029) (-2175.387) -- 0:04:53

      Average standard deviation of split frequencies: 0.024957

      90500 -- (-2173.919) (-2173.989) (-2170.789) [-2177.351] * (-2175.313) (-2173.109) (-2178.850) [-2180.120] -- 0:04:51
      91000 -- [-2173.646] (-2172.375) (-2178.031) (-2169.670) * [-2170.897] (-2171.601) (-2175.291) (-2173.511) -- 0:04:49
      91500 -- (-2176.089) (-2173.216) (-2176.811) [-2168.697] * [-2176.615] (-2177.596) (-2177.665) (-2178.456) -- 0:04:57
      92000 -- (-2172.526) (-2175.857) (-2180.638) [-2172.374] * (-2175.973) [-2170.292] (-2171.669) (-2177.911) -- 0:04:56
      92500 -- (-2173.862) (-2173.050) [-2179.739] (-2177.286) * (-2178.866) (-2172.930) [-2168.172] (-2172.579) -- 0:04:54
      93000 -- (-2172.856) (-2181.948) [-2173.367] (-2176.190) * [-2172.979] (-2183.026) (-2181.485) (-2180.537) -- 0:04:52
      93500 -- (-2175.212) [-2173.235] (-2176.719) (-2171.554) * [-2172.404] (-2172.674) (-2182.643) (-2172.232) -- 0:04:50
      94000 -- (-2179.711) (-2177.354) (-2178.786) [-2173.961] * (-2184.798) [-2169.134] (-2175.879) (-2172.294) -- 0:04:49
      94500 -- (-2181.257) (-2170.677) [-2175.457] (-2171.587) * (-2173.210) (-2180.184) (-2173.726) [-2175.258] -- 0:04:47
      95000 -- (-2177.094) [-2173.085] (-2174.482) (-2172.855) * (-2171.610) (-2176.095) (-2172.873) [-2176.255] -- 0:04:55

      Average standard deviation of split frequencies: 0.018005

      95500 -- (-2175.599) (-2170.615) (-2176.677) [-2171.297] * [-2174.581] (-2171.998) (-2170.887) (-2183.804) -- 0:04:53
      96000 -- (-2171.665) (-2170.851) [-2174.481] (-2172.387) * [-2175.825] (-2173.010) (-2176.285) (-2181.158) -- 0:04:51
      96500 -- [-2171.167] (-2175.407) (-2170.413) (-2168.951) * (-2171.462) [-2177.847] (-2178.234) (-2179.829) -- 0:04:50
      97000 -- (-2177.788) (-2172.629) [-2168.328] (-2176.869) * [-2168.404] (-2181.475) (-2169.607) (-2177.877) -- 0:04:48
      97500 -- (-2170.006) (-2173.852) (-2171.450) [-2171.030] * (-2176.410) (-2180.189) (-2176.846) [-2182.500] -- 0:04:46
      98000 -- (-2173.578) (-2173.585) [-2174.448] (-2183.578) * (-2173.011) [-2172.087] (-2175.812) (-2172.412) -- 0:04:54
      98500 -- (-2187.401) (-2173.716) [-2170.243] (-2170.564) * (-2168.765) (-2172.525) [-2169.685] (-2171.092) -- 0:04:52
      99000 -- [-2178.885] (-2180.517) (-2169.065) (-2174.486) * [-2175.929] (-2181.424) (-2168.822) (-2173.021) -- 0:04:51
      99500 -- (-2176.036) (-2176.157) (-2171.361) [-2174.522] * (-2180.815) [-2172.971] (-2174.499) (-2172.770) -- 0:04:49
      100000 -- (-2182.762) (-2177.479) [-2170.277] (-2172.502) * (-2175.768) (-2176.566) (-2179.379) [-2169.689] -- 0:04:48

      Average standard deviation of split frequencies: 0.011239

      100500 -- [-2172.080] (-2171.261) (-2174.764) (-2174.572) * (-2180.552) [-2173.651] (-2174.203) (-2170.494) -- 0:04:46
      101000 -- (-2179.762) (-2174.816) [-2168.909] (-2171.140) * (-2180.544) (-2175.872) (-2176.430) [-2174.987] -- 0:04:53
      101500 -- (-2168.655) (-2180.850) (-2170.761) [-2174.363] * (-2174.582) [-2173.675] (-2175.022) (-2175.088) -- 0:04:52
      102000 -- [-2169.866] (-2175.234) (-2174.501) (-2172.350) * (-2175.237) [-2177.427] (-2185.960) (-2176.569) -- 0:04:50
      102500 -- (-2175.101) [-2175.254] (-2174.263) (-2177.821) * (-2173.699) [-2169.567] (-2176.018) (-2183.681) -- 0:04:48
      103000 -- (-2175.253) (-2175.713) [-2177.481] (-2177.797) * [-2176.787] (-2175.822) (-2177.273) (-2182.947) -- 0:04:47
      103500 -- [-2174.745] (-2170.252) (-2185.757) (-2173.003) * [-2172.083] (-2173.618) (-2170.343) (-2178.226) -- 0:04:45
      104000 -- [-2172.601] (-2180.850) (-2175.367) (-2170.244) * (-2172.203) (-2172.954) (-2172.900) [-2176.134] -- 0:04:44
      104500 -- (-2172.677) (-2171.369) [-2168.240] (-2183.422) * (-2173.461) (-2176.777) (-2172.329) [-2173.114] -- 0:04:51
      105000 -- [-2174.449] (-2171.456) (-2170.239) (-2172.708) * [-2171.149] (-2175.905) (-2178.316) (-2174.491) -- 0:04:49

      Average standard deviation of split frequencies: 0.017789

      105500 -- [-2174.645] (-2171.668) (-2173.279) (-2175.318) * (-2169.143) (-2183.225) (-2185.321) [-2175.171] -- 0:04:48
      106000 -- (-2174.529) (-2175.127) (-2172.028) [-2174.636] * [-2170.495] (-2170.988) (-2188.651) (-2181.017) -- 0:04:46
      106500 -- (-2184.264) [-2175.415] (-2171.063) (-2170.813) * (-2172.430) [-2175.281] (-2190.346) (-2188.232) -- 0:04:45
      107000 -- (-2175.379) (-2171.187) [-2174.995] (-2178.072) * [-2168.626] (-2184.161) (-2182.520) (-2178.509) -- 0:04:43
      107500 -- [-2175.395] (-2174.032) (-2178.502) (-2179.315) * (-2167.828) (-2178.877) (-2178.159) [-2172.017] -- 0:04:50
      108000 -- (-2173.642) (-2170.532) (-2178.155) [-2175.434] * (-2171.303) (-2184.882) (-2177.253) [-2175.387] -- 0:04:49
      108500 -- [-2171.489] (-2173.635) (-2174.359) (-2173.178) * (-2174.672) [-2172.451] (-2173.058) (-2173.904) -- 0:04:47
      109000 -- (-2179.451) (-2185.127) [-2171.196] (-2178.429) * [-2176.728] (-2181.348) (-2175.754) (-2173.989) -- 0:04:46
      109500 -- (-2184.338) (-2169.198) (-2175.032) [-2174.332] * (-2174.221) (-2173.926) (-2175.562) [-2171.244] -- 0:04:44
      110000 -- (-2172.301) (-2171.456) [-2169.599] (-2181.239) * (-2179.053) [-2173.908] (-2175.912) (-2185.788) -- 0:04:43

      Average standard deviation of split frequencies: 0.019595

      110500 -- (-2180.975) (-2178.460) [-2170.543] (-2182.705) * [-2173.938] (-2177.483) (-2170.348) (-2171.590) -- 0:04:49
      111000 -- (-2172.181) (-2175.015) [-2177.313] (-2185.205) * [-2169.642] (-2184.158) (-2173.460) (-2175.308) -- 0:04:48
      111500 -- [-2170.308] (-2178.144) (-2172.750) (-2178.747) * [-2174.281] (-2177.900) (-2177.943) (-2177.021) -- 0:04:46
      112000 -- (-2173.141) (-2179.307) [-2171.810] (-2174.242) * (-2168.826) (-2171.284) (-2180.293) [-2178.555] -- 0:04:45
      112500 -- (-2177.363) (-2170.310) [-2172.318] (-2174.384) * [-2168.427] (-2174.103) (-2177.221) (-2174.383) -- 0:04:44
      113000 -- (-2173.353) (-2180.003) [-2176.869] (-2171.758) * [-2169.568] (-2177.399) (-2183.634) (-2171.187) -- 0:04:42
      113500 -- (-2178.022) (-2177.843) [-2171.399] (-2167.934) * [-2174.159] (-2171.350) (-2178.070) (-2174.455) -- 0:04:48
      114000 -- (-2173.245) [-2174.942] (-2176.259) (-2175.065) * [-2170.265] (-2173.022) (-2180.124) (-2177.727) -- 0:04:47
      114500 -- [-2174.945] (-2177.974) (-2174.158) (-2172.595) * (-2169.846) (-2175.510) [-2170.696] (-2169.715) -- 0:04:46
      115000 -- (-2171.461) (-2179.421) [-2176.693] (-2179.685) * [-2175.773] (-2173.484) (-2173.981) (-2175.576) -- 0:04:44

      Average standard deviation of split frequencies: 0.016255

      115500 -- (-2167.045) (-2172.213) (-2182.827) [-2172.115] * [-2174.236] (-2168.048) (-2181.320) (-2174.511) -- 0:04:43
      116000 -- (-2173.803) (-2180.228) [-2179.042] (-2177.782) * (-2178.332) (-2180.624) (-2178.682) [-2176.728] -- 0:04:41
      116500 -- [-2168.057] (-2177.752) (-2180.242) (-2177.348) * (-2178.203) (-2181.219) (-2181.109) [-2167.376] -- 0:04:40
      117000 -- (-2170.675) [-2176.306] (-2186.666) (-2172.158) * (-2180.373) (-2176.746) [-2175.795] (-2172.835) -- 0:04:46
      117500 -- (-2171.199) [-2174.682] (-2185.730) (-2170.476) * (-2179.698) (-2180.249) (-2176.182) [-2174.023] -- 0:04:45
      118000 -- [-2170.253] (-2174.846) (-2179.140) (-2172.404) * (-2181.412) [-2178.572] (-2177.053) (-2175.244) -- 0:04:44
      118500 -- (-2176.352) (-2182.621) [-2177.061] (-2170.630) * [-2171.353] (-2175.737) (-2176.651) (-2174.160) -- 0:04:42
      119000 -- [-2178.403] (-2173.088) (-2172.664) (-2171.778) * (-2171.126) (-2178.328) (-2179.695) [-2173.009] -- 0:04:41
      119500 -- (-2174.942) (-2172.114) [-2176.203] (-2172.000) * (-2177.339) (-2176.748) [-2175.961] (-2173.686) -- 0:04:39
      120000 -- (-2177.411) [-2181.681] (-2174.588) (-2174.571) * [-2169.220] (-2176.427) (-2179.879) (-2170.779) -- 0:04:46

      Average standard deviation of split frequencies: 0.017189

      120500 -- (-2181.173) [-2178.001] (-2173.591) (-2174.213) * (-2173.480) (-2180.894) [-2175.144] (-2178.037) -- 0:04:44
      121000 -- (-2176.418) (-2170.225) (-2179.730) [-2176.406] * [-2173.390] (-2177.692) (-2174.454) (-2176.044) -- 0:04:43
      121500 -- (-2178.985) [-2169.688] (-2174.723) (-2172.777) * (-2177.249) (-2173.845) (-2172.993) [-2173.505] -- 0:04:41
      122000 -- (-2174.802) (-2173.481) [-2173.841] (-2177.353) * (-2178.715) (-2171.509) (-2175.454) [-2175.818] -- 0:04:40
      122500 -- (-2177.262) [-2173.881] (-2174.041) (-2170.913) * (-2183.333) (-2173.666) [-2177.172] (-2174.545) -- 0:04:39
      123000 -- (-2174.030) (-2178.933) (-2177.332) [-2170.103] * (-2177.011) (-2178.484) [-2183.382] (-2173.540) -- 0:04:45
      123500 -- [-2178.872] (-2177.872) (-2177.501) (-2168.753) * (-2180.309) (-2176.921) (-2173.838) [-2173.158] -- 0:04:43
      124000 -- (-2180.747) (-2182.692) [-2176.976] (-2176.906) * [-2170.659] (-2172.832) (-2174.107) (-2174.586) -- 0:04:42
      124500 -- (-2173.626) (-2181.643) [-2169.598] (-2175.448) * [-2182.410] (-2175.090) (-2171.448) (-2171.483) -- 0:04:41
      125000 -- (-2173.564) (-2175.649) [-2178.871] (-2181.977) * (-2178.069) (-2185.407) [-2170.949] (-2180.011) -- 0:04:40

      Average standard deviation of split frequencies: 0.014217

      125500 -- (-2170.681) [-2175.686] (-2182.580) (-2181.365) * (-2178.842) [-2171.009] (-2174.882) (-2176.116) -- 0:04:38
      126000 -- [-2174.682] (-2177.488) (-2178.597) (-2176.128) * (-2173.460) (-2178.204) (-2173.720) [-2170.727] -- 0:04:37
      126500 -- (-2173.234) [-2170.651] (-2175.995) (-2177.424) * [-2172.064] (-2176.596) (-2172.335) (-2174.685) -- 0:04:43
      127000 -- (-2170.735) [-2169.099] (-2172.323) (-2187.413) * (-2167.977) (-2176.727) (-2174.267) [-2169.288] -- 0:04:41
      127500 -- (-2172.793) (-2172.841) (-2171.287) [-2175.922] * (-2174.488) (-2167.624) (-2180.126) [-2175.504] -- 0:04:40
      128000 -- (-2173.623) (-2180.521) (-2173.218) [-2173.609] * [-2175.703] (-2179.288) (-2187.147) (-2174.499) -- 0:04:39
      128500 -- (-2177.063) (-2175.572) [-2172.024] (-2173.152) * (-2181.575) (-2174.122) (-2174.895) [-2176.248] -- 0:04:38
      129000 -- [-2174.560] (-2184.452) (-2177.509) (-2179.500) * [-2170.103] (-2171.254) (-2174.492) (-2173.506) -- 0:04:36
      129500 -- (-2176.595) [-2170.092] (-2176.989) (-2171.862) * [-2172.921] (-2184.698) (-2176.520) (-2169.443) -- 0:04:42
      130000 -- [-2169.696] (-2175.225) (-2177.429) (-2172.404) * (-2173.284) (-2180.754) (-2179.953) [-2172.770] -- 0:04:41

      Average standard deviation of split frequencies: 0.015874

      130500 -- (-2172.133) (-2175.947) [-2176.163] (-2172.909) * (-2174.647) (-2180.927) (-2180.955) [-2174.029] -- 0:04:39
      131000 -- (-2172.891) [-2175.821] (-2169.983) (-2176.695) * (-2174.047) (-2175.849) (-2173.697) [-2174.613] -- 0:04:38
      131500 -- [-2173.402] (-2181.461) (-2170.913) (-2175.993) * [-2178.923] (-2172.546) (-2174.260) (-2178.500) -- 0:04:37
      132000 -- (-2175.859) (-2172.506) [-2172.713] (-2175.581) * [-2171.170] (-2174.493) (-2173.309) (-2173.819) -- 0:04:36
      132500 -- (-2169.567) (-2181.400) [-2174.929] (-2179.159) * [-2167.655] (-2174.663) (-2173.474) (-2178.259) -- 0:04:41
      133000 -- (-2174.318) (-2181.227) [-2177.180] (-2179.031) * (-2171.822) (-2171.171) (-2174.825) [-2174.104] -- 0:04:40
      133500 -- (-2174.679) (-2176.675) (-2174.329) [-2176.723] * [-2175.235] (-2175.510) (-2184.021) (-2173.164) -- 0:04:39
      134000 -- (-2180.235) (-2170.291) (-2173.157) [-2175.785] * (-2177.071) (-2173.875) (-2184.109) [-2172.273] -- 0:04:37
      134500 -- [-2171.711] (-2171.460) (-2176.038) (-2174.750) * [-2173.551] (-2181.427) (-2172.731) (-2173.484) -- 0:04:36
      135000 -- (-2176.890) (-2169.726) [-2171.141] (-2174.661) * [-2173.012] (-2178.295) (-2176.413) (-2174.398) -- 0:04:35

      Average standard deviation of split frequencies: 0.015251

      135500 -- (-2168.701) (-2187.415) (-2173.494) [-2174.181] * (-2171.914) [-2172.281] (-2172.273) (-2174.906) -- 0:04:34
      136000 -- (-2174.841) (-2178.979) [-2176.463] (-2175.237) * [-2170.722] (-2173.560) (-2172.234) (-2172.019) -- 0:04:39
      136500 -- (-2170.367) (-2169.635) [-2168.749] (-2172.128) * [-2169.044] (-2173.776) (-2181.076) (-2173.261) -- 0:04:38
      137000 -- (-2172.178) (-2175.872) [-2174.096] (-2175.869) * [-2174.413] (-2172.800) (-2169.659) (-2179.462) -- 0:04:37
      137500 -- (-2173.336) (-2173.711) [-2170.672] (-2182.599) * (-2174.924) [-2174.937] (-2174.767) (-2181.552) -- 0:04:36
      138000 -- [-2171.755] (-2174.432) (-2169.979) (-2181.711) * [-2170.239] (-2173.901) (-2177.020) (-2179.956) -- 0:04:34
      138500 -- (-2172.964) [-2174.122] (-2174.217) (-2179.277) * [-2169.164] (-2181.776) (-2170.098) (-2182.775) -- 0:04:33
      139000 -- (-2179.950) [-2175.874] (-2171.591) (-2183.051) * (-2172.544) (-2178.767) (-2168.529) [-2173.711] -- 0:04:38
      139500 -- (-2172.952) (-2169.843) [-2173.308] (-2174.019) * (-2169.947) (-2170.402) [-2176.193] (-2175.448) -- 0:04:37
      140000 -- [-2178.326] (-2171.101) (-2172.416) (-2176.175) * (-2174.417) (-2175.620) (-2183.871) [-2171.782] -- 0:04:36

      Average standard deviation of split frequencies: 0.012064

      140500 -- [-2176.195] (-2177.859) (-2176.060) (-2175.455) * (-2180.696) (-2177.854) [-2171.406] (-2171.969) -- 0:04:35
      141000 -- (-2178.908) (-2177.664) (-2176.934) [-2173.853] * (-2179.166) (-2171.910) (-2173.485) [-2180.042] -- 0:04:34
      141500 -- (-2173.627) (-2174.723) [-2175.111] (-2172.911) * (-2173.358) (-2175.553) [-2170.955] (-2182.716) -- 0:04:33
      142000 -- (-2170.902) [-2170.951] (-2176.385) (-2171.346) * (-2177.562) [-2172.267] (-2175.047) (-2184.034) -- 0:04:37
      142500 -- (-2177.118) (-2174.958) [-2170.313] (-2171.340) * (-2172.387) (-2173.387) [-2168.487] (-2171.254) -- 0:04:36
      143000 -- (-2180.339) [-2168.495] (-2182.932) (-2172.087) * (-2172.013) (-2171.781) (-2175.215) [-2174.612] -- 0:04:35
      143500 -- (-2179.818) [-2172.968] (-2173.821) (-2171.814) * (-2175.097) (-2180.901) [-2172.639] (-2172.573) -- 0:04:34
      144000 -- (-2175.601) (-2170.556) [-2171.524] (-2174.756) * [-2175.418] (-2175.426) (-2180.700) (-2180.109) -- 0:04:33
      144500 -- [-2172.935] (-2173.514) (-2180.024) (-2177.532) * (-2172.387) (-2176.910) [-2170.002] (-2171.729) -- 0:04:32
      145000 -- (-2172.236) [-2170.089] (-2176.814) (-2170.548) * [-2175.931] (-2176.684) (-2171.527) (-2182.725) -- 0:04:31

      Average standard deviation of split frequencies: 0.012915

      145500 -- (-2175.943) [-2167.352] (-2178.613) (-2170.796) * (-2171.042) (-2179.761) [-2179.832] (-2180.807) -- 0:04:36
      146000 -- (-2176.405) (-2173.016) (-2183.197) [-2174.440] * [-2174.700] (-2175.328) (-2174.134) (-2178.042) -- 0:04:34
      146500 -- (-2171.763) [-2175.189] (-2178.022) (-2181.189) * (-2175.122) [-2176.096] (-2174.743) (-2175.610) -- 0:04:33
      147000 -- (-2172.141) (-2175.482) (-2178.056) [-2173.968] * (-2176.254) (-2170.421) (-2178.030) [-2175.537] -- 0:04:32
      147500 -- (-2176.198) [-2169.062] (-2180.074) (-2170.775) * (-2177.520) (-2174.618) [-2171.221] (-2174.811) -- 0:04:31
      148000 -- (-2178.176) [-2174.182] (-2170.934) (-2179.989) * (-2180.398) (-2177.631) (-2174.226) [-2170.310] -- 0:04:30
      148500 -- (-2175.675) [-2175.968] (-2177.522) (-2174.223) * (-2178.924) [-2170.330] (-2174.659) (-2175.836) -- 0:04:35
      149000 -- (-2179.001) (-2173.495) (-2176.722) [-2173.758] * [-2176.021] (-2169.652) (-2173.685) (-2174.199) -- 0:04:34
      149500 -- (-2184.544) (-2174.974) [-2178.867] (-2183.152) * (-2171.519) (-2174.457) (-2170.626) [-2172.120] -- 0:04:33
      150000 -- (-2175.002) (-2171.339) [-2176.126] (-2181.648) * (-2173.851) (-2175.221) (-2173.279) [-2171.061] -- 0:04:32

      Average standard deviation of split frequencies: 0.013141

      150500 -- (-2176.071) (-2176.011) [-2177.475] (-2176.027) * (-2169.717) [-2174.243] (-2180.945) (-2172.251) -- 0:04:30
      151000 -- (-2170.714) (-2174.852) [-2175.741] (-2176.543) * [-2169.663] (-2170.117) (-2177.214) (-2170.577) -- 0:04:29
      151500 -- (-2175.175) (-2170.930) [-2176.575] (-2177.049) * (-2168.251) (-2174.692) (-2173.759) [-2167.412] -- 0:04:34
      152000 -- [-2172.266] (-2192.344) (-2177.220) (-2175.912) * (-2175.681) (-2177.461) (-2172.729) [-2174.243] -- 0:04:33
      152500 -- (-2172.545) (-2176.996) [-2168.908] (-2177.962) * (-2169.944) [-2175.102] (-2189.520) (-2174.188) -- 0:04:32
      153000 -- (-2168.305) (-2168.524) (-2185.464) [-2179.273] * (-2171.510) (-2174.373) [-2171.202] (-2181.993) -- 0:04:31
      153500 -- (-2176.931) (-2169.820) [-2174.907] (-2174.996) * (-2169.661) (-2171.336) [-2172.367] (-2174.061) -- 0:04:30
      154000 -- [-2172.122] (-2170.325) (-2175.660) (-2171.169) * (-2169.401) (-2171.140) [-2171.358] (-2175.127) -- 0:04:29
      154500 -- (-2173.831) (-2170.516) (-2178.042) [-2171.212] * [-2172.888] (-2173.561) (-2171.148) (-2183.802) -- 0:04:28
      155000 -- (-2171.878) (-2180.890) (-2174.418) [-2177.435] * [-2176.190] (-2181.976) (-2173.018) (-2176.148) -- 0:04:32

      Average standard deviation of split frequencies: 0.010879

      155500 -- (-2174.035) [-2173.275] (-2172.334) (-2178.027) * (-2172.677) [-2170.141] (-2171.685) (-2173.121) -- 0:04:31
      156000 -- (-2172.643) (-2180.226) (-2174.939) [-2174.146] * (-2180.893) [-2173.237] (-2172.654) (-2174.904) -- 0:04:30
      156500 -- (-2178.876) [-2174.967] (-2180.922) (-2173.216) * [-2173.520] (-2166.557) (-2171.593) (-2175.300) -- 0:04:29
      157000 -- (-2177.747) (-2182.653) (-2175.821) [-2177.771] * (-2177.994) (-2172.365) [-2173.192] (-2180.561) -- 0:04:28
      157500 -- (-2171.890) (-2181.824) (-2175.986) [-2169.943] * [-2174.233] (-2170.374) (-2177.664) (-2178.790) -- 0:04:27
      158000 -- [-2180.599] (-2179.057) (-2175.245) (-2169.158) * (-2173.090) (-2174.513) (-2180.918) [-2175.285] -- 0:04:31
      158500 -- (-2174.111) (-2175.683) [-2173.913] (-2180.291) * (-2176.399) (-2173.042) [-2176.791] (-2177.990) -- 0:04:30
      159000 -- (-2181.087) [-2171.747] (-2174.945) (-2171.184) * (-2173.451) (-2170.142) (-2172.081) [-2177.820] -- 0:04:29
      159500 -- (-2185.828) [-2174.285] (-2176.724) (-2169.770) * [-2171.177] (-2170.971) (-2170.517) (-2173.570) -- 0:04:28
      160000 -- (-2177.950) [-2171.393] (-2173.698) (-2180.606) * (-2180.034) [-2172.740] (-2179.996) (-2175.383) -- 0:04:27

      Average standard deviation of split frequencies: 0.008215

      160500 -- (-2185.030) (-2166.519) (-2170.381) [-2171.681] * (-2177.634) [-2170.992] (-2170.013) (-2178.381) -- 0:04:26
      161000 -- [-2171.332] (-2179.149) (-2175.195) (-2177.095) * (-2174.519) (-2170.728) [-2168.579] (-2173.927) -- 0:04:30
      161500 -- [-2173.750] (-2171.482) (-2174.509) (-2180.181) * (-2175.786) (-2179.375) (-2175.696) [-2172.653] -- 0:04:29
      162000 -- (-2177.880) [-2175.556] (-2174.642) (-2192.817) * (-2180.466) (-2175.625) [-2172.683] (-2175.831) -- 0:04:28
      162500 -- (-2173.808) (-2171.032) (-2183.533) [-2170.998] * (-2183.493) (-2178.937) [-2172.781] (-2177.691) -- 0:04:28
      163000 -- (-2175.245) [-2172.788] (-2175.353) (-2171.334) * (-2184.390) (-2173.199) [-2170.183] (-2176.653) -- 0:04:27
      163500 -- [-2172.458] (-2174.106) (-2179.674) (-2178.635) * (-2176.706) [-2177.918] (-2177.177) (-2175.250) -- 0:04:26
      164000 -- (-2182.322) [-2168.173] (-2172.333) (-2176.275) * [-2174.635] (-2170.222) (-2175.245) (-2173.950) -- 0:04:25
      164500 -- (-2180.717) [-2172.136] (-2175.829) (-2176.247) * (-2173.818) (-2176.676) (-2171.271) [-2175.835] -- 0:04:29
      165000 -- (-2180.527) (-2173.655) (-2173.873) [-2173.883] * (-2177.503) [-2172.540] (-2171.764) (-2183.684) -- 0:04:28

      Average standard deviation of split frequencies: 0.008519

      165500 -- (-2173.679) (-2173.782) (-2172.391) [-2172.793] * (-2175.320) [-2169.361] (-2175.819) (-2182.218) -- 0:04:27
      166000 -- (-2179.989) (-2176.006) (-2182.406) [-2176.029] * [-2181.857] (-2174.284) (-2179.719) (-2182.281) -- 0:04:26
      166500 -- (-2173.270) [-2172.775] (-2178.019) (-2171.560) * (-2177.450) (-2173.479) (-2174.726) [-2169.740] -- 0:04:25
      167000 -- (-2169.753) (-2172.568) [-2175.051] (-2177.351) * (-2173.747) [-2174.450] (-2176.374) (-2170.463) -- 0:04:24
      167500 -- (-2171.135) (-2180.692) [-2170.621] (-2172.840) * (-2171.186) [-2173.909] (-2175.575) (-2173.275) -- 0:04:28
      168000 -- (-2170.172) (-2176.996) [-2175.635] (-2174.317) * (-2182.573) (-2171.567) (-2177.192) [-2167.792] -- 0:04:27
      168500 -- (-2171.538) (-2181.945) [-2170.412] (-2173.159) * [-2177.431] (-2172.198) (-2173.258) (-2175.141) -- 0:04:26
      169000 -- (-2172.291) [-2177.447] (-2173.833) (-2177.297) * (-2170.878) (-2174.781) [-2170.130] (-2172.513) -- 0:04:25
      169500 -- (-2174.602) (-2170.361) [-2171.555] (-2170.070) * (-2177.237) [-2178.586] (-2178.211) (-2173.756) -- 0:04:24
      170000 -- (-2171.477) (-2173.294) [-2174.470] (-2181.270) * (-2169.105) (-2177.475) [-2178.343] (-2173.594) -- 0:04:23

      Average standard deviation of split frequencies: 0.011601

      170500 -- [-2175.489] (-2176.484) (-2170.744) (-2172.356) * (-2174.354) (-2171.827) (-2188.364) [-2169.830] -- 0:04:27
      171000 -- (-2171.435) (-2173.020) [-2173.454] (-2178.602) * (-2171.000) [-2169.430] (-2186.570) (-2173.741) -- 0:04:26
      171500 -- (-2179.766) (-2171.881) (-2174.533) [-2169.220] * (-2187.792) (-2177.353) (-2181.297) [-2168.371] -- 0:04:25
      172000 -- (-2175.217) (-2175.541) [-2175.806] (-2172.814) * (-2172.266) (-2173.306) [-2172.968] (-2170.902) -- 0:04:24
      172500 -- (-2174.834) [-2176.892] (-2176.205) (-2172.968) * (-2167.525) (-2178.658) (-2178.927) [-2174.417] -- 0:04:23
      173000 -- (-2175.232) (-2179.743) [-2172.854] (-2172.108) * (-2176.445) (-2169.936) (-2174.332) [-2174.267] -- 0:04:22
      173500 -- (-2177.401) (-2175.176) [-2175.185] (-2167.619) * [-2173.450] (-2177.752) (-2174.266) (-2171.536) -- 0:04:22
      174000 -- (-2169.765) (-2172.490) [-2171.772] (-2170.943) * (-2168.126) (-2178.065) (-2179.451) [-2170.336] -- 0:04:25
      174500 -- (-2168.655) [-2169.955] (-2167.774) (-2170.735) * [-2167.109] (-2175.693) (-2182.198) (-2171.378) -- 0:04:24
      175000 -- (-2174.539) (-2173.412) [-2173.923] (-2177.520) * (-2172.561) [-2180.802] (-2178.530) (-2174.927) -- 0:04:24

      Average standard deviation of split frequencies: 0.012856

      175500 -- (-2175.981) (-2169.897) (-2172.987) [-2183.348] * (-2175.699) (-2182.517) [-2174.533] (-2171.845) -- 0:04:23
      176000 -- [-2170.768] (-2170.087) (-2178.220) (-2178.296) * (-2175.315) (-2173.560) [-2179.731] (-2171.233) -- 0:04:22
      176500 -- (-2181.278) [-2173.030] (-2176.041) (-2178.209) * (-2168.903) (-2180.413) (-2177.850) [-2169.516] -- 0:04:21
      177000 -- [-2174.544] (-2173.430) (-2173.643) (-2170.101) * (-2177.070) (-2178.917) [-2173.621] (-2176.335) -- 0:04:25
      177500 -- (-2181.604) [-2169.904] (-2181.719) (-2171.922) * (-2179.896) (-2176.723) [-2169.437] (-2172.309) -- 0:04:24
      178000 -- (-2180.994) [-2179.493] (-2175.405) (-2175.025) * [-2174.745] (-2180.182) (-2174.157) (-2174.369) -- 0:04:23
      178500 -- (-2171.390) [-2174.466] (-2177.564) (-2175.038) * [-2170.156] (-2183.137) (-2176.288) (-2172.709) -- 0:04:22
      179000 -- [-2169.458] (-2177.345) (-2170.231) (-2177.463) * [-2174.779] (-2180.333) (-2174.930) (-2175.290) -- 0:04:21
      179500 -- [-2171.936] (-2174.586) (-2173.595) (-2183.146) * (-2177.710) (-2183.452) [-2182.148] (-2174.089) -- 0:04:20
      180000 -- (-2168.287) (-2177.170) [-2172.314] (-2175.232) * (-2173.500) (-2175.271) [-2173.906] (-2174.893) -- 0:04:24

      Average standard deviation of split frequencies: 0.012003

      180500 -- (-2171.102) (-2171.096) [-2175.678] (-2182.110) * [-2169.611] (-2172.009) (-2179.946) (-2181.669) -- 0:04:23
      181000 -- (-2178.243) [-2170.591] (-2177.731) (-2181.815) * [-2174.994] (-2171.098) (-2176.256) (-2172.458) -- 0:04:22
      181500 -- (-2178.811) (-2182.787) [-2175.152] (-2182.916) * (-2170.946) [-2172.628] (-2181.871) (-2172.459) -- 0:04:21
      182000 -- [-2169.676] (-2176.823) (-2174.210) (-2183.575) * (-2177.063) (-2174.291) [-2172.406] (-2174.731) -- 0:04:20
      182500 -- (-2169.359) [-2176.494] (-2178.068) (-2175.794) * (-2173.255) (-2180.850) (-2174.396) [-2175.512] -- 0:04:19
      183000 -- [-2171.988] (-2173.807) (-2185.439) (-2185.544) * (-2171.108) (-2177.191) (-2183.471) [-2172.266] -- 0:04:18
      183500 -- [-2172.815] (-2173.298) (-2172.597) (-2184.302) * (-2176.905) (-2179.200) [-2176.949] (-2175.889) -- 0:04:22
      184000 -- (-2171.301) (-2179.000) [-2171.285] (-2182.303) * [-2172.128] (-2174.903) (-2181.165) (-2174.990) -- 0:04:21
      184500 -- (-2174.650) (-2181.584) [-2174.346] (-2172.272) * (-2175.744) (-2173.561) [-2171.677] (-2178.120) -- 0:04:20
      185000 -- (-2169.950) (-2178.825) [-2173.762] (-2176.938) * (-2176.137) (-2174.324) [-2173.358] (-2181.289) -- 0:04:19

      Average standard deviation of split frequencies: 0.011658

      185500 -- (-2173.216) (-2169.325) (-2170.810) [-2177.481] * (-2177.301) (-2178.922) [-2173.340] (-2183.280) -- 0:04:19
      186000 -- (-2176.103) (-2168.705) (-2172.122) [-2175.892] * (-2181.493) (-2176.706) (-2178.557) [-2177.567] -- 0:04:18
      186500 -- (-2171.709) (-2169.067) [-2171.981] (-2177.772) * [-2173.101] (-2178.469) (-2171.806) (-2172.189) -- 0:04:21
      187000 -- (-2179.611) [-2175.924] (-2176.456) (-2173.021) * (-2174.757) [-2169.184] (-2173.122) (-2170.958) -- 0:04:20
      187500 -- (-2176.456) [-2172.054] (-2180.549) (-2177.330) * (-2184.238) [-2174.880] (-2177.229) (-2179.303) -- 0:04:20
      188000 -- (-2171.888) (-2177.822) [-2179.243] (-2175.293) * (-2177.254) [-2171.667] (-2177.491) (-2177.816) -- 0:04:19
      188500 -- (-2170.757) (-2178.658) (-2184.287) [-2178.692] * [-2171.529] (-2172.302) (-2170.170) (-2178.301) -- 0:04:18
      189000 -- (-2173.244) (-2172.638) [-2175.841] (-2176.867) * (-2176.595) (-2179.839) [-2169.131] (-2171.977) -- 0:04:17
      189500 -- (-2168.757) [-2171.495] (-2178.236) (-2175.673) * (-2176.852) (-2169.347) [-2169.815] (-2169.110) -- 0:04:20
      190000 -- (-2171.516) (-2179.008) [-2176.474] (-2177.857) * (-2178.037) (-2172.920) [-2174.075] (-2177.643) -- 0:04:20

      Average standard deviation of split frequencies: 0.009890

      190500 -- [-2171.400] (-2178.780) (-2177.660) (-2167.530) * (-2169.048) (-2173.187) (-2173.867) [-2169.842] -- 0:04:19
      191000 -- [-2168.393] (-2175.899) (-2175.330) (-2170.253) * (-2180.428) [-2179.984] (-2177.133) (-2174.592) -- 0:04:18
      191500 -- [-2174.509] (-2188.029) (-2173.138) (-2172.185) * [-2174.674] (-2174.525) (-2185.511) (-2171.452) -- 0:04:17
      192000 -- (-2168.637) [-2172.350] (-2179.023) (-2174.073) * (-2176.508) (-2183.137) [-2176.498] (-2180.427) -- 0:04:16
      192500 -- [-2178.683] (-2176.351) (-2175.476) (-2177.635) * (-2168.828) (-2174.847) (-2181.150) [-2173.964] -- 0:04:20
      193000 -- (-2168.923) (-2173.180) [-2177.257] (-2184.354) * (-2178.535) (-2180.095) [-2173.228] (-2175.839) -- 0:04:19
      193500 -- [-2172.606] (-2172.977) (-2177.752) (-2181.122) * (-2182.500) (-2172.325) [-2175.053] (-2180.300) -- 0:04:18
      194000 -- [-2169.397] (-2173.879) (-2184.030) (-2171.737) * (-2172.890) (-2171.948) (-2174.354) [-2177.069] -- 0:04:17
      194500 -- [-2170.583] (-2170.867) (-2175.437) (-2171.548) * (-2172.661) [-2172.126] (-2175.243) (-2173.696) -- 0:04:16
      195000 -- (-2172.689) (-2173.905) (-2174.297) [-2176.565] * [-2171.335] (-2174.929) (-2172.545) (-2178.844) -- 0:04:15

      Average standard deviation of split frequencies: 0.010583

      195500 -- (-2172.952) (-2178.951) (-2171.547) [-2173.128] * (-2177.626) (-2172.265) (-2167.847) [-2175.219] -- 0:04:15
      196000 -- (-2174.566) [-2171.099] (-2174.427) (-2168.536) * (-2176.134) [-2173.351] (-2173.964) (-2185.073) -- 0:04:18
      196500 -- (-2177.764) [-2169.038] (-2178.408) (-2172.451) * (-2178.667) [-2175.117] (-2176.955) (-2187.421) -- 0:04:17
      197000 -- [-2172.455] (-2171.247) (-2179.618) (-2176.122) * (-2174.747) [-2172.549] (-2180.959) (-2173.482) -- 0:04:16
      197500 -- (-2170.039) (-2173.862) [-2173.880] (-2174.272) * (-2170.190) (-2176.351) (-2170.579) [-2178.495] -- 0:04:15
      198000 -- [-2167.155] (-2172.750) (-2173.303) (-2174.597) * [-2174.904] (-2176.775) (-2172.205) (-2175.571) -- 0:04:15
      198500 -- [-2176.415] (-2180.879) (-2171.021) (-2170.723) * (-2178.424) (-2181.487) (-2173.283) [-2175.136] -- 0:04:14
      199000 -- (-2176.684) (-2176.634) (-2177.676) [-2171.349] * (-2177.347) (-2176.139) [-2171.169] (-2177.010) -- 0:04:17
      199500 -- (-2172.220) (-2173.670) (-2166.766) [-2173.111] * (-2177.535) (-2177.021) (-2173.344) [-2174.522] -- 0:04:16
      200000 -- (-2178.215) (-2174.459) [-2168.870] (-2170.311) * (-2174.005) [-2173.096] (-2171.929) (-2176.898) -- 0:04:16

      Average standard deviation of split frequencies: 0.009397

      200500 -- (-2176.314) [-2171.797] (-2176.021) (-2170.573) * (-2174.443) (-2177.773) [-2170.219] (-2175.320) -- 0:04:15
      201000 -- (-2175.576) [-2171.353] (-2176.381) (-2172.590) * (-2176.524) (-2183.747) [-2173.815] (-2168.770) -- 0:04:14
      201500 -- [-2169.495] (-2177.047) (-2173.509) (-2169.431) * (-2171.149) (-2182.902) (-2175.401) [-2175.785] -- 0:04:13
      202000 -- (-2182.208) (-2175.772) (-2183.763) [-2176.085] * (-2171.921) [-2177.570] (-2178.240) (-2186.226) -- 0:04:16
      202500 -- (-2172.575) (-2172.539) [-2173.377] (-2177.133) * (-2171.274) (-2176.387) (-2173.519) [-2174.154] -- 0:04:15
      203000 -- (-2176.295) (-2172.338) [-2168.135] (-2186.904) * [-2176.556] (-2175.129) (-2175.068) (-2177.920) -- 0:04:15
      203500 -- (-2175.379) [-2173.141] (-2177.251) (-2173.807) * (-2179.225) [-2174.338] (-2173.285) (-2181.925) -- 0:04:14
      204000 -- (-2177.718) (-2175.367) [-2170.758] (-2172.922) * (-2180.689) (-2170.965) (-2175.716) [-2170.221] -- 0:04:13
      204500 -- (-2174.582) (-2173.344) [-2169.311] (-2174.610) * [-2175.186] (-2171.881) (-2175.837) (-2171.184) -- 0:04:12
      205000 -- (-2172.201) (-2171.343) (-2172.200) [-2165.862] * (-2177.186) [-2173.063] (-2177.097) (-2176.363) -- 0:04:12

      Average standard deviation of split frequencies: 0.010984

      205500 -- (-2175.033) (-2177.746) [-2170.619] (-2171.891) * [-2173.415] (-2175.969) (-2178.140) (-2179.864) -- 0:04:15
      206000 -- (-2177.049) [-2170.652] (-2170.900) (-2174.390) * [-2174.444] (-2171.996) (-2181.130) (-2177.381) -- 0:04:14
      206500 -- (-2182.837) (-2176.796) (-2180.367) [-2173.596] * (-2176.925) [-2168.480] (-2179.196) (-2172.767) -- 0:04:13
      207000 -- (-2177.717) [-2167.777] (-2177.531) (-2167.854) * (-2178.752) [-2167.853] (-2177.252) (-2175.620) -- 0:04:12
      207500 -- (-2183.212) [-2174.540] (-2175.732) (-2172.662) * [-2175.221] (-2174.083) (-2181.051) (-2179.131) -- 0:04:12
      208000 -- (-2176.150) (-2172.454) (-2172.698) [-2172.392] * [-2173.305] (-2180.589) (-2177.375) (-2179.243) -- 0:04:11
      208500 -- (-2175.975) (-2171.677) (-2180.224) [-2170.487] * (-2172.808) (-2179.202) (-2174.753) [-2172.594] -- 0:04:14
      209000 -- (-2171.975) [-2168.571] (-2174.998) (-2176.616) * (-2169.032) (-2179.822) (-2177.087) [-2175.847] -- 0:04:13
      209500 -- (-2175.519) (-2173.562) [-2178.834] (-2172.454) * (-2176.261) (-2183.246) [-2170.391] (-2179.878) -- 0:04:12
      210000 -- (-2168.346) (-2179.065) [-2174.080] (-2174.032) * (-2172.353) [-2172.643] (-2174.791) (-2173.135) -- 0:04:12

      Average standard deviation of split frequencies: 0.009846

      210500 -- (-2175.149) [-2174.836] (-2181.072) (-2170.596) * (-2177.818) (-2174.260) [-2179.219] (-2170.608) -- 0:04:11
      211000 -- (-2180.085) [-2172.118] (-2176.220) (-2174.565) * [-2172.467] (-2174.796) (-2181.459) (-2175.428) -- 0:04:10
      211500 -- (-2174.231) (-2172.754) (-2177.271) [-2173.410] * (-2174.396) [-2175.821] (-2180.500) (-2175.230) -- 0:04:13
      212000 -- (-2172.637) (-2171.512) (-2171.797) [-2171.689] * [-2180.006] (-2173.867) (-2181.364) (-2173.993) -- 0:04:12
      212500 -- (-2175.140) (-2179.185) (-2176.132) [-2169.208] * [-2174.806] (-2172.952) (-2180.280) (-2175.812) -- 0:04:12
      213000 -- (-2175.380) (-2175.495) (-2176.883) [-2177.516] * (-2169.567) (-2175.009) (-2173.311) [-2174.875] -- 0:04:11
      213500 -- (-2172.072) (-2176.158) [-2179.453] (-2180.796) * (-2179.670) (-2176.754) [-2168.295] (-2179.063) -- 0:04:10
      214000 -- [-2171.732] (-2178.453) (-2177.309) (-2185.744) * [-2177.591] (-2175.515) (-2171.073) (-2171.739) -- 0:04:09
      214500 -- (-2171.874) (-2197.494) [-2171.719] (-2172.620) * (-2193.591) (-2181.265) (-2170.255) [-2171.195] -- 0:04:09
      215000 -- (-2170.717) (-2174.240) [-2174.384] (-2177.496) * [-2174.816] (-2169.394) (-2170.494) (-2176.438) -- 0:04:11

      Average standard deviation of split frequencies: 0.009603

      215500 -- (-2184.506) (-2173.473) [-2172.058] (-2174.454) * (-2171.069) [-2180.784] (-2179.099) (-2175.077) -- 0:04:11
      216000 -- (-2174.513) (-2179.849) [-2172.112] (-2176.601) * (-2173.847) (-2179.177) [-2179.425] (-2179.348) -- 0:04:10
      216500 -- (-2172.413) [-2172.216] (-2177.836) (-2172.743) * (-2177.737) [-2168.986] (-2173.840) (-2178.454) -- 0:04:09
      217000 -- [-2172.741] (-2178.760) (-2175.367) (-2173.174) * (-2176.996) [-2173.045] (-2184.687) (-2176.384) -- 0:04:08
      217500 -- [-2173.904] (-2173.240) (-2171.977) (-2177.375) * (-2175.479) (-2172.189) (-2180.893) [-2175.564] -- 0:04:08
      218000 -- (-2174.866) (-2170.383) [-2172.918] (-2180.996) * (-2180.049) [-2173.688] (-2173.131) (-2177.444) -- 0:04:11
      218500 -- (-2174.890) (-2174.363) (-2173.658) [-2170.220] * [-2173.749] (-2171.944) (-2170.945) (-2177.189) -- 0:04:10
      219000 -- (-2186.375) [-2177.478] (-2170.139) (-2178.960) * [-2175.437] (-2173.735) (-2169.327) (-2173.221) -- 0:04:09
      219500 -- (-2177.765) (-2179.266) [-2171.154] (-2173.966) * [-2171.355] (-2177.624) (-2171.443) (-2170.978) -- 0:04:08
      220000 -- (-2174.553) (-2170.403) [-2168.845] (-2174.129) * (-2172.127) (-2174.964) [-2168.810] (-2174.334) -- 0:04:08

      Average standard deviation of split frequencies: 0.010254

      220500 -- [-2172.123] (-2188.532) (-2175.261) (-2171.228) * (-2171.340) (-2170.889) [-2172.831] (-2178.487) -- 0:04:07
      221000 -- [-2180.725] (-2173.294) (-2173.039) (-2175.675) * (-2184.044) (-2173.787) [-2175.224] (-2177.936) -- 0:04:10
      221500 -- (-2193.616) (-2172.451) [-2172.086] (-2176.877) * (-2175.927) (-2177.237) (-2172.784) [-2174.597] -- 0:04:09
      222000 -- (-2179.738) (-2172.766) (-2174.296) [-2167.988] * (-2173.207) (-2176.304) (-2178.833) [-2169.770] -- 0:04:08
      222500 -- [-2174.628] (-2189.053) (-2180.334) (-2174.214) * (-2170.084) [-2176.453] (-2170.289) (-2167.575) -- 0:04:08
      223000 -- [-2176.632] (-2173.089) (-2177.921) (-2181.196) * (-2174.056) (-2176.886) [-2169.643] (-2174.239) -- 0:04:07
      223500 -- [-2176.475] (-2173.505) (-2174.793) (-2175.340) * (-2172.592) (-2180.230) [-2176.392] (-2173.963) -- 0:04:06
      224000 -- (-2173.944) (-2174.251) (-2171.016) [-2172.962] * [-2172.723] (-2173.694) (-2175.251) (-2177.399) -- 0:04:05
      224500 -- [-2171.145] (-2179.574) (-2177.504) (-2170.859) * [-2174.107] (-2173.117) (-2170.189) (-2168.493) -- 0:04:08
      225000 -- [-2173.924] (-2179.980) (-2184.214) (-2175.006) * (-2171.346) (-2169.716) (-2173.838) [-2173.851] -- 0:04:08

      Average standard deviation of split frequencies: 0.009595

      225500 -- (-2170.913) [-2176.474] (-2173.181) (-2171.699) * (-2173.727) (-2171.206) (-2170.967) [-2178.039] -- 0:04:07
      226000 -- (-2171.578) (-2174.652) [-2175.879] (-2173.987) * [-2169.595] (-2175.412) (-2169.746) (-2176.458) -- 0:04:06
      226500 -- (-2177.124) [-2177.637] (-2173.755) (-2177.099) * [-2174.761] (-2168.720) (-2173.943) (-2175.500) -- 0:04:05
      227000 -- (-2172.923) [-2175.483] (-2177.190) (-2169.801) * (-2172.723) (-2170.624) [-2172.135] (-2168.456) -- 0:04:05
      227500 -- (-2176.281) (-2171.344) (-2183.688) [-2178.426] * (-2170.764) (-2171.365) [-2167.670] (-2170.635) -- 0:04:07
      228000 -- (-2176.113) [-2179.066] (-2179.198) (-2175.449) * (-2169.475) (-2169.250) (-2172.502) [-2175.926] -- 0:04:07
      228500 -- (-2178.135) (-2173.637) [-2173.096] (-2177.180) * (-2169.624) [-2167.737] (-2180.154) (-2169.572) -- 0:04:06
      229000 -- (-2179.170) (-2185.544) [-2172.708] (-2178.418) * (-2175.785) [-2174.201] (-2176.241) (-2170.931) -- 0:04:05
      229500 -- (-2178.888) (-2187.140) [-2170.204] (-2175.246) * [-2173.165] (-2177.671) (-2173.010) (-2176.703) -- 0:04:05
      230000 -- [-2172.996] (-2176.687) (-2169.852) (-2175.386) * (-2174.915) [-2178.069] (-2172.638) (-2178.353) -- 0:04:04

      Average standard deviation of split frequencies: 0.006131

      230500 -- (-2182.169) (-2182.097) [-2169.091] (-2178.623) * (-2172.148) (-2173.290) (-2178.350) [-2172.571] -- 0:04:07
      231000 -- (-2174.976) (-2176.231) [-2173.884] (-2173.626) * [-2171.775] (-2178.466) (-2171.004) (-2181.352) -- 0:04:06
      231500 -- (-2177.466) (-2171.007) (-2182.645) [-2168.954] * (-2175.372) [-2177.601] (-2177.522) (-2175.903) -- 0:04:05
      232000 -- (-2173.834) [-2169.732] (-2185.682) (-2174.519) * (-2169.805) [-2175.609] (-2172.392) (-2177.644) -- 0:04:04
      232500 -- (-2179.192) (-2176.430) (-2181.418) [-2169.429] * [-2174.151] (-2175.581) (-2171.247) (-2172.993) -- 0:04:04
      233000 -- (-2174.439) (-2166.748) (-2173.645) [-2170.345] * (-2176.331) (-2174.623) (-2171.114) [-2169.580] -- 0:04:03
      233500 -- (-2172.771) (-2172.259) (-2174.082) [-2173.247] * [-2173.546] (-2172.037) (-2180.552) (-2174.874) -- 0:04:02
      234000 -- [-2171.622] (-2173.998) (-2172.727) (-2176.979) * (-2172.597) (-2171.860) [-2175.297] (-2174.450) -- 0:04:05
      234500 -- (-2174.755) (-2174.863) (-2179.208) [-2180.691] * (-2178.785) (-2175.112) (-2185.752) [-2179.383] -- 0:04:04
      235000 -- [-2175.804] (-2178.397) (-2175.896) (-2168.440) * [-2177.979] (-2172.271) (-2174.037) (-2174.417) -- 0:04:04

      Average standard deviation of split frequencies: 0.006392

      235500 -- (-2173.949) [-2174.752] (-2171.808) (-2170.273) * (-2176.167) [-2172.874] (-2180.552) (-2172.158) -- 0:04:03
      236000 -- [-2171.119] (-2180.624) (-2170.467) (-2176.558) * [-2177.544] (-2175.615) (-2186.104) (-2176.937) -- 0:04:02
      236500 -- [-2174.981] (-2176.450) (-2173.942) (-2173.115) * [-2181.375] (-2183.807) (-2174.153) (-2175.353) -- 0:04:02
      237000 -- (-2179.590) (-2172.201) [-2177.579] (-2176.136) * [-2175.453] (-2180.156) (-2179.926) (-2176.364) -- 0:04:04
      237500 -- [-2178.481] (-2176.337) (-2177.017) (-2176.321) * (-2179.813) (-2174.606) (-2181.287) [-2177.163] -- 0:04:04
      238000 -- [-2171.143] (-2172.699) (-2177.176) (-2175.859) * (-2180.943) (-2172.579) (-2176.225) [-2182.503] -- 0:04:03
      238500 -- [-2171.909] (-2182.734) (-2171.676) (-2178.812) * (-2176.617) [-2175.590] (-2172.865) (-2177.723) -- 0:04:02
      239000 -- [-2171.229] (-2167.657) (-2178.712) (-2177.724) * (-2176.787) (-2175.264) [-2173.484] (-2171.543) -- 0:04:01
      239500 -- (-2179.104) (-2177.677) [-2172.719] (-2172.940) * (-2178.413) (-2171.051) [-2173.016] (-2170.827) -- 0:04:01
      240000 -- [-2175.629] (-2177.759) (-2175.517) (-2172.533) * (-2177.470) (-2169.872) (-2172.351) [-2168.199] -- 0:04:03

      Average standard deviation of split frequencies: 0.007443

      240500 -- (-2178.454) (-2179.240) (-2174.760) [-2177.733] * (-2187.205) [-2169.803] (-2180.713) (-2177.172) -- 0:04:03
      241000 -- (-2177.789) (-2173.300) [-2171.234] (-2180.770) * (-2185.263) [-2173.577] (-2170.642) (-2175.853) -- 0:04:02
      241500 -- (-2173.337) (-2170.571) [-2169.434] (-2171.773) * (-2180.909) (-2171.856) (-2177.117) [-2174.994] -- 0:04:01
      242000 -- (-2175.886) (-2172.035) [-2175.858] (-2175.896) * (-2179.747) [-2169.621] (-2180.928) (-2173.214) -- 0:04:01
      242500 -- (-2173.355) [-2171.642] (-2172.474) (-2182.941) * (-2179.078) [-2176.531] (-2176.346) (-2175.157) -- 0:04:00
      243000 -- [-2175.941] (-2177.653) (-2178.805) (-2176.272) * [-2178.472] (-2181.642) (-2173.466) (-2175.652) -- 0:03:59
      243500 -- [-2175.659] (-2170.034) (-2169.334) (-2184.225) * (-2176.059) (-2173.516) [-2173.318] (-2182.309) -- 0:04:02
      244000 -- [-2174.958] (-2178.398) (-2174.397) (-2171.900) * (-2171.945) (-2179.058) (-2173.305) [-2189.865] -- 0:04:01
      244500 -- (-2178.077) [-2173.495] (-2171.910) (-2168.016) * (-2174.452) [-2172.719] (-2174.822) (-2186.819) -- 0:04:01
      245000 -- (-2172.974) (-2173.431) [-2171.726] (-2170.535) * [-2175.236] (-2171.232) (-2175.014) (-2172.982) -- 0:04:00

      Average standard deviation of split frequencies: 0.007282

      245500 -- (-2173.591) (-2176.265) [-2174.771] (-2177.380) * (-2171.934) (-2174.999) [-2179.696] (-2183.267) -- 0:03:59
      246000 -- (-2174.137) (-2178.138) [-2174.552] (-2179.222) * (-2184.599) (-2173.265) [-2170.299] (-2177.518) -- 0:03:59
      246500 -- (-2174.869) (-2173.431) (-2181.982) [-2178.757] * (-2172.548) [-2173.663] (-2175.908) (-2176.239) -- 0:04:01
      247000 -- [-2174.928] (-2174.948) (-2172.395) (-2176.983) * [-2173.476] (-2185.823) (-2174.903) (-2188.771) -- 0:04:00
      247500 -- [-2172.096] (-2173.102) (-2172.935) (-2181.895) * (-2175.703) (-2179.291) (-2172.457) [-2176.235] -- 0:04:00
      248000 -- (-2176.262) [-2172.072] (-2172.377) (-2175.691) * (-2175.998) (-2173.394) (-2174.429) [-2170.538] -- 0:03:59
      248500 -- (-2174.100) (-2186.400) [-2169.816] (-2180.119) * (-2176.090) (-2173.861) [-2173.358] (-2174.171) -- 0:03:58
      249000 -- (-2175.726) (-2181.482) [-2174.142] (-2177.127) * (-2178.094) [-2172.418] (-2176.735) (-2171.348) -- 0:03:58
      249500 -- (-2175.330) (-2174.070) [-2167.692] (-2174.781) * (-2174.113) [-2176.482] (-2172.444) (-2175.939) -- 0:04:00
      250000 -- (-2176.885) (-2176.766) [-2176.709] (-2175.116) * (-2187.922) (-2175.557) [-2170.156] (-2184.380) -- 0:04:00

      Average standard deviation of split frequencies: 0.007899

      250500 -- (-2174.601) [-2174.773] (-2167.911) (-2183.321) * (-2174.741) (-2175.739) (-2170.747) [-2176.037] -- 0:03:59
      251000 -- (-2177.635) [-2172.859] (-2178.597) (-2171.421) * (-2175.226) [-2171.416] (-2178.397) (-2176.601) -- 0:03:58
      251500 -- [-2172.654] (-2176.545) (-2180.200) (-2177.965) * (-2172.678) (-2178.268) [-2173.591] (-2175.913) -- 0:03:58
      252000 -- (-2168.677) (-2173.377) [-2172.802] (-2176.662) * (-2172.463) (-2177.494) (-2180.856) [-2174.186] -- 0:03:57
      252500 -- (-2169.423) [-2171.975] (-2173.652) (-2172.113) * [-2172.085] (-2175.013) (-2174.950) (-2177.589) -- 0:03:56
      253000 -- (-2183.243) (-2171.444) [-2178.700] (-2174.621) * (-2174.360) [-2169.701] (-2182.116) (-2176.266) -- 0:03:59
      253500 -- (-2176.247) [-2168.203] (-2173.590) (-2173.924) * (-2179.419) [-2176.789] (-2175.135) (-2180.017) -- 0:03:58
      254000 -- (-2181.709) (-2175.318) (-2175.296) [-2173.139] * (-2173.308) (-2177.500) [-2169.757] (-2175.229) -- 0:03:57
      254500 -- [-2174.712] (-2169.414) (-2173.271) (-2172.283) * (-2181.332) (-2172.067) (-2173.130) [-2170.098] -- 0:03:57
      255000 -- [-2172.009] (-2174.221) (-2171.712) (-2169.555) * [-2171.343] (-2175.826) (-2174.604) (-2175.052) -- 0:03:56

      Average standard deviation of split frequencies: 0.007734

      255500 -- (-2173.427) [-2172.727] (-2175.731) (-2173.054) * [-2172.155] (-2172.697) (-2171.296) (-2176.636) -- 0:03:56
      256000 -- (-2176.029) [-2176.932] (-2172.171) (-2169.595) * (-2170.247) (-2180.211) (-2174.599) [-2173.286] -- 0:03:58
      256500 -- (-2173.134) (-2175.497) (-2172.606) [-2168.793] * (-2173.059) (-2176.819) [-2171.033] (-2176.340) -- 0:03:57
      257000 -- (-2180.547) (-2181.014) (-2170.913) [-2173.152] * (-2171.874) (-2174.719) [-2173.044] (-2172.946) -- 0:03:57
      257500 -- (-2172.785) (-2184.821) [-2172.442] (-2177.008) * [-2172.311] (-2175.864) (-2172.517) (-2174.434) -- 0:03:56
      258000 -- (-2178.558) (-2183.460) [-2172.730] (-2179.678) * (-2178.019) (-2180.176) [-2171.841] (-2176.592) -- 0:03:55
      258500 -- [-2176.711] (-2183.603) (-2176.526) (-2170.536) * [-2175.886] (-2175.311) (-2172.430) (-2171.779) -- 0:03:55
      259000 -- (-2172.432) (-2179.533) [-2174.455] (-2170.748) * (-2183.166) (-2177.988) (-2172.703) [-2173.619] -- 0:03:57
      259500 -- [-2175.185] (-2174.645) (-2177.976) (-2168.965) * (-2173.593) [-2174.496] (-2171.200) (-2175.620) -- 0:03:56
      260000 -- [-2174.943] (-2182.363) (-2177.482) (-2173.719) * [-2172.762] (-2176.122) (-2176.755) (-2174.983) -- 0:03:56

      Average standard deviation of split frequencies: 0.007957

      260500 -- (-2174.331) [-2176.779] (-2175.111) (-2178.651) * (-2178.829) (-2183.206) [-2180.319] (-2177.873) -- 0:03:55
      261000 -- (-2173.837) [-2172.433] (-2181.571) (-2172.761) * (-2175.204) [-2177.983] (-2174.829) (-2171.770) -- 0:03:55
      261500 -- [-2185.148] (-2177.064) (-2175.708) (-2177.043) * [-2171.279] (-2175.246) (-2171.140) (-2174.561) -- 0:03:54
      262000 -- (-2175.775) (-2176.401) [-2172.685] (-2172.800) * (-2169.294) [-2172.003] (-2174.731) (-2172.793) -- 0:03:56
      262500 -- [-2169.512] (-2187.245) (-2169.718) (-2180.415) * (-2177.016) [-2166.794] (-2173.519) (-2178.306) -- 0:03:56
      263000 -- (-2176.440) [-2172.450] (-2175.604) (-2173.670) * (-2176.777) (-2170.699) (-2176.716) [-2166.246] -- 0:03:55
      263500 -- (-2171.417) (-2169.132) [-2178.645] (-2166.037) * [-2174.693] (-2181.386) (-2170.542) (-2172.417) -- 0:03:54
      264000 -- (-2178.077) [-2170.310] (-2169.718) (-2173.507) * (-2176.098) (-2172.396) (-2177.886) [-2174.291] -- 0:03:54
      264500 -- (-2173.842) (-2176.687) [-2171.839] (-2175.365) * (-2176.962) [-2173.028] (-2171.960) (-2175.763) -- 0:03:53
      265000 -- (-2177.559) (-2168.016) [-2173.641] (-2182.738) * (-2176.896) [-2180.569] (-2171.864) (-2174.756) -- 0:03:52

      Average standard deviation of split frequencies: 0.006734

      265500 -- [-2175.097] (-2176.110) (-2171.593) (-2171.580) * (-2176.128) (-2176.215) [-2175.363] (-2176.213) -- 0:03:55
      266000 -- [-2177.240] (-2188.667) (-2172.095) (-2171.198) * (-2178.978) (-2173.473) (-2185.678) [-2176.228] -- 0:03:54
      266500 -- [-2176.409] (-2176.778) (-2174.518) (-2174.377) * (-2173.892) (-2175.592) (-2184.007) [-2177.292] -- 0:03:53
      267000 -- (-2179.043) (-2180.634) (-2175.845) [-2171.144] * [-2169.860] (-2173.440) (-2178.864) (-2174.947) -- 0:03:53
      267500 -- (-2185.416) (-2182.320) (-2172.397) [-2174.325] * (-2179.610) [-2170.864] (-2174.635) (-2175.388) -- 0:03:52
      268000 -- [-2173.383] (-2181.012) (-2173.463) (-2172.203) * [-2171.187] (-2174.753) (-2179.766) (-2178.475) -- 0:03:52
      268500 -- (-2174.427) (-2189.663) [-2171.006] (-2169.580) * [-2168.762] (-2192.347) (-2174.579) (-2176.338) -- 0:03:54
      269000 -- (-2174.625) (-2184.475) (-2173.420) [-2170.505] * (-2175.416) (-2176.765) (-2175.758) [-2172.573] -- 0:03:53
      269500 -- [-2174.152] (-2172.145) (-2177.092) (-2172.178) * [-2172.211] (-2172.869) (-2179.443) (-2176.384) -- 0:03:53
      270000 -- (-2180.408) (-2168.213) (-2176.971) [-2175.267] * (-2193.920) (-2173.902) [-2172.223] (-2177.092) -- 0:03:52

      Average standard deviation of split frequencies: 0.005573

      270500 -- (-2177.868) (-2176.287) (-2173.698) [-2175.018] * [-2178.500] (-2172.579) (-2187.283) (-2173.342) -- 0:03:51
      271000 -- (-2176.245) (-2185.576) (-2176.093) [-2175.383] * (-2183.882) [-2176.006] (-2171.755) (-2174.991) -- 0:03:51
      271500 -- (-2184.438) (-2176.323) (-2169.270) [-2169.680] * (-2171.553) [-2175.474] (-2173.792) (-2172.600) -- 0:03:53
      272000 -- (-2186.061) (-2174.128) (-2176.696) [-2176.685] * [-2182.928] (-2181.187) (-2176.935) (-2178.249) -- 0:03:52
      272500 -- (-2186.594) (-2175.606) (-2169.277) [-2172.270] * (-2177.094) (-2178.118) (-2174.749) [-2174.383] -- 0:03:52
      273000 -- [-2180.713] (-2169.736) (-2179.879) (-2178.126) * [-2173.517] (-2172.356) (-2174.446) (-2170.612) -- 0:03:51
      273500 -- (-2174.645) (-2172.639) (-2186.691) [-2179.469] * (-2172.520) [-2174.613] (-2180.532) (-2176.627) -- 0:03:51
      274000 -- (-2172.173) (-2172.235) [-2178.738] (-2176.565) * (-2173.488) (-2178.552) (-2170.719) [-2166.880] -- 0:03:50
      274500 -- (-2175.060) [-2172.752] (-2175.077) (-2170.851) * (-2174.960) (-2171.718) (-2171.201) [-2175.050] -- 0:03:49
      275000 -- (-2176.402) [-2177.336] (-2180.246) (-2175.192) * (-2171.981) (-2172.196) [-2174.899] (-2169.059) -- 0:03:52

      Average standard deviation of split frequencies: 0.003758

      275500 -- (-2175.870) [-2170.003] (-2175.107) (-2176.920) * (-2179.561) (-2171.304) [-2179.728] (-2175.481) -- 0:03:51
      276000 -- (-2173.488) [-2175.260] (-2174.460) (-2171.696) * [-2174.691] (-2174.926) (-2181.748) (-2175.419) -- 0:03:50
      276500 -- (-2174.697) (-2176.668) (-2173.960) [-2176.015] * (-2172.410) [-2167.807] (-2173.162) (-2173.408) -- 0:03:50
      277000 -- [-2169.947] (-2174.146) (-2181.788) (-2170.232) * [-2166.986] (-2170.002) (-2178.991) (-2174.977) -- 0:03:49
      277500 -- [-2176.748] (-2185.205) (-2174.006) (-2189.080) * [-2170.908] (-2174.577) (-2172.986) (-2177.952) -- 0:03:49
      278000 -- (-2169.166) [-2177.054] (-2178.767) (-2173.463) * [-2173.015] (-2171.044) (-2177.089) (-2177.030) -- 0:03:51
      278500 -- (-2175.871) (-2171.576) [-2174.505] (-2176.404) * (-2175.488) (-2177.392) [-2174.515] (-2180.234) -- 0:03:50
      279000 -- [-2180.280] (-2173.094) (-2175.605) (-2174.644) * [-2178.600] (-2170.885) (-2171.434) (-2178.205) -- 0:03:49
      279500 -- (-2182.509) (-2175.019) [-2175.154] (-2172.856) * (-2172.574) (-2179.644) (-2178.263) [-2173.690] -- 0:03:49
      280000 -- [-2172.520] (-2177.183) (-2177.421) (-2170.437) * (-2173.261) (-2178.548) [-2174.462] (-2176.324) -- 0:03:48

      Average standard deviation of split frequencies: 0.004031

      280500 -- [-2175.860] (-2172.818) (-2171.956) (-2170.937) * (-2170.547) (-2173.631) [-2174.789] (-2171.392) -- 0:03:48
      281000 -- (-2177.905) [-2175.048] (-2174.780) (-2172.037) * (-2172.480) (-2174.876) (-2169.140) [-2168.303] -- 0:03:47
      281500 -- (-2176.627) (-2177.251) [-2172.049] (-2168.820) * (-2170.313) [-2168.426] (-2174.735) (-2173.008) -- 0:03:49
      282000 -- (-2173.013) (-2177.026) [-2169.949] (-2174.549) * [-2168.832] (-2180.640) (-2174.770) (-2174.942) -- 0:03:49
      282500 -- (-2173.837) (-2178.471) [-2173.662] (-2168.777) * (-2173.641) (-2173.629) (-2179.376) [-2170.525] -- 0:03:48
      283000 -- (-2174.266) (-2171.962) (-2172.803) [-2171.737] * (-2176.073) [-2170.531] (-2169.339) (-2170.564) -- 0:03:48
      283500 -- (-2179.975) (-2185.194) [-2171.357] (-2168.386) * [-2171.576] (-2180.225) (-2177.907) (-2165.736) -- 0:03:47
      284000 -- [-2174.209] (-2175.306) (-2175.721) (-2168.924) * (-2178.502) (-2177.455) [-2175.862] (-2168.444) -- 0:03:49
      284500 -- [-2175.679] (-2172.289) (-2174.248) (-2178.942) * (-2173.212) (-2174.619) (-2181.763) [-2174.412] -- 0:03:48
      285000 -- [-2174.167] (-2173.353) (-2171.763) (-2185.452) * [-2171.714] (-2177.045) (-2172.096) (-2169.584) -- 0:03:48

      Average standard deviation of split frequencies: 0.004615

      285500 -- [-2170.125] (-2173.980) (-2177.060) (-2178.665) * (-2184.381) [-2173.150] (-2175.311) (-2174.403) -- 0:03:47
      286000 -- (-2176.329) (-2175.292) [-2175.803] (-2179.756) * (-2173.636) [-2172.424] (-2177.048) (-2170.957) -- 0:03:47
      286500 -- (-2173.406) (-2168.912) (-2181.807) [-2173.276] * (-2172.103) (-2181.263) [-2172.543] (-2173.135) -- 0:03:49
      287000 -- (-2180.924) (-2170.629) (-2170.865) [-2174.316] * [-2173.330] (-2175.490) (-2178.775) (-2183.213) -- 0:03:48
      287500 -- (-2178.159) (-2172.020) (-2178.488) [-2177.764] * (-2172.556) (-2175.067) [-2171.196] (-2175.753) -- 0:03:48
      288000 -- (-2177.798) (-2176.137) (-2180.831) [-2168.359] * [-2171.926] (-2173.595) (-2179.804) (-2171.522) -- 0:03:47
      288500 -- (-2170.106) (-2172.156) (-2175.605) [-2172.393] * [-2168.164] (-2168.735) (-2183.653) (-2178.129) -- 0:03:46
      289000 -- (-2171.691) (-2175.380) (-2177.508) [-2171.220] * (-2170.617) (-2172.360) [-2174.046] (-2170.083) -- 0:03:48
      289500 -- (-2174.732) (-2175.660) (-2178.811) [-2170.209] * [-2171.945] (-2176.537) (-2173.490) (-2176.424) -- 0:03:48
      290000 -- (-2171.910) [-2177.775] (-2170.749) (-2175.064) * (-2173.775) (-2171.916) [-2170.628] (-2174.266) -- 0:03:47

      Average standard deviation of split frequencies: 0.005190

      290500 -- [-2172.356] (-2177.027) (-2180.600) (-2174.887) * (-2179.181) [-2177.122] (-2171.744) (-2174.003) -- 0:03:47
      291000 -- (-2180.611) [-2183.864] (-2174.555) (-2176.666) * (-2169.045) [-2171.124] (-2174.028) (-2172.411) -- 0:03:46
      291500 -- (-2171.075) (-2183.544) (-2176.253) [-2175.393] * (-2185.318) (-2178.478) (-2172.229) [-2179.169] -- 0:03:48
      292000 -- [-2173.770] (-2183.439) (-2178.010) (-2173.230) * (-2179.435) (-2184.671) (-2168.560) [-2175.426] -- 0:03:47
      292500 -- (-2173.972) (-2180.314) (-2173.541) [-2176.966] * (-2175.872) (-2176.806) [-2170.987] (-2173.392) -- 0:03:47
      293000 -- (-2174.989) [-2181.645] (-2184.299) (-2172.882) * (-2178.130) (-2182.113) [-2170.425] (-2178.944) -- 0:03:46
      293500 -- (-2180.679) (-2174.140) (-2176.305) [-2171.363] * (-2174.985) (-2172.363) [-2169.227] (-2178.899) -- 0:03:46
      294000 -- (-2172.998) [-2172.370] (-2170.343) (-2170.497) * (-2175.178) [-2171.240] (-2171.143) (-2171.611) -- 0:03:45
      294500 -- [-2171.804] (-2173.909) (-2174.678) (-2175.010) * (-2174.863) (-2172.261) (-2173.747) [-2174.080] -- 0:03:47
      295000 -- (-2178.454) (-2172.664) [-2174.398] (-2173.515) * [-2176.822] (-2167.276) (-2173.016) (-2169.857) -- 0:03:47

      Average standard deviation of split frequencies: 0.005096

      295500 -- (-2172.440) (-2172.425) (-2183.325) [-2172.077] * (-2173.295) (-2177.110) [-2181.390] (-2174.632) -- 0:03:46
      296000 -- (-2177.930) (-2175.110) (-2179.563) [-2171.456] * (-2176.536) [-2171.091] (-2170.971) (-2176.953) -- 0:03:45
      296500 -- (-2171.778) (-2174.339) (-2176.261) [-2174.836] * [-2175.551] (-2176.277) (-2170.462) (-2171.121) -- 0:03:45
      297000 -- (-2169.669) (-2173.509) [-2174.760] (-2174.996) * (-2176.366) (-2175.940) [-2171.695] (-2171.694) -- 0:03:47
      297500 -- (-2174.089) [-2176.878] (-2173.297) (-2175.638) * (-2175.388) [-2171.297] (-2169.751) (-2178.241) -- 0:03:46
      298000 -- (-2175.868) (-2174.859) (-2171.135) [-2169.623] * [-2173.733] (-2175.101) (-2174.467) (-2173.020) -- 0:03:46
      298500 -- (-2174.968) [-2173.473] (-2181.344) (-2173.677) * [-2167.986] (-2174.666) (-2171.839) (-2182.159) -- 0:03:45
      299000 -- [-2171.889] (-2176.888) (-2187.526) (-2171.927) * (-2172.970) (-2173.532) (-2177.251) [-2173.573] -- 0:03:45
      299500 -- (-2174.315) (-2182.467) [-2186.011] (-2174.467) * (-2172.645) (-2169.256) [-2174.529] (-2175.595) -- 0:03:44
      300000 -- (-2172.128) (-2181.961) [-2179.075] (-2180.506) * (-2175.011) [-2171.529] (-2173.711) (-2176.093) -- 0:03:46

      Average standard deviation of split frequencies: 0.004312

      300500 -- (-2171.890) (-2176.195) (-2186.225) [-2173.371] * (-2180.710) [-2173.487] (-2181.200) (-2167.788) -- 0:03:45
      301000 -- [-2175.508] (-2184.789) (-2178.089) (-2179.310) * (-2183.637) (-2174.732) [-2176.287] (-2171.895) -- 0:03:45
      301500 -- (-2172.297) (-2172.468) [-2169.269] (-2175.766) * (-2167.151) (-2175.630) [-2175.506] (-2176.531) -- 0:03:44
      302000 -- (-2176.962) (-2173.220) [-2173.034] (-2177.605) * [-2168.137] (-2169.530) (-2179.552) (-2171.205) -- 0:03:44
      302500 -- (-2176.523) (-2172.480) (-2176.634) [-2174.214] * (-2175.874) [-2175.968] (-2168.249) (-2171.506) -- 0:03:43
      303000 -- (-2171.386) (-2184.582) [-2176.781] (-2173.001) * (-2177.188) (-2172.566) (-2172.605) [-2170.336] -- 0:03:45
      303500 -- (-2174.834) (-2187.547) (-2169.473) [-2174.318] * (-2179.270) (-2168.551) (-2171.196) [-2171.985] -- 0:03:44
      304000 -- (-2175.681) [-2173.567] (-2175.754) (-2180.137) * (-2172.828) (-2174.650) [-2174.051] (-2169.598) -- 0:03:44
      304500 -- [-2174.448] (-2173.901) (-2169.397) (-2174.984) * (-2188.774) [-2168.680] (-2173.808) (-2170.541) -- 0:03:43
      305000 -- [-2179.930] (-2178.695) (-2181.524) (-2176.052) * (-2176.422) (-2170.861) (-2171.839) [-2177.422] -- 0:03:43

      Average standard deviation of split frequencies: 0.003697

      305500 -- (-2181.064) [-2167.301] (-2184.770) (-2174.097) * [-2170.229] (-2174.462) (-2172.046) (-2171.112) -- 0:03:42
      306000 -- (-2175.000) [-2171.816] (-2179.444) (-2172.787) * (-2191.712) (-2172.434) [-2174.625] (-2172.558) -- 0:03:42
      306500 -- (-2174.975) [-2176.520] (-2175.925) (-2184.097) * (-2177.310) (-2174.646) (-2174.498) [-2175.141] -- 0:03:44
      307000 -- (-2173.544) (-2167.834) [-2175.422] (-2186.943) * (-2177.228) [-2182.086] (-2170.296) (-2175.177) -- 0:03:43
      307500 -- (-2173.586) (-2177.630) [-2174.977] (-2172.419) * (-2174.955) [-2174.817] (-2175.518) (-2177.104) -- 0:03:42
      308000 -- (-2170.871) (-2187.782) (-2170.806) [-2177.613] * (-2170.696) [-2174.961] (-2168.792) (-2176.006) -- 0:03:42
      308500 -- [-2176.009] (-2187.332) (-2174.936) (-2176.371) * (-2173.734) (-2174.954) [-2176.743] (-2175.102) -- 0:03:41
      309000 -- [-2168.772] (-2177.879) (-2179.313) (-2175.061) * (-2169.868) (-2177.514) [-2176.503] (-2178.984) -- 0:03:41
      309500 -- (-2175.514) (-2178.386) (-2174.127) [-2172.684] * (-2181.045) [-2173.152] (-2172.010) (-2173.711) -- 0:03:43
      310000 -- (-2172.853) (-2178.957) (-2183.380) [-2170.977] * (-2178.573) [-2177.247] (-2168.838) (-2172.794) -- 0:03:42

      Average standard deviation of split frequencies: 0.003338

      310500 -- (-2170.405) (-2178.606) (-2178.062) [-2173.362] * (-2172.594) [-2172.069] (-2169.450) (-2171.677) -- 0:03:42
      311000 -- (-2172.035) (-2183.243) (-2169.977) [-2168.905] * [-2175.985] (-2175.225) (-2177.814) (-2173.910) -- 0:03:41
      311500 -- (-2179.920) (-2184.400) (-2174.414) [-2183.287] * [-2176.441] (-2176.077) (-2173.485) (-2178.009) -- 0:03:41
      312000 -- (-2180.450) (-2176.986) [-2173.923] (-2176.452) * (-2173.923) [-2178.058] (-2177.273) (-2174.044) -- 0:03:40
      312500 -- (-2172.369) (-2175.176) [-2175.104] (-2171.816) * [-2175.538] (-2172.273) (-2179.484) (-2173.869) -- 0:03:42
      313000 -- (-2178.799) (-2179.972) [-2170.497] (-2176.816) * (-2176.669) [-2173.064] (-2182.911) (-2170.068) -- 0:03:41
      313500 -- [-2173.155] (-2173.425) (-2179.055) (-2179.354) * (-2176.444) (-2182.033) (-2180.653) [-2177.333] -- 0:03:41
      314000 -- [-2175.130] (-2175.831) (-2177.941) (-2177.535) * (-2173.868) (-2189.466) [-2175.983] (-2176.005) -- 0:03:40
      314500 -- [-2175.608] (-2174.345) (-2177.780) (-2171.972) * [-2168.259] (-2181.147) (-2173.818) (-2174.385) -- 0:03:40
      315000 -- [-2172.288] (-2172.162) (-2178.066) (-2180.047) * [-2175.900] (-2179.207) (-2171.278) (-2174.300) -- 0:03:39

      Average standard deviation of split frequencies: 0.003357

      315500 -- [-2168.921] (-2169.812) (-2179.540) (-2173.210) * (-2175.172) [-2174.255] (-2181.929) (-2179.325) -- 0:03:39
      316000 -- (-2172.583) [-2169.446] (-2177.149) (-2182.041) * (-2178.335) (-2172.802) (-2169.311) [-2170.822] -- 0:03:40
      316500 -- [-2174.507] (-2173.992) (-2177.119) (-2170.310) * (-2171.643) (-2173.772) (-2176.520) [-2173.616] -- 0:03:40
      317000 -- (-2173.675) [-2177.262] (-2177.720) (-2172.068) * (-2174.675) (-2175.328) [-2170.766] (-2176.908) -- 0:03:39
      317500 -- (-2170.263) (-2170.301) (-2182.401) [-2175.787] * (-2169.352) (-2178.747) [-2178.751] (-2172.237) -- 0:03:39
      318000 -- [-2169.839] (-2173.804) (-2176.795) (-2182.494) * (-2170.506) [-2173.722] (-2177.125) (-2175.002) -- 0:03:38
      318500 -- [-2174.267] (-2172.414) (-2178.095) (-2181.547) * (-2174.008) (-2174.969) [-2174.916] (-2177.490) -- 0:03:38
      319000 -- (-2174.428) (-2182.219) [-2168.698] (-2177.873) * (-2177.200) [-2173.199] (-2177.191) (-2177.054) -- 0:03:39
      319500 -- [-2177.206] (-2176.911) (-2171.192) (-2181.461) * [-2174.550] (-2173.462) (-2170.148) (-2176.107) -- 0:03:39
      320000 -- (-2169.311) (-2176.011) [-2168.887] (-2171.533) * (-2170.702) [-2174.027] (-2172.984) (-2176.069) -- 0:03:38

      Average standard deviation of split frequencies: 0.003675

      320500 -- (-2176.424) (-2173.577) [-2173.198] (-2171.072) * [-2171.223] (-2175.510) (-2176.513) (-2186.438) -- 0:03:38
      321000 -- (-2171.436) (-2171.138) [-2174.810] (-2181.462) * (-2173.893) (-2180.734) [-2172.543] (-2178.298) -- 0:03:37
      321500 -- (-2172.416) [-2169.015] (-2172.080) (-2179.201) * (-2175.427) [-2174.017] (-2182.066) (-2173.305) -- 0:03:37
      322000 -- (-2175.909) (-2180.986) [-2172.227] (-2179.198) * (-2175.213) [-2173.245] (-2175.356) (-2174.958) -- 0:03:38
      322500 -- (-2175.385) (-2175.684) (-2172.393) [-2177.521] * (-2181.993) (-2176.385) [-2174.910] (-2177.163) -- 0:03:38
      323000 -- (-2179.281) [-2174.188] (-2173.682) (-2171.168) * (-2180.920) [-2170.476] (-2179.962) (-2183.368) -- 0:03:37
      323500 -- [-2171.493] (-2178.054) (-2170.146) (-2182.229) * [-2178.000] (-2173.333) (-2178.450) (-2174.698) -- 0:03:37
      324000 -- (-2180.397) [-2174.844] (-2179.396) (-2176.409) * (-2182.895) [-2171.581] (-2177.232) (-2170.634) -- 0:03:36
      324500 -- (-2169.116) (-2171.625) [-2170.043] (-2170.429) * (-2188.764) [-2173.016] (-2176.616) (-2173.020) -- 0:03:36
      325000 -- (-2172.637) (-2180.095) [-2174.250] (-2175.356) * (-2184.705) (-2178.052) [-2186.443] (-2176.192) -- 0:03:36

      Average standard deviation of split frequencies: 0.002892

      325500 -- [-2173.971] (-2175.509) (-2170.780) (-2173.945) * (-2182.623) (-2180.297) [-2173.295] (-2175.440) -- 0:03:37
      326000 -- [-2172.549] (-2171.554) (-2174.490) (-2176.209) * (-2176.361) (-2174.933) (-2171.956) [-2171.333] -- 0:03:37
      326500 -- (-2172.858) (-2172.765) (-2171.135) [-2170.054] * [-2178.884] (-2174.544) (-2174.574) (-2177.201) -- 0:03:36
      327000 -- [-2176.153] (-2178.493) (-2183.843) (-2175.113) * (-2171.568) (-2177.091) (-2179.179) [-2170.123] -- 0:03:36
      327500 -- [-2172.528] (-2183.050) (-2180.152) (-2170.981) * (-2172.200) (-2179.354) (-2177.997) [-2169.791] -- 0:03:35
      328000 -- [-2174.943] (-2174.306) (-2176.353) (-2174.806) * [-2173.732] (-2175.441) (-2176.479) (-2174.876) -- 0:03:35
      328500 -- (-2181.270) (-2174.394) (-2174.800) [-2173.418] * (-2176.744) (-2172.625) [-2174.497] (-2172.517) -- 0:03:36
      329000 -- [-2173.501] (-2179.537) (-2180.758) (-2182.126) * (-2171.862) (-2182.760) (-2176.664) [-2172.558] -- 0:03:36
      329500 -- (-2179.575) [-2172.189] (-2174.275) (-2171.224) * [-2172.552] (-2179.681) (-2170.024) (-2171.952) -- 0:03:35
      330000 -- (-2177.512) (-2175.716) (-2172.885) [-2168.503] * [-2167.357] (-2174.875) (-2173.187) (-2171.600) -- 0:03:35

      Average standard deviation of split frequencies: 0.002138

      330500 -- [-2180.117] (-2172.376) (-2177.154) (-2175.137) * (-2178.989) (-2170.849) (-2181.054) [-2172.978] -- 0:03:34
      331000 -- (-2179.854) (-2180.705) [-2171.593] (-2174.068) * [-2180.938] (-2173.384) (-2173.698) (-2178.137) -- 0:03:34
      331500 -- (-2176.881) (-2168.609) (-2174.927) [-2174.257] * (-2170.207) (-2182.811) [-2171.327] (-2174.619) -- 0:03:35
      332000 -- [-2179.668] (-2185.837) (-2174.204) (-2171.067) * [-2172.523] (-2175.296) (-2173.350) (-2174.976) -- 0:03:35
      332500 -- (-2185.069) (-2175.625) (-2173.761) [-2176.208] * (-2178.102) [-2178.206] (-2168.698) (-2175.352) -- 0:03:34
      333000 -- (-2181.054) (-2181.300) (-2180.560) [-2175.876] * [-2180.001] (-2174.230) (-2175.787) (-2175.808) -- 0:03:34
      333500 -- (-2173.865) [-2170.305] (-2174.379) (-2167.552) * [-2171.370] (-2184.522) (-2172.604) (-2174.153) -- 0:03:33
      334000 -- (-2168.981) (-2171.836) [-2176.879] (-2169.451) * (-2178.142) (-2175.313) (-2172.352) [-2173.899] -- 0:03:33
      334500 -- [-2171.659] (-2172.025) (-2183.469) (-2177.495) * [-2171.519] (-2173.034) (-2187.060) (-2175.139) -- 0:03:32
      335000 -- (-2175.664) [-2171.044] (-2177.961) (-2176.269) * (-2183.330) (-2171.748) (-2184.197) [-2180.189] -- 0:03:34

      Average standard deviation of split frequencies: 0.002104

      335500 -- (-2179.294) (-2176.291) [-2169.181] (-2173.955) * [-2175.680] (-2172.738) (-2176.197) (-2185.379) -- 0:03:33
      336000 -- (-2168.842) (-2174.348) (-2171.476) [-2174.734] * (-2176.195) (-2175.424) (-2173.123) [-2175.624] -- 0:03:33
      336500 -- [-2176.786] (-2179.304) (-2171.662) (-2174.903) * (-2176.212) (-2170.620) [-2174.017] (-2176.164) -- 0:03:32
      337000 -- (-2179.305) (-2176.994) (-2178.858) [-2169.419] * (-2172.054) (-2174.227) (-2184.576) [-2173.567] -- 0:03:32
      337500 -- (-2183.448) [-2174.901] (-2170.061) (-2175.718) * [-2172.983] (-2180.453) (-2174.608) (-2180.789) -- 0:03:32
      338000 -- (-2175.889) [-2171.134] (-2172.117) (-2174.929) * [-2175.237] (-2171.710) (-2179.589) (-2179.079) -- 0:03:33
      338500 -- (-2171.022) (-2172.772) [-2170.890] (-2176.936) * (-2177.250) (-2174.353) [-2175.445] (-2184.135) -- 0:03:33
      339000 -- [-2177.603] (-2169.672) (-2178.567) (-2178.067) * [-2179.772] (-2173.055) (-2185.596) (-2188.296) -- 0:03:32
      339500 -- (-2177.854) [-2169.338] (-2172.753) (-2179.897) * [-2171.097] (-2172.335) (-2177.798) (-2183.618) -- 0:03:32
      340000 -- [-2174.162] (-2176.920) (-2176.375) (-2183.201) * (-2172.915) [-2172.887] (-2186.966) (-2177.252) -- 0:03:31

      Average standard deviation of split frequencies: 0.002076

      340500 -- (-2170.405) (-2183.194) [-2176.020] (-2180.154) * (-2177.180) [-2172.389] (-2192.175) (-2175.994) -- 0:03:31
      341000 -- (-2172.704) [-2176.133] (-2171.342) (-2173.386) * [-2171.420] (-2170.161) (-2178.878) (-2174.896) -- 0:03:32
      341500 -- (-2171.188) (-2169.913) (-2170.328) [-2173.613] * [-2170.380] (-2176.475) (-2177.469) (-2176.330) -- 0:03:32
      342000 -- [-2170.664] (-2176.020) (-2171.043) (-2169.590) * (-2170.938) [-2176.472] (-2174.301) (-2175.319) -- 0:03:31
      342500 -- [-2171.138] (-2178.414) (-2178.262) (-2175.127) * (-2172.378) [-2173.006] (-2169.543) (-2177.259) -- 0:03:31
      343000 -- (-2171.633) (-2171.401) (-2173.633) [-2178.185] * [-2171.387] (-2175.926) (-2171.472) (-2176.174) -- 0:03:30
      343500 -- (-2180.634) [-2177.232] (-2174.864) (-2174.067) * (-2173.924) (-2171.031) (-2175.715) [-2172.547] -- 0:03:30
      344000 -- (-2186.467) (-2178.103) (-2173.234) [-2169.973] * (-2173.266) (-2173.726) [-2176.219] (-2177.294) -- 0:03:29
      344500 -- (-2173.051) [-2172.248] (-2178.399) (-2171.428) * (-2174.987) (-2183.948) (-2172.533) [-2172.678] -- 0:03:31
      345000 -- [-2173.107] (-2178.140) (-2175.152) (-2174.478) * [-2174.817] (-2174.927) (-2171.913) (-2171.136) -- 0:03:30

      Average standard deviation of split frequencies: 0.002725

      345500 -- [-2172.796] (-2173.321) (-2174.823) (-2177.960) * [-2175.644] (-2182.784) (-2175.149) (-2171.232) -- 0:03:30
      346000 -- (-2181.560) (-2192.287) [-2167.909] (-2172.680) * (-2176.173) [-2170.841] (-2177.423) (-2171.677) -- 0:03:29
      346500 -- [-2174.939] (-2183.324) (-2167.873) (-2174.866) * [-2169.768] (-2176.337) (-2182.125) (-2179.327) -- 0:03:29
      347000 -- (-2179.731) (-2174.375) [-2171.874] (-2172.044) * (-2173.868) (-2178.773) [-2178.096] (-2185.768) -- 0:03:28
      347500 -- (-2177.009) (-2176.798) [-2171.631] (-2179.670) * (-2175.204) (-2186.277) (-2182.903) [-2173.830] -- 0:03:30
      348000 -- [-2175.778] (-2174.210) (-2177.111) (-2181.101) * (-2174.193) (-2182.935) (-2170.280) [-2175.934] -- 0:03:29
      348500 -- [-2171.446] (-2172.206) (-2178.485) (-2172.099) * (-2170.020) (-2176.713) (-2177.402) [-2174.617] -- 0:03:29
      349000 -- (-2173.191) (-2176.254) [-2173.863] (-2174.374) * (-2171.007) [-2179.716] (-2177.406) (-2174.337) -- 0:03:28
      349500 -- (-2177.592) [-2170.184] (-2173.647) (-2175.293) * (-2171.550) [-2178.090] (-2178.315) (-2171.824) -- 0:03:28
      350000 -- (-2177.832) (-2167.285) (-2172.817) [-2174.860] * (-2172.769) (-2173.456) (-2180.764) [-2176.024] -- 0:03:28

      Average standard deviation of split frequencies: 0.003025

      350500 -- (-2172.540) (-2170.308) (-2171.398) [-2174.773] * [-2172.535] (-2173.169) (-2177.100) (-2173.959) -- 0:03:29
      351000 -- (-2170.756) [-2171.236] (-2183.385) (-2180.916) * (-2170.238) (-2176.570) [-2173.938] (-2179.283) -- 0:03:28
      351500 -- (-2180.560) [-2168.908] (-2176.410) (-2177.881) * (-2173.075) [-2178.290] (-2179.491) (-2172.309) -- 0:03:28
      352000 -- (-2174.461) (-2174.601) (-2169.742) [-2173.798] * (-2177.477) [-2174.174] (-2187.281) (-2170.417) -- 0:03:28
      352500 -- (-2175.759) (-2177.500) (-2180.370) [-2175.269] * (-2172.911) (-2172.793) (-2177.489) [-2171.895] -- 0:03:27
      353000 -- (-2172.074) (-2172.913) [-2170.639] (-2175.787) * (-2171.786) [-2174.324] (-2177.873) (-2178.271) -- 0:03:27
      353500 -- [-2171.925] (-2180.696) (-2173.477) (-2177.593) * (-2176.600) (-2171.697) (-2183.663) [-2174.985] -- 0:03:26
      354000 -- (-2171.454) (-2173.651) (-2174.113) [-2170.197] * (-2181.505) (-2172.331) [-2175.514] (-2172.181) -- 0:03:28
      354500 -- (-2178.102) [-2179.514] (-2181.520) (-2176.059) * (-2174.713) (-2173.691) (-2179.348) [-2178.111] -- 0:03:27
      355000 -- [-2169.198] (-2177.870) (-2171.111) (-2171.608) * [-2177.086] (-2175.697) (-2180.433) (-2177.377) -- 0:03:27

      Average standard deviation of split frequencies: 0.003973

      355500 -- (-2173.153) (-2180.230) (-2170.474) [-2171.094] * (-2176.733) (-2171.263) (-2174.048) [-2177.398] -- 0:03:26
      356000 -- [-2172.037] (-2173.995) (-2173.068) (-2172.561) * (-2178.688) (-2176.916) [-2170.398] (-2172.920) -- 0:03:26
      356500 -- (-2176.094) (-2174.696) [-2183.171] (-2176.869) * (-2179.141) [-2175.385] (-2173.295) (-2168.839) -- 0:03:25
      357000 -- (-2174.022) (-2184.406) (-2177.208) [-2178.906] * (-2181.371) [-2176.246] (-2167.853) (-2181.619) -- 0:03:27
      357500 -- (-2175.067) (-2180.829) [-2175.174] (-2172.081) * [-2170.264] (-2177.724) (-2179.395) (-2178.290) -- 0:03:26
      358000 -- (-2172.962) [-2175.229] (-2174.184) (-2173.818) * [-2170.782] (-2173.877) (-2175.740) (-2172.787) -- 0:03:26
      358500 -- (-2175.997) [-2170.427] (-2169.772) (-2174.676) * (-2171.040) (-2183.890) (-2190.545) [-2168.371] -- 0:03:25
      359000 -- (-2182.577) (-2178.199) (-2174.101) [-2174.155] * (-2171.041) [-2175.461] (-2182.317) (-2170.514) -- 0:03:25
      359500 -- [-2171.721] (-2176.684) (-2177.720) (-2170.444) * (-2171.389) [-2180.469] (-2173.295) (-2170.122) -- 0:03:24
      360000 -- (-2170.073) (-2175.831) (-2184.071) [-2177.045] * [-2176.353] (-2183.474) (-2180.612) (-2177.533) -- 0:03:26

      Average standard deviation of split frequencies: 0.003594

      360500 -- (-2174.270) [-2173.168] (-2176.686) (-2183.663) * (-2178.391) (-2186.030) (-2172.276) [-2174.959] -- 0:03:25
      361000 -- [-2173.758] (-2178.155) (-2180.088) (-2176.602) * (-2177.897) [-2174.338] (-2170.154) (-2170.065) -- 0:03:25
      361500 -- (-2172.480) (-2169.337) [-2174.526] (-2168.678) * (-2176.128) (-2177.834) [-2174.391] (-2173.434) -- 0:03:24
      362000 -- (-2173.442) [-2174.303] (-2173.206) (-2179.025) * [-2184.075] (-2178.175) (-2182.700) (-2182.759) -- 0:03:24
      362500 -- (-2182.576) [-2170.928] (-2173.622) (-2189.491) * (-2173.561) (-2176.781) [-2169.166] (-2175.044) -- 0:03:24
      363000 -- [-2188.985] (-2185.856) (-2177.149) (-2175.560) * (-2172.519) (-2171.428) (-2180.929) [-2174.599] -- 0:03:23
      363500 -- (-2174.385) (-2176.535) (-2177.607) [-2173.150] * (-2172.303) [-2176.850] (-2181.408) (-2177.303) -- 0:03:24
      364000 -- (-2184.104) (-2178.983) (-2175.805) [-2172.531] * (-2172.232) (-2171.645) (-2182.409) [-2177.373] -- 0:03:24
      364500 -- (-2175.126) (-2180.605) [-2174.020] (-2189.564) * (-2174.949) (-2180.009) [-2171.254] (-2182.055) -- 0:03:23
      365000 -- (-2177.105) (-2183.080) [-2169.256] (-2175.768) * (-2177.320) (-2173.496) [-2168.724] (-2183.051) -- 0:03:23

      Average standard deviation of split frequencies: 0.004508

      365500 -- (-2177.762) (-2183.266) (-2176.884) [-2173.102] * (-2181.335) (-2178.510) (-2172.987) [-2176.419] -- 0:03:23
      366000 -- [-2171.530] (-2180.137) (-2172.450) (-2173.747) * [-2177.403] (-2177.408) (-2173.342) (-2178.152) -- 0:03:22
      366500 -- [-2174.356] (-2172.716) (-2181.211) (-2177.513) * [-2179.597] (-2181.977) (-2176.380) (-2179.545) -- 0:03:23
      367000 -- (-2176.285) (-2185.458) (-2171.261) [-2171.133] * [-2173.009] (-2175.234) (-2173.254) (-2182.123) -- 0:03:23
      367500 -- (-2180.339) (-2171.353) (-2180.363) [-2173.055] * (-2176.019) (-2171.256) (-2171.552) [-2177.504] -- 0:03:23
      368000 -- (-2172.112) (-2171.059) (-2171.963) [-2170.839] * (-2178.021) [-2174.249] (-2171.762) (-2181.660) -- 0:03:22
      368500 -- (-2176.279) [-2171.782] (-2175.615) (-2169.578) * [-2172.868] (-2174.217) (-2171.383) (-2181.997) -- 0:03:22
      369000 -- (-2174.104) [-2168.496] (-2184.480) (-2179.816) * (-2178.582) [-2170.385] (-2177.554) (-2173.060) -- 0:03:21
      369500 -- [-2170.513] (-2168.527) (-2176.917) (-2179.279) * [-2170.443] (-2176.256) (-2183.633) (-2174.532) -- 0:03:23
      370000 -- (-2173.163) [-2173.637] (-2174.014) (-2172.727) * (-2170.847) (-2182.319) (-2171.846) [-2168.350] -- 0:03:22

      Average standard deviation of split frequencies: 0.004451

      370500 -- (-2181.634) (-2168.382) [-2169.606] (-2174.695) * [-2178.198] (-2184.848) (-2173.126) (-2171.979) -- 0:03:22
      371000 -- (-2179.848) (-2173.773) (-2173.362) [-2175.967] * [-2169.395] (-2172.592) (-2180.093) (-2177.929) -- 0:03:21
      371500 -- (-2174.232) (-2173.153) [-2174.455] (-2168.727) * [-2178.698] (-2171.233) (-2183.757) (-2180.833) -- 0:03:21
      372000 -- (-2167.049) (-2171.036) [-2171.150] (-2175.263) * (-2170.311) (-2175.271) (-2176.912) [-2173.096] -- 0:03:20
      372500 -- (-2173.827) (-2174.092) [-2171.953] (-2175.756) * (-2177.583) [-2173.724] (-2174.442) (-2175.917) -- 0:03:20
      373000 -- (-2173.734) [-2172.002] (-2177.008) (-2177.278) * [-2171.910] (-2170.536) (-2181.781) (-2180.894) -- 0:03:21
      373500 -- (-2175.764) (-2177.845) (-2185.851) [-2168.765] * (-2185.807) [-2174.260] (-2174.499) (-2174.647) -- 0:03:21
      374000 -- (-2171.107) [-2175.970] (-2180.577) (-2183.543) * [-2176.680] (-2180.628) (-2171.730) (-2179.091) -- 0:03:20
      374500 -- (-2171.023) (-2172.654) [-2174.912] (-2177.276) * [-2177.782] (-2185.945) (-2175.998) (-2178.689) -- 0:03:20
      375000 -- (-2179.101) (-2171.252) (-2175.407) [-2178.395] * [-2174.584] (-2178.820) (-2175.818) (-2174.790) -- 0:03:20

      Average standard deviation of split frequencies: 0.006269

      375500 -- (-2174.315) (-2178.718) (-2180.773) [-2173.177] * (-2181.992) [-2173.817] (-2177.366) (-2171.055) -- 0:03:19
      376000 -- (-2179.863) [-2173.006] (-2178.490) (-2174.796) * (-2175.570) (-2169.284) (-2179.934) [-2176.509] -- 0:03:20
      376500 -- (-2177.912) (-2184.802) (-2182.056) [-2167.938] * (-2178.178) [-2173.852] (-2171.490) (-2170.413) -- 0:03:20
      377000 -- (-2180.284) [-2178.569] (-2182.153) (-2171.353) * (-2173.592) [-2171.625] (-2172.966) (-2173.509) -- 0:03:19
      377500 -- (-2168.766) [-2178.746] (-2180.564) (-2170.754) * (-2172.888) (-2178.095) [-2172.498] (-2170.396) -- 0:03:19
      378000 -- [-2172.593] (-2177.483) (-2175.916) (-2170.908) * (-2172.958) (-2176.439) [-2173.569] (-2171.484) -- 0:03:19
      378500 -- (-2169.306) (-2179.051) (-2173.604) [-2170.098] * (-2176.190) (-2172.421) [-2177.851] (-2176.237) -- 0:03:18
      379000 -- (-2173.651) (-2184.033) (-2170.823) [-2171.071] * (-2169.478) (-2173.857) [-2171.035] (-2177.091) -- 0:03:19
      379500 -- [-2179.365] (-2178.549) (-2182.677) (-2172.952) * (-2171.601) (-2175.732) [-2167.179] (-2170.992) -- 0:03:19
      380000 -- (-2170.655) [-2179.649] (-2185.982) (-2173.960) * (-2179.202) [-2172.078] (-2178.625) (-2172.703) -- 0:03:19

      Average standard deviation of split frequencies: 0.005944

      380500 -- (-2171.504) [-2176.059] (-2175.131) (-2173.151) * [-2176.327] (-2171.888) (-2174.139) (-2169.550) -- 0:03:18
      381000 -- (-2178.139) (-2179.414) [-2178.183] (-2178.235) * (-2171.196) (-2170.695) (-2182.214) [-2170.472] -- 0:03:18
      381500 -- (-2183.395) (-2177.753) [-2174.677] (-2169.205) * (-2171.691) (-2177.190) (-2176.824) [-2168.025] -- 0:03:17
      382000 -- (-2176.767) (-2173.522) (-2172.845) [-2165.474] * (-2177.128) [-2174.102] (-2178.861) (-2169.175) -- 0:03:17
      382500 -- (-2172.528) [-2172.921] (-2176.366) (-2173.372) * (-2178.825) [-2175.835] (-2172.848) (-2176.484) -- 0:03:18
      383000 -- (-2177.558) (-2171.307) (-2172.012) [-2170.533] * [-2171.032] (-2171.724) (-2172.341) (-2178.231) -- 0:03:18
      383500 -- (-2173.834) (-2173.836) (-2170.857) [-2171.692] * (-2169.696) (-2174.966) [-2173.828] (-2174.284) -- 0:03:17
      384000 -- [-2172.776] (-2171.586) (-2170.560) (-2173.980) * [-2170.320] (-2175.344) (-2173.315) (-2176.591) -- 0:03:17
      384500 -- (-2178.085) (-2172.125) (-2171.866) [-2173.718] * [-2171.102] (-2173.112) (-2173.372) (-2178.154) -- 0:03:16
      385000 -- (-2176.199) (-2174.237) [-2171.042] (-2176.148) * [-2171.729] (-2172.716) (-2171.359) (-2173.750) -- 0:03:16

      Average standard deviation of split frequencies: 0.005129

      385500 -- (-2174.925) [-2169.605] (-2172.569) (-2170.929) * [-2174.275] (-2176.532) (-2170.656) (-2176.584) -- 0:03:17
      386000 -- (-2173.093) [-2169.004] (-2174.403) (-2174.517) * (-2175.350) [-2173.198] (-2174.177) (-2173.555) -- 0:03:17
      386500 -- (-2171.617) [-2173.884] (-2173.807) (-2177.410) * (-2173.917) (-2171.919) (-2178.056) [-2169.569] -- 0:03:16
      387000 -- (-2180.834) (-2174.341) (-2176.589) [-2168.369] * [-2171.968] (-2174.676) (-2176.161) (-2178.066) -- 0:03:16
      387500 -- (-2182.290) (-2175.126) (-2176.302) [-2173.696] * (-2175.349) [-2176.476] (-2177.682) (-2168.151) -- 0:03:16
      388000 -- (-2186.627) (-2168.900) [-2172.886] (-2172.389) * (-2168.771) [-2169.098] (-2179.041) (-2172.837) -- 0:03:15
      388500 -- (-2184.787) (-2172.174) [-2172.777] (-2174.772) * (-2179.937) [-2179.991] (-2175.365) (-2182.995) -- 0:03:16
      389000 -- (-2178.992) (-2184.552) [-2176.388] (-2183.391) * (-2177.566) [-2170.067] (-2180.154) (-2172.349) -- 0:03:16
      389500 -- (-2186.620) (-2183.850) (-2176.845) [-2174.092] * (-2180.521) (-2177.365) (-2172.254) [-2169.225] -- 0:03:15
      390000 -- (-2176.907) (-2176.645) (-2173.232) [-2168.173] * [-2171.861] (-2170.543) (-2178.675) (-2170.929) -- 0:03:15

      Average standard deviation of split frequencies: 0.004525

      390500 -- (-2183.981) (-2172.201) (-2177.364) [-2175.112] * (-2177.658) (-2180.208) (-2172.015) [-2167.907] -- 0:03:15
      391000 -- (-2181.586) (-2176.198) (-2178.952) [-2174.859] * (-2171.795) (-2176.635) [-2172.464] (-2176.346) -- 0:03:14
      391500 -- (-2177.333) [-2170.013] (-2175.968) (-2181.366) * (-2184.720) [-2175.651] (-2172.319) (-2171.275) -- 0:03:14
      392000 -- (-2186.914) (-2172.630) [-2174.838] (-2169.774) * (-2174.361) [-2175.439] (-2175.840) (-2174.738) -- 0:03:15
      392500 -- [-2177.879] (-2173.126) (-2174.981) (-2174.052) * (-2173.298) [-2173.628] (-2183.649) (-2177.396) -- 0:03:15
      393000 -- (-2174.070) [-2176.343] (-2169.390) (-2176.119) * (-2168.972) [-2177.347] (-2177.358) (-2182.534) -- 0:03:14
      393500 -- (-2173.200) (-2173.168) [-2169.137] (-2173.572) * (-2175.075) (-2175.531) (-2171.958) [-2176.622] -- 0:03:14
      394000 -- [-2178.345] (-2169.391) (-2177.488) (-2174.850) * (-2178.562) [-2176.602] (-2179.749) (-2181.941) -- 0:03:13
      394500 -- (-2179.296) (-2175.150) [-2173.010] (-2168.847) * [-2178.238] (-2179.411) (-2172.944) (-2173.646) -- 0:03:13
      395000 -- (-2182.605) (-2178.134) [-2171.169] (-2175.992) * (-2174.585) (-2177.771) [-2171.981] (-2174.533) -- 0:03:14

      Average standard deviation of split frequencies: 0.004166

      395500 -- (-2182.222) (-2174.311) (-2174.407) [-2171.297] * [-2171.166] (-2170.244) (-2178.748) (-2171.609) -- 0:03:14
      396000 -- (-2178.442) (-2173.746) (-2181.053) [-2175.851] * [-2178.087] (-2184.795) (-2179.374) (-2177.422) -- 0:03:13
      396500 -- (-2179.908) (-2172.547) (-2173.683) [-2175.355] * [-2177.158] (-2176.400) (-2181.165) (-2176.891) -- 0:03:13
      397000 -- (-2178.433) (-2174.939) [-2172.428] (-2182.965) * (-2176.801) (-2172.265) [-2174.963] (-2177.866) -- 0:03:12
      397500 -- [-2180.116] (-2172.271) (-2176.548) (-2174.432) * (-2182.724) (-2180.056) (-2175.558) [-2175.966] -- 0:03:12
      398000 -- (-2172.126) (-2172.985) (-2178.115) [-2172.500] * [-2175.196] (-2179.799) (-2172.452) (-2174.746) -- 0:03:13
      398500 -- (-2191.840) (-2172.247) [-2170.643] (-2173.499) * (-2171.368) (-2171.747) (-2175.006) [-2175.420] -- 0:03:13
      399000 -- (-2173.286) [-2176.047] (-2178.509) (-2173.793) * (-2182.277) [-2173.533] (-2174.330) (-2172.421) -- 0:03:12
      399500 -- (-2172.921) [-2168.561] (-2180.557) (-2180.083) * (-2171.472) (-2170.444) [-2174.796] (-2175.004) -- 0:03:12
      400000 -- (-2174.997) (-2179.670) [-2167.940] (-2180.375) * (-2173.567) (-2177.506) [-2174.706] (-2181.831) -- 0:03:12

      Average standard deviation of split frequencies: 0.002353

      400500 -- [-2171.283] (-2171.693) (-2173.481) (-2175.714) * (-2181.859) (-2172.316) [-2173.519] (-2178.109) -- 0:03:11
      401000 -- (-2170.499) (-2183.335) (-2172.573) [-2171.961] * [-2172.486] (-2169.662) (-2176.936) (-2185.547) -- 0:03:11
      401500 -- [-2176.163] (-2174.158) (-2171.926) (-2173.134) * (-2178.871) (-2177.496) [-2173.159] (-2176.041) -- 0:03:12
      402000 -- (-2170.380) (-2178.639) [-2181.572] (-2176.212) * (-2172.304) (-2176.296) [-2170.640] (-2177.546) -- 0:03:11
      402500 -- [-2175.182] (-2175.630) (-2181.609) (-2179.547) * (-2171.550) (-2171.273) [-2169.940] (-2178.281) -- 0:03:11
      403000 -- (-2176.572) (-2187.518) (-2185.909) [-2172.053] * [-2172.303] (-2173.269) (-2176.635) (-2170.931) -- 0:03:11
      403500 -- [-2182.185] (-2183.614) (-2167.178) (-2186.183) * (-2173.962) [-2174.402] (-2182.157) (-2177.940) -- 0:03:10
      404000 -- (-2179.915) (-2191.684) [-2170.765] (-2178.073) * (-2179.473) (-2181.425) [-2173.170] (-2180.297) -- 0:03:10
      404500 -- (-2173.569) (-2179.969) (-2176.390) [-2172.723] * (-2176.086) (-2173.446) [-2172.316] (-2169.177) -- 0:03:11
      405000 -- (-2171.839) [-2186.952] (-2178.048) (-2169.001) * (-2172.603) (-2173.395) (-2169.732) [-2173.490] -- 0:03:10

      Average standard deviation of split frequencies: 0.002322

      405500 -- (-2173.744) (-2181.109) [-2166.771] (-2174.362) * (-2171.949) (-2179.205) (-2175.091) [-2170.691] -- 0:03:10
      406000 -- [-2170.938] (-2180.957) (-2174.611) (-2176.817) * (-2175.368) (-2170.283) (-2173.350) [-2172.409] -- 0:03:10
      406500 -- [-2175.070] (-2176.138) (-2171.293) (-2179.701) * [-2168.921] (-2181.317) (-2166.969) (-2176.777) -- 0:03:09
      407000 -- (-2177.542) (-2175.143) (-2179.190) [-2178.836] * (-2169.144) (-2181.593) [-2173.849] (-2171.946) -- 0:03:09
      407500 -- (-2179.679) (-2170.041) (-2172.855) [-2180.571] * (-2178.269) (-2177.843) [-2174.551] (-2181.496) -- 0:03:10
      408000 -- (-2176.565) [-2171.314] (-2175.931) (-2183.441) * [-2173.413] (-2186.186) (-2180.707) (-2177.556) -- 0:03:10
      408500 -- [-2171.304] (-2174.385) (-2173.215) (-2176.288) * (-2176.993) (-2175.722) (-2172.459) [-2173.413] -- 0:03:09
      409000 -- (-2178.591) [-2172.760] (-2174.466) (-2175.779) * (-2184.281) (-2178.427) (-2175.480) [-2168.976] -- 0:03:09
      409500 -- (-2175.170) (-2174.956) (-2185.890) [-2175.234] * (-2179.154) [-2172.893] (-2172.556) (-2176.843) -- 0:03:08
      410000 -- (-2172.921) (-2175.899) [-2177.114] (-2179.385) * (-2178.820) [-2174.630] (-2171.771) (-2185.714) -- 0:03:08

      Average standard deviation of split frequencies: 0.002583

      410500 -- [-2168.278] (-2177.596) (-2187.127) (-2174.137) * (-2168.764) (-2170.470) [-2173.317] (-2172.255) -- 0:03:08
      411000 -- (-2172.012) (-2176.431) [-2170.264] (-2175.842) * (-2173.072) (-2176.506) (-2179.420) [-2170.343] -- 0:03:09
      411500 -- [-2173.539] (-2182.071) (-2168.822) (-2173.885) * (-2178.580) (-2172.155) (-2172.374) [-2168.736] -- 0:03:08
      412000 -- (-2172.538) (-2174.974) (-2173.491) [-2179.342] * (-2178.658) (-2180.247) (-2183.866) [-2172.686] -- 0:03:08
      412500 -- (-2175.527) (-2176.621) (-2170.103) [-2173.688] * (-2175.547) (-2182.151) (-2179.229) [-2170.983] -- 0:03:08
      413000 -- (-2168.165) (-2179.158) [-2167.802] (-2174.827) * (-2170.543) (-2174.743) (-2178.515) [-2169.034] -- 0:03:07
      413500 -- (-2171.944) [-2171.515] (-2174.081) (-2172.443) * (-2178.849) (-2173.813) (-2177.227) [-2167.469] -- 0:03:07
      414000 -- (-2175.934) (-2181.066) [-2174.738] (-2177.372) * [-2170.391] (-2179.099) (-2175.067) (-2172.019) -- 0:03:08
      414500 -- (-2169.558) (-2185.191) (-2174.113) [-2176.724] * [-2170.750] (-2179.426) (-2175.853) (-2173.602) -- 0:03:07
      415000 -- (-2173.643) (-2176.774) [-2169.037] (-2173.660) * (-2170.818) (-2178.278) [-2178.352] (-2172.750) -- 0:03:07

      Average standard deviation of split frequencies: 0.002266

      415500 -- (-2173.164) [-2176.412] (-2181.055) (-2171.425) * [-2182.621] (-2182.175) (-2172.181) (-2172.671) -- 0:03:07
      416000 -- (-2171.149) [-2172.381] (-2174.024) (-2169.406) * [-2176.078] (-2192.066) (-2176.420) (-2170.919) -- 0:03:06
      416500 -- [-2171.115] (-2181.829) (-2176.081) (-2175.605) * (-2180.059) [-2176.092] (-2176.708) (-2169.904) -- 0:03:06
      417000 -- (-2171.273) [-2170.530] (-2172.519) (-2175.569) * (-2176.861) [-2171.995] (-2172.483) (-2174.362) -- 0:03:07
      417500 -- (-2174.290) [-2172.975] (-2175.892) (-2173.648) * (-2178.109) [-2176.447] (-2182.435) (-2174.067) -- 0:03:06
      418000 -- (-2171.254) (-2174.388) [-2179.021] (-2170.442) * (-2181.333) [-2172.356] (-2170.469) (-2177.380) -- 0:03:06
      418500 -- (-2171.838) (-2179.161) (-2179.853) [-2175.730] * (-2173.940) (-2173.912) [-2175.334] (-2176.269) -- 0:03:06
      419000 -- (-2176.145) [-2176.304] (-2175.919) (-2170.083) * [-2176.432] (-2184.815) (-2179.170) (-2173.829) -- 0:03:05
      419500 -- [-2171.155] (-2180.131) (-2172.749) (-2172.841) * (-2173.416) [-2177.694] (-2176.030) (-2176.291) -- 0:03:05
      420000 -- (-2171.977) (-2178.445) (-2179.137) [-2174.777] * [-2176.806] (-2177.534) (-2171.866) (-2169.760) -- 0:03:06

      Average standard deviation of split frequencies: 0.002241

      420500 -- (-2173.508) (-2175.884) (-2187.600) [-2174.131] * (-2171.015) [-2175.468] (-2174.084) (-2171.380) -- 0:03:06
      421000 -- (-2178.724) [-2173.795] (-2184.573) (-2178.537) * [-2168.799] (-2172.669) (-2173.141) (-2175.601) -- 0:03:05
      421500 -- (-2172.616) [-2172.899] (-2178.101) (-2173.712) * (-2171.918) (-2174.326) (-2179.817) [-2171.502] -- 0:03:05
      422000 -- (-2177.678) (-2179.391) (-2175.447) [-2174.438] * (-2178.431) (-2180.000) [-2171.728] (-2176.341) -- 0:03:04
      422500 -- [-2177.593] (-2176.222) (-2176.471) (-2174.040) * [-2174.411] (-2174.416) (-2174.507) (-2179.237) -- 0:03:04
      423000 -- (-2170.610) (-2174.818) [-2175.702] (-2174.851) * (-2175.996) (-2176.256) (-2172.758) [-2175.210] -- 0:03:04
      423500 -- (-2172.381) (-2179.218) (-2175.865) [-2173.855] * (-2174.131) [-2173.028] (-2180.372) (-2177.564) -- 0:03:05
      424000 -- [-2175.164] (-2178.820) (-2177.665) (-2170.747) * (-2171.948) [-2171.919] (-2185.824) (-2172.254) -- 0:03:04
      424500 -- (-2175.041) (-2175.845) [-2169.822] (-2176.665) * (-2175.944) (-2179.719) (-2181.940) [-2171.869] -- 0:03:04
      425000 -- (-2168.514) (-2177.797) [-2176.242] (-2174.242) * (-2177.662) (-2172.814) (-2177.760) [-2172.254] -- 0:03:04

      Average standard deviation of split frequencies: 0.001937

      425500 -- (-2172.902) [-2175.383] (-2175.771) (-2178.526) * (-2187.683) [-2170.412] (-2172.689) (-2169.896) -- 0:03:03
      426000 -- (-2174.182) (-2184.364) [-2174.242] (-2173.860) * (-2178.154) (-2169.257) (-2179.565) [-2174.525] -- 0:03:03
      426500 -- (-2178.372) (-2186.033) [-2173.039] (-2167.791) * (-2177.880) (-2176.539) (-2180.763) [-2171.938] -- 0:03:04
      427000 -- [-2171.020] (-2181.082) (-2173.199) (-2177.114) * (-2175.957) [-2176.638] (-2180.233) (-2178.454) -- 0:03:03
      427500 -- [-2169.484] (-2175.703) (-2173.547) (-2177.636) * (-2177.182) [-2175.384] (-2179.912) (-2184.009) -- 0:03:03
      428000 -- (-2179.980) (-2178.361) [-2177.092] (-2176.824) * (-2177.550) (-2169.184) [-2177.732] (-2189.667) -- 0:03:03
      428500 -- (-2177.729) [-2174.751] (-2171.825) (-2176.607) * [-2168.533] (-2172.646) (-2191.170) (-2181.508) -- 0:03:02
      429000 -- (-2172.114) [-2173.333] (-2174.625) (-2177.280) * [-2175.753] (-2176.860) (-2191.264) (-2174.319) -- 0:03:02
      429500 -- [-2173.445] (-2172.315) (-2175.737) (-2177.025) * (-2170.497) (-2173.114) (-2172.928) [-2176.516] -- 0:03:03
      430000 -- (-2170.378) (-2182.852) (-2188.649) [-2172.650] * (-2171.410) (-2172.202) (-2176.777) [-2180.889] -- 0:03:02

      Average standard deviation of split frequencies: 0.001642

      430500 -- [-2170.989] (-2181.743) (-2187.964) (-2178.572) * (-2174.250) (-2181.599) (-2176.297) [-2176.933] -- 0:03:02
      431000 -- (-2175.064) (-2176.654) [-2169.117] (-2177.156) * (-2171.324) (-2175.813) (-2169.187) [-2173.556] -- 0:03:02
      431500 -- (-2172.478) [-2177.095] (-2177.589) (-2188.415) * (-2176.137) (-2173.258) (-2172.972) [-2171.588] -- 0:03:01
      432000 -- [-2169.127] (-2175.303) (-2173.949) (-2182.546) * (-2179.641) [-2173.174] (-2170.762) (-2183.891) -- 0:03:01
      432500 -- (-2171.491) (-2175.252) [-2178.684] (-2186.095) * [-2170.757] (-2178.390) (-2170.838) (-2179.967) -- 0:03:01
      433000 -- [-2170.438] (-2174.369) (-2188.512) (-2175.199) * (-2174.142) (-2174.393) (-2179.888) [-2175.006] -- 0:03:02
      433500 -- (-2170.240) (-2186.267) [-2172.295] (-2177.553) * (-2179.448) [-2170.367] (-2187.672) (-2177.927) -- 0:03:01
      434000 -- [-2171.245] (-2168.388) (-2173.721) (-2180.130) * [-2173.614] (-2176.688) (-2178.802) (-2169.492) -- 0:03:01
      434500 -- (-2170.574) (-2175.435) (-2169.427) [-2176.213] * (-2177.275) (-2175.224) [-2176.360] (-2175.212) -- 0:03:00
      435000 -- (-2165.189) (-2171.339) [-2176.187] (-2182.115) * (-2174.655) (-2176.359) [-2177.728] (-2173.594) -- 0:03:00

      Average standard deviation of split frequencies: 0.001352

      435500 -- (-2182.829) (-2174.325) (-2174.241) [-2168.973] * (-2177.346) [-2174.116] (-2173.004) (-2177.736) -- 0:03:00
      436000 -- (-2174.512) (-2178.537) (-2179.784) [-2177.012] * [-2172.483] (-2174.380) (-2175.846) (-2179.390) -- 0:03:01
      436500 -- (-2175.991) [-2177.728] (-2181.366) (-2185.032) * [-2176.372] (-2169.869) (-2172.360) (-2177.537) -- 0:03:00
      437000 -- (-2174.827) [-2173.480] (-2175.106) (-2181.917) * (-2177.447) [-2172.574] (-2186.304) (-2176.491) -- 0:03:00
      437500 -- [-2173.946] (-2183.076) (-2176.084) (-2178.400) * (-2183.580) (-2181.162) [-2175.816] (-2179.401) -- 0:03:00
      438000 -- [-2172.117] (-2176.048) (-2180.740) (-2172.503) * (-2176.346) (-2178.451) [-2170.164] (-2178.457) -- 0:02:59
      438500 -- (-2176.504) (-2182.021) [-2171.335] (-2171.321) * (-2180.401) (-2180.825) (-2185.800) [-2173.064] -- 0:02:59
      439000 -- [-2171.974] (-2172.840) (-2179.764) (-2176.007) * (-2175.501) [-2169.417] (-2172.056) (-2175.677) -- 0:03:00
      439500 -- (-2173.579) [-2171.599] (-2182.020) (-2174.489) * (-2169.659) [-2175.450] (-2173.481) (-2185.963) -- 0:02:59
      440000 -- (-2172.147) [-2167.577] (-2179.150) (-2178.996) * (-2172.673) (-2174.013) (-2171.507) [-2171.778] -- 0:02:59

      Average standard deviation of split frequencies: 0.001605

      440500 -- (-2173.844) [-2171.550] (-2180.978) (-2175.141) * (-2174.378) (-2175.646) [-2169.696] (-2171.766) -- 0:02:59
      441000 -- [-2172.709] (-2170.425) (-2173.652) (-2172.975) * (-2171.492) (-2184.592) (-2172.251) [-2169.997] -- 0:02:58
      441500 -- (-2176.468) (-2176.722) (-2176.830) [-2176.823] * (-2169.163) (-2175.862) [-2170.007] (-2175.388) -- 0:02:58
      442000 -- [-2173.149] (-2181.672) (-2167.657) (-2188.394) * (-2176.089) (-2172.150) [-2170.243] (-2174.149) -- 0:02:58
      442500 -- (-2174.674) (-2179.171) [-2171.811] (-2177.494) * (-2173.250) (-2181.981) [-2174.533] (-2175.466) -- 0:02:58
      443000 -- (-2173.159) [-2168.882] (-2173.048) (-2171.187) * (-2172.854) (-2171.204) [-2173.549] (-2182.317) -- 0:02:58
      443500 -- (-2178.472) [-2174.663] (-2183.151) (-2168.893) * [-2173.369] (-2172.475) (-2176.208) (-2174.953) -- 0:02:58
      444000 -- [-2170.379] (-2174.977) (-2174.534) (-2173.209) * (-2172.651) (-2175.790) (-2183.863) [-2175.225] -- 0:02:57
      444500 -- (-2176.629) (-2178.285) (-2177.415) [-2172.644] * (-2179.798) (-2175.559) (-2184.269) [-2170.527] -- 0:02:57
      445000 -- [-2178.300] (-2172.378) (-2177.836) (-2168.162) * [-2176.928] (-2177.498) (-2173.058) (-2178.757) -- 0:02:57

      Average standard deviation of split frequencies: 0.002642

      445500 -- (-2174.009) (-2174.205) (-2184.372) [-2171.973] * (-2178.182) [-2181.390] (-2171.863) (-2180.858) -- 0:02:57
      446000 -- [-2175.048] (-2176.440) (-2169.806) (-2176.698) * (-2168.104) (-2173.070) [-2174.148] (-2178.405) -- 0:02:57
      446500 -- (-2172.369) (-2174.159) (-2172.776) [-2168.689] * (-2173.677) (-2174.849) [-2172.825] (-2175.139) -- 0:02:57
      447000 -- (-2173.679) [-2171.564] (-2179.052) (-2181.265) * (-2179.754) (-2176.072) [-2172.006] (-2175.916) -- 0:02:56
      447500 -- (-2172.816) [-2176.134] (-2174.088) (-2175.475) * (-2172.242) (-2175.213) (-2178.560) [-2170.709] -- 0:02:56
      448000 -- (-2176.595) [-2178.064] (-2173.771) (-2179.686) * [-2172.079] (-2178.651) (-2184.343) (-2172.793) -- 0:02:56
      448500 -- (-2171.800) (-2176.297) (-2173.313) [-2168.088] * (-2176.320) [-2175.134] (-2179.079) (-2179.843) -- 0:02:57
      449000 -- (-2174.691) (-2182.351) (-2171.710) [-2173.043] * (-2176.177) (-2174.218) (-2179.004) [-2173.432] -- 0:02:56
      449500 -- (-2181.926) (-2176.760) (-2176.116) [-2178.427] * [-2178.702] (-2176.726) (-2174.910) (-2173.388) -- 0:02:56
      450000 -- (-2171.746) (-2184.105) [-2171.089] (-2179.385) * (-2175.798) [-2174.709] (-2179.591) (-2175.514) -- 0:02:56

      Average standard deviation of split frequencies: 0.001569

      450500 -- [-2172.734] (-2179.636) (-2171.252) (-2172.011) * (-2175.672) [-2178.675] (-2172.407) (-2174.280) -- 0:02:55
      451000 -- (-2173.354) (-2178.570) [-2175.166] (-2179.406) * [-2172.155] (-2181.648) (-2167.374) (-2176.812) -- 0:02:55
      451500 -- (-2173.196) (-2172.998) (-2176.090) [-2172.321] * (-2169.119) (-2180.275) (-2171.621) [-2174.026] -- 0:02:54
      452000 -- [-2171.647] (-2175.796) (-2179.907) (-2177.961) * (-2177.827) (-2176.271) (-2174.883) [-2177.588] -- 0:02:55
      452500 -- (-2175.242) (-2177.659) [-2178.814] (-2172.437) * (-2172.061) (-2172.474) [-2170.176] (-2172.441) -- 0:02:55
      453000 -- (-2174.745) (-2174.937) (-2176.306) [-2173.522] * (-2186.579) (-2177.104) [-2172.020] (-2171.155) -- 0:02:55
      453500 -- (-2177.995) [-2176.625] (-2177.040) (-2178.631) * (-2179.584) [-2177.353] (-2172.866) (-2184.192) -- 0:02:54
      454000 -- (-2173.133) [-2182.006] (-2175.964) (-2174.187) * (-2176.014) (-2181.755) (-2174.403) [-2172.159] -- 0:02:54
      454500 -- (-2180.213) [-2176.084] (-2170.379) (-2174.733) * (-2172.548) (-2179.975) (-2177.766) [-2172.468] -- 0:02:54
      455000 -- (-2178.524) (-2171.268) (-2172.023) [-2172.566] * [-2178.676] (-2176.835) (-2176.280) (-2179.519) -- 0:02:54

      Average standard deviation of split frequencies: 0.000775

      455500 -- (-2178.169) (-2168.899) (-2175.361) [-2175.853] * [-2175.158] (-2178.292) (-2175.430) (-2177.642) -- 0:02:54
      456000 -- (-2174.332) [-2173.697] (-2173.811) (-2182.895) * [-2173.245] (-2176.438) (-2178.718) (-2177.294) -- 0:02:54
      456500 -- [-2174.838] (-2173.229) (-2181.561) (-2177.797) * (-2179.419) [-2166.986] (-2181.666) (-2174.399) -- 0:02:53
      457000 -- (-2173.913) (-2166.155) [-2174.851] (-2187.965) * (-2172.432) [-2172.319] (-2181.264) (-2179.818) -- 0:02:53
      457500 -- (-2170.887) (-2178.552) [-2169.740] (-2181.114) * (-2174.195) (-2175.158) [-2172.870] (-2181.584) -- 0:02:53
      458000 -- (-2178.593) (-2174.307) [-2170.947] (-2176.324) * (-2175.827) (-2169.217) [-2171.459] (-2181.548) -- 0:02:53
      458500 -- [-2181.376] (-2171.094) (-2174.876) (-2178.176) * (-2177.303) [-2180.426] (-2173.147) (-2174.743) -- 0:02:53
      459000 -- [-2179.053] (-2173.449) (-2177.106) (-2183.493) * [-2175.299] (-2181.904) (-2172.611) (-2174.438) -- 0:02:53
      459500 -- (-2171.597) [-2170.239] (-2170.368) (-2179.132) * (-2182.969) (-2175.893) [-2171.906] (-2173.753) -- 0:02:52
      460000 -- (-2178.149) [-2175.783] (-2173.123) (-2174.258) * (-2176.935) [-2174.902] (-2172.477) (-2177.265) -- 0:02:52

      Average standard deviation of split frequencies: 0.000512

      460500 -- (-2179.449) (-2176.235) (-2173.789) [-2178.932] * (-2182.725) (-2174.110) [-2173.869] (-2175.557) -- 0:02:52
      461000 -- (-2184.147) (-2171.562) (-2181.953) [-2169.614] * (-2177.125) [-2173.399] (-2171.972) (-2172.853) -- 0:02:51
      461500 -- [-2173.391] (-2172.857) (-2183.360) (-2176.179) * (-2172.495) (-2178.479) [-2170.466] (-2172.441) -- 0:02:52
      462000 -- [-2176.898] (-2177.220) (-2178.996) (-2173.135) * (-2177.442) [-2175.338] (-2176.370) (-2178.132) -- 0:02:52
      462500 -- (-2178.504) (-2176.725) (-2176.232) [-2174.229] * (-2178.764) (-2174.754) [-2171.608] (-2175.173) -- 0:02:52
      463000 -- [-2172.849] (-2175.698) (-2172.175) (-2168.058) * (-2174.518) (-2174.267) (-2183.677) [-2175.695] -- 0:02:51
      463500 -- [-2171.497] (-2175.540) (-2172.436) (-2174.647) * [-2168.892] (-2177.815) (-2174.945) (-2175.534) -- 0:02:51
      464000 -- [-2173.275] (-2179.986) (-2172.516) (-2169.876) * [-2184.606] (-2175.666) (-2174.220) (-2179.826) -- 0:02:50
      464500 -- (-2178.581) (-2176.489) [-2181.456] (-2186.430) * [-2174.900] (-2171.373) (-2171.561) (-2170.660) -- 0:02:51
      465000 -- [-2175.604] (-2172.592) (-2176.610) (-2188.514) * (-2174.913) (-2174.868) [-2173.858] (-2187.443) -- 0:02:51

      Average standard deviation of split frequencies: 0.000253

      465500 -- (-2173.291) (-2180.491) (-2172.240) [-2175.500] * [-2180.397] (-2180.028) (-2178.138) (-2173.024) -- 0:02:51
      466000 -- (-2172.214) (-2174.327) [-2178.380] (-2174.882) * [-2174.523] (-2179.052) (-2185.330) (-2172.252) -- 0:02:50
      466500 -- [-2170.632] (-2176.187) (-2172.803) (-2179.891) * (-2175.768) (-2177.867) (-2185.057) [-2170.447] -- 0:02:50
      467000 -- (-2177.012) (-2180.689) [-2172.481] (-2178.546) * (-2176.337) (-2174.636) [-2175.901] (-2168.536) -- 0:02:50
      467500 -- (-2172.769) (-2170.673) [-2173.842] (-2175.278) * [-2172.922] (-2174.892) (-2177.362) (-2174.691) -- 0:02:50
      468000 -- [-2172.069] (-2174.033) (-2169.531) (-2178.587) * (-2179.434) (-2174.657) (-2175.575) [-2182.173] -- 0:02:50
      468500 -- (-2176.813) [-2171.114] (-2173.098) (-2182.022) * (-2176.778) [-2173.596] (-2178.289) (-2176.689) -- 0:02:50
      469000 -- [-2174.364] (-2172.146) (-2172.416) (-2180.269) * (-2174.383) [-2172.688] (-2170.420) (-2170.935) -- 0:02:49
      469500 -- [-2178.571] (-2174.980) (-2176.459) (-2176.853) * (-2174.577) [-2175.953] (-2176.786) (-2174.271) -- 0:02:49
      470000 -- (-2177.738) [-2169.449] (-2177.382) (-2182.568) * (-2176.167) (-2171.598) (-2177.125) [-2171.090] -- 0:02:49

      Average standard deviation of split frequencies: 0.000751

      470500 -- (-2177.164) [-2172.220] (-2171.247) (-2178.795) * (-2172.935) (-2176.142) [-2172.832] (-2182.645) -- 0:02:48
      471000 -- [-2170.800] (-2168.418) (-2176.936) (-2174.823) * (-2174.154) (-2177.893) [-2177.749] (-2175.658) -- 0:02:49
      471500 -- [-2178.802] (-2171.847) (-2177.331) (-2175.595) * [-2169.403] (-2179.504) (-2187.519) (-2183.841) -- 0:02:49
      472000 -- (-2174.065) [-2174.430] (-2179.912) (-2176.180) * [-2169.871] (-2169.098) (-2183.157) (-2172.304) -- 0:02:48
      472500 -- (-2180.495) [-2173.077] (-2178.762) (-2174.616) * (-2175.663) (-2172.791) (-2178.255) [-2173.171] -- 0:02:48
      473000 -- [-2176.450] (-2171.625) (-2175.666) (-2174.402) * (-2183.633) (-2173.963) [-2173.289] (-2169.163) -- 0:02:48
      473500 -- (-2180.448) (-2176.161) [-2172.274] (-2174.782) * (-2173.326) (-2176.933) (-2172.084) [-2173.509] -- 0:02:47
      474000 -- [-2177.606] (-2170.640) (-2177.340) (-2179.479) * (-2181.018) [-2176.811] (-2177.888) (-2169.516) -- 0:02:48
      474500 -- (-2177.514) (-2167.784) [-2171.494] (-2173.781) * [-2173.369] (-2177.765) (-2176.527) (-2173.974) -- 0:02:48
      475000 -- [-2174.060] (-2178.447) (-2172.400) (-2175.137) * (-2172.753) (-2176.661) (-2179.644) [-2170.195] -- 0:02:48

      Average standard deviation of split frequencies: 0.000248

      475500 -- (-2176.553) (-2174.335) (-2171.419) [-2168.998] * (-2180.681) (-2184.814) [-2177.807] (-2178.382) -- 0:02:47
      476000 -- (-2178.087) (-2166.827) [-2172.738] (-2181.624) * (-2175.061) (-2180.962) [-2170.920] (-2175.202) -- 0:02:47
      476500 -- (-2179.192) [-2172.487] (-2172.741) (-2171.200) * (-2175.397) (-2175.427) (-2176.581) [-2171.476] -- 0:02:46
      477000 -- (-2179.600) [-2175.493] (-2171.817) (-2171.208) * [-2173.309] (-2182.071) (-2170.078) (-2177.900) -- 0:02:47
      477500 -- [-2169.460] (-2176.129) (-2171.120) (-2172.866) * [-2177.255] (-2184.234) (-2172.900) (-2174.937) -- 0:02:47
      478000 -- (-2176.295) (-2179.307) (-2174.552) [-2171.599] * (-2171.686) (-2174.194) (-2176.242) [-2173.140] -- 0:02:47
      478500 -- (-2174.424) [-2172.913] (-2178.068) (-2173.482) * (-2173.580) [-2172.396] (-2185.229) (-2173.335) -- 0:02:46
      479000 -- (-2175.112) (-2179.726) [-2186.425] (-2176.856) * (-2170.894) (-2174.638) (-2180.149) [-2173.404] -- 0:02:46
      479500 -- [-2172.487] (-2180.132) (-2175.005) (-2172.225) * (-2174.128) (-2172.058) [-2171.950] (-2177.761) -- 0:02:46
      480000 -- (-2175.453) (-2182.821) (-2171.702) [-2178.722] * (-2178.779) [-2173.022] (-2175.929) (-2177.211) -- 0:02:45

      Average standard deviation of split frequencies: 0.000490

      480500 -- [-2172.262] (-2170.288) (-2182.293) (-2167.799) * (-2180.551) (-2176.973) (-2176.376) [-2170.111] -- 0:02:46
      481000 -- (-2175.041) (-2178.584) (-2175.406) [-2170.862] * (-2177.201) [-2174.829] (-2171.808) (-2168.561) -- 0:02:46
      481500 -- (-2176.898) (-2173.180) (-2179.132) [-2169.728] * (-2172.120) (-2180.057) [-2178.175] (-2170.250) -- 0:02:45
      482000 -- (-2170.778) (-2176.561) (-2178.223) [-2169.876] * (-2174.097) (-2180.592) (-2171.263) [-2176.200] -- 0:02:45
      482500 -- [-2175.514] (-2170.702) (-2174.118) (-2174.293) * [-2175.717] (-2181.687) (-2173.076) (-2179.686) -- 0:02:45
      483000 -- (-2174.176) (-2172.979) (-2171.379) [-2171.634] * [-2177.817] (-2174.829) (-2172.184) (-2179.906) -- 0:02:44
      483500 -- (-2181.087) (-2169.841) [-2171.928] (-2174.211) * [-2171.028] (-2174.684) (-2177.078) (-2175.853) -- 0:02:45
      484000 -- (-2175.112) (-2174.304) [-2175.601] (-2171.792) * [-2178.514] (-2172.403) (-2173.859) (-2171.605) -- 0:02:45
      484500 -- [-2180.787] (-2170.590) (-2178.889) (-2174.992) * [-2172.502] (-2170.678) (-2174.777) (-2171.300) -- 0:02:44
      485000 -- [-2173.536] (-2174.953) (-2174.137) (-2188.499) * [-2172.751] (-2174.998) (-2175.050) (-2175.139) -- 0:02:44

      Average standard deviation of split frequencies: 0.000242

      485500 -- [-2173.732] (-2171.007) (-2171.206) (-2174.524) * (-2173.421) (-2173.027) [-2173.352] (-2174.891) -- 0:02:44
      486000 -- (-2175.407) [-2175.265] (-2177.319) (-2188.194) * (-2171.631) (-2175.621) (-2175.489) [-2175.282] -- 0:02:43
      486500 -- (-2184.228) (-2184.565) [-2176.659] (-2187.420) * (-2171.543) [-2178.820] (-2177.421) (-2172.361) -- 0:02:44
      487000 -- (-2173.458) (-2179.620) [-2179.979] (-2169.236) * (-2179.507) [-2169.564] (-2180.002) (-2180.536) -- 0:02:44
      487500 -- (-2172.357) [-2176.487] (-2171.874) (-2173.695) * [-2175.230] (-2171.883) (-2175.073) (-2174.621) -- 0:02:44
      488000 -- [-2172.836] (-2168.681) (-2171.362) (-2172.207) * [-2172.787] (-2170.600) (-2171.732) (-2180.643) -- 0:02:43
      488500 -- (-2170.505) (-2175.343) (-2177.316) [-2175.517] * [-2179.374] (-2182.073) (-2180.280) (-2174.157) -- 0:02:43
      489000 -- (-2180.040) (-2182.371) [-2170.292] (-2177.776) * (-2170.936) (-2174.882) (-2171.652) [-2175.545] -- 0:02:43
      489500 -- (-2172.465) (-2173.737) [-2173.442] (-2172.183) * (-2172.381) [-2169.046] (-2173.636) (-2176.817) -- 0:02:43
      490000 -- [-2174.995] (-2177.442) (-2172.836) (-2179.644) * (-2179.029) (-2182.784) [-2172.176] (-2169.542) -- 0:02:43

      Average standard deviation of split frequencies: 0.000961

      490500 -- (-2185.369) (-2179.052) (-2176.122) [-2173.693] * (-2173.081) (-2177.044) (-2169.249) [-2170.248] -- 0:02:43
      491000 -- [-2174.835] (-2184.072) (-2170.458) (-2171.571) * (-2173.828) [-2178.209] (-2176.145) (-2172.872) -- 0:02:42
      491500 -- (-2181.093) [-2172.377] (-2174.172) (-2176.718) * (-2169.945) (-2175.315) [-2171.217] (-2172.373) -- 0:02:42
      492000 -- [-2175.023] (-2169.516) (-2181.888) (-2173.473) * (-2169.769) (-2180.623) [-2170.132] (-2170.255) -- 0:02:42
      492500 -- (-2180.454) (-2173.461) [-2172.449] (-2178.774) * (-2177.839) [-2170.901] (-2175.119) (-2169.844) -- 0:02:41
      493000 -- (-2176.634) (-2176.617) [-2181.445] (-2177.667) * (-2179.490) [-2172.274] (-2173.040) (-2178.298) -- 0:02:42
      493500 -- (-2169.070) (-2179.267) [-2174.142] (-2171.413) * [-2173.954] (-2169.139) (-2177.369) (-2177.042) -- 0:02:42
      494000 -- (-2174.081) (-2174.998) [-2176.609] (-2173.898) * (-2177.407) (-2172.938) (-2181.633) [-2169.852] -- 0:02:41
      494500 -- (-2177.817) [-2178.369] (-2178.287) (-2172.444) * [-2178.886] (-2170.873) (-2180.056) (-2171.385) -- 0:02:41
      495000 -- (-2181.220) [-2172.214] (-2175.305) (-2169.682) * (-2179.237) [-2172.488] (-2175.661) (-2175.259) -- 0:02:41

      Average standard deviation of split frequencies: 0.001188

      495500 -- [-2177.937] (-2169.031) (-2180.193) (-2171.482) * (-2186.862) (-2176.098) (-2173.887) [-2173.263] -- 0:02:40
      496000 -- [-2174.430] (-2172.959) (-2180.367) (-2167.326) * [-2174.896] (-2171.406) (-2176.559) (-2173.495) -- 0:02:41
      496500 -- (-2172.183) (-2172.572) (-2181.553) [-2169.165] * (-2176.531) (-2172.350) [-2170.969] (-2173.640) -- 0:02:41
      497000 -- [-2186.123] (-2177.280) (-2173.925) (-2172.839) * [-2175.328] (-2172.168) (-2168.635) (-2172.956) -- 0:02:40
      497500 -- (-2185.172) (-2177.401) (-2177.510) [-2182.062] * (-2177.663) (-2177.232) [-2175.532] (-2175.979) -- 0:02:40
      498000 -- (-2187.812) (-2182.375) (-2176.057) [-2177.126] * (-2179.586) (-2171.769) [-2169.156] (-2180.363) -- 0:02:40
      498500 -- (-2174.816) (-2179.715) (-2176.507) [-2171.003] * (-2171.356) (-2171.738) [-2169.654] (-2178.944) -- 0:02:39
      499000 -- [-2170.713] (-2172.758) (-2185.165) (-2175.655) * (-2180.187) (-2173.208) [-2170.834] (-2174.909) -- 0:02:40
      499500 -- (-2170.032) (-2177.199) (-2173.201) [-2170.582] * (-2179.637) (-2172.827) [-2171.158] (-2177.822) -- 0:02:40
      500000 -- (-2175.845) [-2170.318] (-2179.312) (-2178.695) * [-2175.896] (-2175.580) (-2175.959) (-2183.105) -- 0:02:40

      Average standard deviation of split frequencies: 0.001648

      500500 -- (-2170.774) (-2177.845) [-2178.983] (-2177.939) * (-2178.024) (-2172.210) (-2173.660) [-2176.041] -- 0:02:39
      501000 -- (-2175.305) (-2181.503) [-2170.028] (-2174.441) * [-2171.470] (-2170.730) (-2176.942) (-2172.296) -- 0:02:39
      501500 -- (-2174.024) (-2185.627) [-2170.224] (-2182.170) * (-2172.890) (-2180.312) (-2176.585) [-2171.623] -- 0:02:39
      502000 -- (-2170.996) (-2173.085) [-2169.101] (-2176.255) * (-2177.277) (-2175.279) (-2173.773) [-2171.835] -- 0:02:38
      502500 -- [-2172.350] (-2172.785) (-2171.620) (-2175.067) * (-2180.577) (-2172.258) (-2174.067) [-2177.058] -- 0:02:39
      503000 -- [-2172.107] (-2174.412) (-2173.050) (-2172.099) * (-2179.926) (-2177.154) [-2172.303] (-2171.558) -- 0:02:39
      503500 -- (-2177.610) (-2176.462) [-2177.181] (-2181.944) * (-2184.784) [-2173.870] (-2172.334) (-2175.403) -- 0:02:38
      504000 -- (-2178.481) (-2179.622) [-2169.905] (-2175.179) * (-2178.473) [-2174.673] (-2178.041) (-2177.920) -- 0:02:38
      504500 -- (-2175.381) (-2177.003) (-2173.588) [-2172.639] * [-2173.473] (-2169.350) (-2180.597) (-2176.918) -- 0:02:38
      505000 -- (-2184.021) (-2172.624) [-2170.625] (-2173.262) * (-2174.858) [-2173.379] (-2179.247) (-2171.998) -- 0:02:37

      Average standard deviation of split frequencies: 0.001630

      505500 -- (-2177.645) (-2181.372) (-2179.361) [-2173.642] * (-2170.761) (-2180.118) [-2175.957] (-2176.920) -- 0:02:38
      506000 -- [-2170.708] (-2177.366) (-2175.157) (-2175.321) * (-2180.441) (-2186.001) [-2170.992] (-2177.694) -- 0:02:38
      506500 -- [-2171.467] (-2177.226) (-2173.020) (-2182.904) * (-2172.740) [-2172.769] (-2183.482) (-2176.084) -- 0:02:37
      507000 -- (-2176.050) (-2173.204) [-2170.758] (-2181.669) * (-2173.909) (-2170.643) (-2176.591) [-2176.072] -- 0:02:37
      507500 -- (-2171.835) [-2170.599] (-2175.193) (-2171.989) * [-2177.494] (-2169.593) (-2172.959) (-2179.019) -- 0:02:37
      508000 -- (-2181.629) (-2175.768) [-2176.395] (-2174.184) * (-2179.004) (-2169.762) (-2182.953) [-2174.301] -- 0:02:36
      508500 -- (-2174.640) (-2173.544) [-2172.515] (-2172.909) * (-2168.749) [-2171.051] (-2180.718) (-2170.522) -- 0:02:37
      509000 -- (-2167.796) (-2176.373) (-2174.574) [-2172.510] * (-2185.523) [-2174.220] (-2174.053) (-2175.808) -- 0:02:37
      509500 -- (-2176.702) (-2175.732) [-2174.768] (-2174.792) * (-2178.429) (-2169.264) (-2173.505) [-2171.372] -- 0:02:36
      510000 -- [-2177.343] (-2179.659) (-2170.418) (-2180.863) * (-2178.789) [-2174.742] (-2173.806) (-2172.437) -- 0:02:36

      Average standard deviation of split frequencies: 0.002308

      510500 -- (-2171.460) (-2175.570) [-2172.218] (-2173.733) * [-2179.428] (-2180.827) (-2172.344) (-2172.177) -- 0:02:36
      511000 -- (-2187.759) (-2181.163) [-2171.340] (-2172.669) * (-2178.983) [-2179.244] (-2181.454) (-2168.647) -- 0:02:35
      511500 -- (-2178.740) (-2182.644) [-2176.849] (-2174.984) * (-2175.093) (-2181.926) (-2184.935) [-2168.745] -- 0:02:36
      512000 -- [-2179.787] (-2181.863) (-2171.873) (-2178.242) * (-2171.482) [-2179.488] (-2176.335) (-2175.739) -- 0:02:36
      512500 -- (-2169.693) [-2172.800] (-2167.480) (-2170.544) * (-2183.307) (-2175.736) [-2177.298] (-2174.256) -- 0:02:36
      513000 -- [-2175.314] (-2179.174) (-2174.478) (-2175.778) * (-2170.929) (-2180.475) (-2178.006) [-2171.107] -- 0:02:35
      513500 -- (-2177.462) (-2172.912) (-2174.490) [-2185.481] * [-2177.198] (-2178.939) (-2183.238) (-2172.755) -- 0:02:35
      514000 -- (-2176.724) (-2174.679) (-2174.565) [-2174.265] * (-2177.543) [-2169.291] (-2173.006) (-2170.210) -- 0:02:35
      514500 -- [-2168.411] (-2177.830) (-2171.042) (-2177.590) * [-2170.645] (-2182.471) (-2177.580) (-2175.575) -- 0:02:34
      515000 -- (-2169.111) (-2173.760) [-2181.722] (-2175.868) * [-2174.334] (-2175.231) (-2172.886) (-2170.937) -- 0:02:35

      Average standard deviation of split frequencies: 0.002056

      515500 -- (-2171.099) (-2175.064) (-2177.981) [-2173.724] * (-2175.080) (-2169.653) (-2173.556) [-2174.527] -- 0:02:35
      516000 -- (-2171.864) (-2171.848) (-2179.918) [-2180.068] * (-2182.248) (-2174.477) [-2180.601] (-2174.167) -- 0:02:34
      516500 -- [-2171.443] (-2171.125) (-2174.992) (-2175.211) * (-2174.408) (-2172.924) (-2179.497) [-2174.946] -- 0:02:34
      517000 -- (-2169.792) [-2171.559] (-2168.356) (-2173.142) * [-2169.694] (-2171.991) (-2179.484) (-2173.112) -- 0:02:34
      517500 -- [-2171.033] (-2172.994) (-2169.117) (-2181.705) * (-2176.964) (-2169.684) [-2178.121] (-2169.665) -- 0:02:33
      518000 -- (-2171.249) (-2169.625) [-2168.468] (-2172.809) * [-2174.867] (-2171.849) (-2179.308) (-2170.699) -- 0:02:34
      518500 -- (-2169.832) (-2175.174) [-2173.989] (-2174.841) * (-2179.968) (-2169.690) [-2176.438] (-2171.913) -- 0:02:34
      519000 -- (-2177.536) (-2175.804) [-2170.154] (-2180.785) * (-2172.247) [-2171.058] (-2173.601) (-2177.240) -- 0:02:33
      519500 -- [-2171.421] (-2170.739) (-2175.007) (-2175.722) * (-2173.058) [-2173.037] (-2180.909) (-2180.974) -- 0:02:33
      520000 -- (-2175.388) (-2170.154) (-2175.792) [-2173.327] * (-2166.494) [-2171.307] (-2173.751) (-2177.239) -- 0:02:33

      Average standard deviation of split frequencies: 0.002263

      520500 -- (-2178.719) (-2176.848) (-2183.010) [-2174.716] * (-2175.867) (-2182.167) [-2173.451] (-2176.363) -- 0:02:32
      521000 -- (-2175.495) [-2173.795] (-2175.380) (-2176.829) * (-2175.187) [-2177.255] (-2177.778) (-2177.609) -- 0:02:33
      521500 -- [-2176.903] (-2185.995) (-2183.348) (-2173.026) * (-2170.560) [-2179.275] (-2170.212) (-2171.958) -- 0:02:33
      522000 -- (-2181.428) (-2174.391) (-2172.704) [-2171.185] * (-2173.256) [-2170.206] (-2170.448) (-2176.112) -- 0:02:32
      522500 -- (-2174.421) [-2168.154] (-2181.964) (-2179.513) * (-2177.492) (-2175.365) (-2176.848) [-2175.604] -- 0:02:32
      523000 -- (-2177.119) (-2172.792) (-2173.216) [-2175.274] * [-2173.264] (-2168.469) (-2177.259) (-2177.315) -- 0:02:32
      523500 -- (-2171.953) (-2177.586) [-2170.752] (-2178.749) * (-2170.668) [-2170.532] (-2178.331) (-2178.976) -- 0:02:32
      524000 -- (-2174.907) (-2178.096) (-2177.772) [-2171.040] * (-2171.926) [-2173.252] (-2172.777) (-2181.492) -- 0:02:31
      524500 -- (-2170.650) [-2171.599] (-2171.745) (-2180.134) * (-2170.902) (-2173.675) (-2180.596) [-2172.329] -- 0:02:32
      525000 -- [-2172.868] (-2174.288) (-2177.446) (-2173.199) * [-2178.293] (-2171.491) (-2187.022) (-2170.108) -- 0:02:32

      Average standard deviation of split frequencies: 0.002689

      525500 -- (-2181.534) (-2176.423) (-2168.434) [-2171.846] * (-2177.927) (-2170.497) (-2189.320) [-2170.498] -- 0:02:31
      526000 -- [-2173.178] (-2181.107) (-2169.133) (-2169.783) * (-2181.754) (-2190.944) [-2171.474] (-2169.305) -- 0:02:31
      526500 -- (-2172.945) (-2179.577) [-2173.026] (-2175.783) * (-2182.366) [-2189.569] (-2175.719) (-2174.171) -- 0:02:31
      527000 -- [-2171.932] (-2179.541) (-2177.832) (-2173.946) * (-2177.520) (-2174.574) [-2182.022] (-2174.983) -- 0:02:30
      527500 -- (-2170.374) [-2176.072] (-2172.851) (-2179.871) * (-2170.976) (-2176.473) (-2173.599) [-2172.695] -- 0:02:31
      528000 -- (-2171.999) [-2172.568] (-2178.088) (-2174.213) * (-2180.443) (-2178.386) [-2175.441] (-2172.108) -- 0:02:31
      528500 -- (-2178.420) [-2178.271] (-2179.824) (-2171.432) * [-2174.145] (-2178.118) (-2179.523) (-2174.278) -- 0:02:30
      529000 -- (-2171.402) (-2178.438) (-2178.329) [-2176.066] * [-2171.310] (-2176.734) (-2177.330) (-2180.954) -- 0:02:30
      529500 -- (-2179.502) (-2177.676) (-2169.434) [-2172.496] * [-2172.528] (-2174.980) (-2176.895) (-2176.273) -- 0:02:30
      530000 -- (-2171.951) [-2171.485] (-2173.775) (-2173.958) * (-2177.091) [-2176.014] (-2173.327) (-2171.758) -- 0:02:29

      Average standard deviation of split frequencies: 0.002887

      530500 -- (-2170.938) [-2173.823] (-2172.130) (-2180.431) * [-2170.873] (-2177.605) (-2171.933) (-2176.529) -- 0:02:30
      531000 -- (-2175.512) [-2175.149] (-2173.163) (-2172.981) * [-2171.910] (-2170.724) (-2180.154) (-2172.667) -- 0:02:30
      531500 -- [-2171.703] (-2182.175) (-2177.191) (-2176.181) * [-2175.523] (-2187.739) (-2170.603) (-2175.563) -- 0:02:29
      532000 -- (-2173.134) (-2179.283) (-2179.098) [-2175.130] * (-2176.369) [-2180.214] (-2168.490) (-2174.507) -- 0:02:29
      532500 -- (-2170.260) [-2172.953] (-2173.056) (-2174.988) * (-2172.732) [-2168.514] (-2176.415) (-2171.488) -- 0:02:29
      533000 -- (-2173.525) (-2175.499) (-2174.728) [-2173.398] * (-2179.453) [-2176.187] (-2173.131) (-2177.128) -- 0:02:28
      533500 -- (-2174.914) (-2172.401) [-2172.495] (-2169.816) * (-2178.278) (-2176.200) [-2173.648] (-2172.401) -- 0:02:28
      534000 -- (-2178.811) [-2176.784] (-2175.911) (-2177.966) * (-2173.025) [-2171.295] (-2178.580) (-2174.730) -- 0:02:29
      534500 -- (-2174.845) (-2171.887) (-2174.866) [-2180.181] * [-2169.694] (-2172.243) (-2179.658) (-2174.813) -- 0:02:28
      535000 -- (-2174.782) (-2170.686) (-2171.145) [-2174.773] * [-2173.929] (-2177.580) (-2181.764) (-2168.250) -- 0:02:28

      Average standard deviation of split frequencies: 0.001979

      535500 -- [-2170.245] (-2171.814) (-2172.700) (-2177.616) * (-2177.295) [-2174.863] (-2181.593) (-2171.491) -- 0:02:28
      536000 -- [-2177.780] (-2176.952) (-2181.476) (-2177.388) * (-2170.593) [-2174.712] (-2175.886) (-2178.383) -- 0:02:28
      536500 -- (-2174.995) [-2168.806] (-2186.532) (-2174.986) * (-2172.532) (-2168.725) [-2170.686] (-2183.133) -- 0:02:27
      537000 -- (-2171.670) [-2173.172] (-2183.543) (-2177.689) * (-2176.385) (-2174.995) (-2168.865) [-2171.256] -- 0:02:28
      537500 -- (-2180.418) [-2180.543] (-2171.843) (-2180.417) * [-2172.868] (-2175.329) (-2177.397) (-2172.417) -- 0:02:28
      538000 -- [-2178.726] (-2180.077) (-2177.333) (-2174.557) * (-2172.141) [-2170.997] (-2171.410) (-2175.703) -- 0:02:27
      538500 -- (-2176.531) (-2187.532) [-2179.912] (-2174.924) * (-2179.413) [-2168.729] (-2173.833) (-2182.805) -- 0:02:27
      539000 -- [-2174.278] (-2171.426) (-2181.201) (-2173.613) * (-2176.144) (-2173.129) (-2180.915) [-2176.330] -- 0:02:27
      539500 -- (-2171.976) (-2172.308) (-2172.956) [-2176.432] * (-2175.897) (-2170.315) [-2176.626] (-2179.977) -- 0:02:26
      540000 -- (-2179.338) (-2175.464) (-2171.184) [-2173.408] * (-2170.276) (-2181.996) [-2173.432] (-2173.957) -- 0:02:27

      Average standard deviation of split frequencies: 0.001744

      540500 -- (-2178.146) (-2173.908) (-2175.280) [-2172.679] * (-2171.973) (-2180.893) [-2171.001] (-2175.347) -- 0:02:27
      541000 -- (-2179.815) [-2169.359] (-2184.486) (-2175.206) * [-2172.093] (-2181.721) (-2174.441) (-2174.453) -- 0:02:26
      541500 -- (-2173.779) (-2175.797) [-2173.603] (-2175.067) * (-2174.554) (-2184.716) [-2170.502] (-2178.250) -- 0:02:26
      542000 -- (-2179.603) (-2183.651) (-2174.323) [-2175.988] * [-2173.424] (-2181.760) (-2168.492) (-2178.982) -- 0:02:26
      542500 -- [-2176.616] (-2171.590) (-2172.387) (-2179.922) * (-2172.528) (-2178.479) [-2171.456] (-2180.243) -- 0:02:25
      543000 -- (-2177.377) (-2175.362) (-2171.210) [-2170.248] * (-2171.883) (-2172.592) [-2171.231] (-2174.756) -- 0:02:25
      543500 -- (-2182.855) (-2172.220) (-2169.710) [-2173.805] * (-2180.970) (-2171.760) (-2179.908) [-2175.041] -- 0:02:26
      544000 -- [-2181.378] (-2176.967) (-2174.149) (-2172.489) * (-2172.359) [-2172.050] (-2178.655) (-2171.668) -- 0:02:25
      544500 -- (-2186.165) (-2170.104) [-2175.301] (-2171.497) * (-2179.057) (-2173.931) (-2178.664) [-2174.195] -- 0:02:25
      545000 -- (-2175.453) (-2169.667) [-2171.880] (-2175.134) * (-2175.007) [-2174.520] (-2171.834) (-2179.279) -- 0:02:25

      Average standard deviation of split frequencies: 0.001943

      545500 -- (-2175.375) (-2177.796) (-2171.930) [-2172.081] * (-2175.227) [-2167.649] (-2173.933) (-2178.759) -- 0:02:24
      546000 -- [-2173.658] (-2169.819) (-2178.629) (-2177.129) * [-2179.338] (-2174.282) (-2171.474) (-2169.998) -- 0:02:24
      546500 -- (-2174.897) (-2180.615) [-2174.267] (-2183.848) * (-2179.229) (-2178.701) [-2179.819] (-2173.558) -- 0:02:25
      547000 -- (-2175.020) [-2173.478] (-2172.213) (-2171.052) * (-2169.959) [-2172.126] (-2184.738) (-2177.910) -- 0:02:24
      547500 -- (-2174.200) (-2172.454) (-2172.850) [-2171.225] * [-2180.911] (-2167.197) (-2171.002) (-2175.066) -- 0:02:24
      548000 -- (-2175.440) (-2170.041) [-2174.073] (-2176.069) * [-2175.980] (-2176.156) (-2172.312) (-2176.947) -- 0:02:24
      548500 -- (-2178.410) (-2170.956) (-2177.040) [-2169.607] * (-2173.838) (-2175.943) [-2171.283] (-2176.696) -- 0:02:24
      549000 -- (-2173.680) (-2176.952) [-2173.054] (-2180.560) * [-2169.801] (-2168.514) (-2180.210) (-2176.477) -- 0:02:23
      549500 -- (-2177.182) (-2172.004) (-2178.934) [-2175.558] * (-2182.475) (-2177.053) (-2171.247) [-2173.164] -- 0:02:24
      550000 -- (-2177.625) [-2171.914] (-2178.958) (-2173.357) * [-2171.741] (-2174.855) (-2174.297) (-2177.990) -- 0:02:24

      Average standard deviation of split frequencies: 0.001926

      550500 -- [-2179.274] (-2174.980) (-2178.680) (-2169.613) * [-2173.503] (-2172.761) (-2174.259) (-2178.232) -- 0:02:23
      551000 -- (-2179.915) (-2179.397) [-2174.099] (-2174.346) * (-2171.960) [-2169.744] (-2173.039) (-2175.031) -- 0:02:23
      551500 -- (-2173.098) (-2170.143) (-2183.177) [-2174.783] * [-2168.613] (-2185.083) (-2174.834) (-2175.022) -- 0:02:23
      552000 -- (-2178.165) (-2171.293) (-2170.834) [-2169.722] * (-2173.927) [-2171.850] (-2170.276) (-2177.548) -- 0:02:22
      552500 -- (-2172.582) (-2175.642) [-2172.668] (-2179.469) * (-2173.358) (-2190.298) [-2172.256] (-2172.821) -- 0:02:23
      553000 -- (-2177.595) [-2177.758] (-2170.860) (-2175.040) * (-2172.440) [-2172.871] (-2179.952) (-2170.128) -- 0:02:23
      553500 -- (-2172.453) (-2179.747) (-2176.117) [-2177.259] * [-2171.100] (-2168.639) (-2175.489) (-2175.672) -- 0:02:22
      554000 -- [-2174.985] (-2180.262) (-2177.030) (-2179.581) * (-2171.616) [-2176.263] (-2175.832) (-2177.458) -- 0:02:22
      554500 -- (-2174.729) (-2175.476) (-2179.963) [-2171.871] * [-2167.896] (-2172.810) (-2184.238) (-2178.766) -- 0:02:22
      555000 -- (-2171.817) (-2168.378) (-2182.250) [-2175.372] * (-2178.640) [-2176.276] (-2184.230) (-2173.918) -- 0:02:21

      Average standard deviation of split frequencies: 0.002332

      555500 -- (-2168.404) (-2171.364) [-2172.252] (-2177.779) * (-2171.302) (-2172.870) [-2171.145] (-2182.557) -- 0:02:21
      556000 -- [-2168.917] (-2173.867) (-2176.338) (-2178.966) * (-2172.393) (-2177.214) (-2175.346) [-2171.851] -- 0:02:22
      556500 -- (-2173.547) (-2180.187) (-2176.851) [-2180.595] * [-2175.032] (-2179.452) (-2173.084) (-2179.668) -- 0:02:21
      557000 -- (-2174.042) (-2175.533) [-2171.117] (-2170.536) * [-2173.106] (-2172.340) (-2177.307) (-2171.435) -- 0:02:21
      557500 -- (-2173.307) (-2176.870) [-2172.536] (-2171.671) * (-2174.926) (-2173.717) (-2177.895) [-2175.463] -- 0:02:21
      558000 -- [-2174.956] (-2173.159) (-2173.997) (-2177.347) * (-2172.650) [-2172.891] (-2177.028) (-2176.994) -- 0:02:20
      558500 -- [-2174.893] (-2175.819) (-2174.851) (-2176.545) * [-2172.299] (-2183.457) (-2177.600) (-2173.952) -- 0:02:20
      559000 -- (-2177.954) [-2176.545] (-2174.207) (-2172.178) * (-2171.252) (-2181.434) [-2176.080] (-2178.890) -- 0:02:21
      559500 -- (-2172.160) (-2174.077) (-2172.975) [-2171.876] * [-2170.463] (-2174.567) (-2171.578) (-2177.619) -- 0:02:20
      560000 -- [-2176.926] (-2174.272) (-2181.098) (-2171.010) * (-2167.824) (-2180.309) (-2178.137) [-2175.735] -- 0:02:20

      Average standard deviation of split frequencies: 0.001892

      560500 -- (-2171.482) (-2183.836) (-2176.986) [-2168.872] * [-2173.939] (-2170.684) (-2173.018) (-2180.537) -- 0:02:20
      561000 -- (-2169.006) (-2179.106) [-2173.859] (-2173.921) * (-2171.882) (-2172.395) (-2178.724) [-2174.901] -- 0:02:20
      561500 -- [-2171.002] (-2181.426) (-2173.056) (-2171.856) * [-2176.835] (-2177.202) (-2175.384) (-2174.966) -- 0:02:19
      562000 -- (-2173.569) (-2174.126) [-2176.936] (-2175.819) * (-2171.367) (-2172.760) (-2176.960) [-2169.894] -- 0:02:20
      562500 -- (-2172.505) [-2175.355] (-2169.851) (-2173.728) * (-2177.729) [-2171.748] (-2173.259) (-2173.623) -- 0:02:20
      563000 -- [-2170.914] (-2173.651) (-2176.387) (-2173.034) * (-2173.655) (-2179.752) (-2175.657) [-2169.238] -- 0:02:19
      563500 -- (-2184.601) [-2169.643] (-2179.820) (-2170.900) * (-2179.374) (-2179.136) [-2172.323] (-2170.241) -- 0:02:19
      564000 -- (-2174.079) (-2172.769) (-2171.276) [-2174.062] * (-2181.357) (-2177.096) [-2171.479] (-2170.496) -- 0:02:19
      564500 -- (-2175.118) (-2174.054) (-2173.164) [-2174.008] * (-2176.270) [-2176.465] (-2169.329) (-2175.233) -- 0:02:18
      565000 -- (-2177.337) (-2174.299) (-2172.417) [-2174.591] * (-2173.266) [-2171.556] (-2173.524) (-2182.551) -- 0:02:19

      Average standard deviation of split frequencies: 0.001874

      565500 -- (-2171.978) [-2171.980] (-2177.575) (-2167.619) * (-2176.528) [-2175.810] (-2176.321) (-2173.651) -- 0:02:19
      566000 -- (-2177.352) (-2175.616) [-2169.166] (-2175.790) * (-2172.846) (-2184.297) (-2173.569) [-2176.148] -- 0:02:18
      566500 -- [-2171.156] (-2176.127) (-2171.736) (-2173.622) * (-2176.379) (-2176.684) (-2171.376) [-2173.961] -- 0:02:18
      567000 -- (-2173.117) (-2174.450) [-2173.683] (-2165.544) * [-2170.714] (-2176.966) (-2180.597) (-2171.804) -- 0:02:18
      567500 -- [-2175.857] (-2176.554) (-2173.030) (-2169.598) * [-2172.830] (-2185.740) (-2179.180) (-2174.008) -- 0:02:17
      568000 -- [-2176.765] (-2174.546) (-2171.982) (-2170.918) * (-2172.536) (-2178.561) (-2177.436) [-2173.307] -- 0:02:17
      568500 -- (-2174.792) [-2170.786] (-2177.850) (-2170.265) * [-2173.547] (-2185.982) (-2177.125) (-2172.902) -- 0:02:18
      569000 -- (-2174.888) (-2173.604) [-2170.646] (-2168.030) * [-2174.876] (-2180.553) (-2172.389) (-2170.772) -- 0:02:17
      569500 -- (-2173.884) (-2178.464) (-2168.277) [-2171.772] * (-2180.551) [-2173.212] (-2179.388) (-2172.238) -- 0:02:17
      570000 -- (-2168.833) (-2172.217) [-2172.502] (-2172.158) * (-2176.725) (-2179.847) [-2168.785] (-2172.049) -- 0:02:17

      Average standard deviation of split frequencies: 0.001859

      570500 -- (-2174.716) (-2172.817) (-2173.589) [-2171.406] * (-2177.443) [-2170.495] (-2177.485) (-2176.345) -- 0:02:17
      571000 -- [-2170.441] (-2175.280) (-2185.008) (-2181.492) * (-2177.632) (-2174.204) (-2176.343) [-2170.430] -- 0:02:16
      571500 -- (-2173.004) [-2175.950] (-2169.837) (-2174.695) * (-2170.694) (-2174.371) [-2171.762] (-2178.383) -- 0:02:17
      572000 -- (-2169.117) [-2169.337] (-2172.201) (-2177.683) * [-2172.990] (-2175.833) (-2170.844) (-2179.515) -- 0:02:16
      572500 -- (-2180.286) (-2168.299) (-2175.000) [-2173.978] * [-2175.043] (-2186.332) (-2170.244) (-2183.471) -- 0:02:16
      573000 -- (-2170.953) (-2175.314) (-2178.505) [-2169.555] * [-2172.699] (-2173.190) (-2175.130) (-2172.272) -- 0:02:16
      573500 -- (-2174.042) [-2171.048] (-2179.938) (-2175.257) * (-2174.053) [-2171.881] (-2176.390) (-2173.119) -- 0:02:16
      574000 -- (-2178.833) [-2170.835] (-2180.997) (-2175.955) * (-2176.957) [-2175.219] (-2172.978) (-2180.340) -- 0:02:15
      574500 -- [-2178.161] (-2178.570) (-2177.676) (-2174.337) * (-2177.665) (-2174.470) (-2172.716) [-2173.774] -- 0:02:16
      575000 -- (-2177.503) (-2173.976) [-2171.048] (-2170.585) * (-2173.276) [-2171.827] (-2186.243) (-2179.475) -- 0:02:16

      Average standard deviation of split frequencies: 0.002864

      575500 -- (-2173.227) [-2172.222] (-2179.402) (-2172.610) * (-2175.155) (-2174.892) (-2171.048) [-2173.619] -- 0:02:15
      576000 -- (-2189.884) (-2169.559) (-2175.830) [-2173.758] * [-2176.076] (-2169.570) (-2176.794) (-2176.314) -- 0:02:15
      576500 -- [-2178.633] (-2176.914) (-2174.594) (-2173.233) * (-2178.399) (-2173.726) [-2173.228] (-2172.026) -- 0:02:15
      577000 -- (-2173.301) [-2171.292] (-2174.560) (-2178.688) * (-2173.290) [-2175.418] (-2174.943) (-2171.860) -- 0:02:14
      577500 -- [-2172.795] (-2167.696) (-2168.509) (-2178.030) * (-2174.510) (-2173.438) [-2174.684] (-2171.066) -- 0:02:14
      578000 -- (-2172.571) (-2174.836) [-2175.305] (-2175.068) * (-2175.060) [-2175.092] (-2176.081) (-2181.154) -- 0:02:15
      578500 -- (-2172.218) (-2175.027) [-2187.047] (-2177.337) * (-2172.981) (-2180.807) (-2171.458) [-2171.002] -- 0:02:14
      579000 -- (-2176.169) [-2177.282] (-2177.359) (-2176.161) * (-2173.412) (-2177.125) [-2176.541] (-2175.406) -- 0:02:14
      579500 -- (-2174.002) (-2173.109) (-2175.248) [-2173.390] * (-2169.437) (-2172.395) (-2176.261) [-2184.001] -- 0:02:14
      580000 -- (-2175.402) (-2183.996) (-2172.826) [-2171.394] * (-2169.590) (-2177.163) (-2172.709) [-2172.780] -- 0:02:13

      Average standard deviation of split frequencies: 0.002841

      580500 -- (-2174.168) (-2175.842) [-2173.249] (-2175.902) * (-2178.378) (-2181.648) [-2170.273] (-2178.346) -- 0:02:13
      581000 -- (-2181.475) (-2178.635) [-2169.723] (-2183.189) * (-2175.280) (-2175.634) [-2173.861] (-2175.562) -- 0:02:14
      581500 -- (-2169.607) (-2180.800) [-2176.303] (-2172.487) * (-2176.152) [-2170.012] (-2175.520) (-2171.300) -- 0:02:13
      582000 -- (-2170.543) (-2175.981) [-2171.876] (-2176.388) * (-2182.828) (-2175.102) (-2180.099) [-2179.219] -- 0:02:13
      582500 -- (-2171.361) (-2173.496) [-2173.523] (-2178.538) * (-2183.127) (-2172.266) [-2168.711] (-2180.477) -- 0:02:13
      583000 -- (-2172.736) [-2174.907] (-2173.836) (-2178.988) * (-2176.904) [-2170.366] (-2167.430) (-2182.530) -- 0:02:13
      583500 -- (-2172.624) (-2167.972) [-2167.734] (-2178.149) * (-2171.836) [-2178.325] (-2168.314) (-2172.145) -- 0:02:12
      584000 -- (-2181.955) (-2177.205) [-2173.468] (-2174.970) * (-2178.083) [-2174.259] (-2172.921) (-2174.170) -- 0:02:13
      584500 -- (-2185.477) [-2172.337] (-2173.092) (-2177.167) * [-2168.590] (-2178.906) (-2173.136) (-2175.088) -- 0:02:12
      585000 -- [-2170.726] (-2176.875) (-2179.357) (-2182.916) * [-2175.119] (-2174.873) (-2170.089) (-2176.657) -- 0:02:12

      Average standard deviation of split frequencies: 0.002614

      585500 -- [-2175.903] (-2180.417) (-2169.799) (-2174.418) * (-2170.438) (-2177.424) [-2171.843] (-2176.679) -- 0:02:12
      586000 -- (-2170.718) (-2177.015) [-2172.672] (-2170.512) * (-2175.040) (-2171.358) [-2171.696] (-2182.803) -- 0:02:12
      586500 -- [-2173.996] (-2172.045) (-2178.595) (-2176.289) * (-2172.990) (-2168.843) [-2171.778] (-2179.653) -- 0:02:11
      587000 -- (-2174.005) (-2175.802) [-2168.448] (-2168.460) * (-2171.962) (-2170.743) (-2177.441) [-2179.178] -- 0:02:11
      587500 -- (-2173.754) (-2176.006) [-2177.310] (-2170.221) * (-2175.405) (-2174.130) [-2176.539] (-2173.678) -- 0:02:12
      588000 -- [-2175.535] (-2176.053) (-2173.508) (-2176.971) * (-2170.049) (-2174.779) [-2177.345] (-2173.420) -- 0:02:11
      588500 -- [-2177.225] (-2184.601) (-2179.501) (-2174.132) * [-2172.812] (-2177.240) (-2178.465) (-2175.700) -- 0:02:11
      589000 -- (-2180.897) (-2171.802) (-2182.569) [-2171.058] * (-2178.063) [-2171.728] (-2179.229) (-2175.780) -- 0:02:11
      589500 -- (-2172.520) (-2177.699) [-2174.048] (-2170.404) * [-2172.441] (-2183.373) (-2176.677) (-2175.002) -- 0:02:10
      590000 -- [-2169.098] (-2170.789) (-2180.465) (-2181.408) * (-2169.192) (-2169.119) (-2175.884) [-2178.134] -- 0:02:10

      Average standard deviation of split frequencies: 0.002793

      590500 -- [-2175.435] (-2171.394) (-2179.539) (-2182.316) * (-2172.076) (-2170.643) (-2175.652) [-2174.945] -- 0:02:11
      591000 -- (-2176.022) (-2175.477) [-2176.209] (-2176.770) * (-2174.647) (-2170.955) [-2169.474] (-2170.331) -- 0:02:10
      591500 -- (-2177.650) (-2177.521) (-2176.870) [-2171.574] * (-2180.232) (-2173.076) (-2188.357) [-2175.151] -- 0:02:10
      592000 -- (-2172.234) (-2179.340) [-2173.248] (-2170.653) * (-2176.808) (-2174.237) (-2171.711) [-2169.584] -- 0:02:10
      592500 -- (-2175.521) (-2185.258) [-2171.607] (-2171.378) * (-2172.237) [-2169.903] (-2173.095) (-2174.849) -- 0:02:09
      593000 -- (-2174.410) (-2181.380) (-2170.114) [-2175.338] * [-2170.763] (-2177.049) (-2173.011) (-2173.209) -- 0:02:09
      593500 -- [-2176.234] (-2183.949) (-2178.278) (-2183.132) * (-2172.936) (-2178.124) (-2173.245) [-2174.816] -- 0:02:10
      594000 -- (-2173.306) (-2172.161) [-2174.271] (-2170.142) * (-2171.042) [-2173.971] (-2172.891) (-2171.863) -- 0:02:09
      594500 -- [-2171.727] (-2170.476) (-2181.311) (-2178.217) * (-2172.130) [-2171.265] (-2172.182) (-2174.603) -- 0:02:09
      595000 -- [-2166.283] (-2182.741) (-2176.350) (-2169.805) * [-2174.813] (-2172.911) (-2173.494) (-2173.203) -- 0:02:09

      Average standard deviation of split frequencies: 0.002571

      595500 -- [-2169.586] (-2175.789) (-2171.923) (-2169.058) * (-2176.070) (-2175.188) [-2174.467] (-2174.997) -- 0:02:09
      596000 -- (-2174.793) [-2173.388] (-2177.373) (-2172.920) * (-2178.235) [-2170.901] (-2175.813) (-2171.048) -- 0:02:08
      596500 -- (-2172.667) (-2176.121) (-2169.623) [-2176.379] * (-2180.143) [-2171.388] (-2184.479) (-2169.681) -- 0:02:09
      597000 -- (-2174.855) [-2171.430] (-2172.227) (-2168.186) * (-2181.926) (-2167.565) [-2175.788] (-2175.556) -- 0:02:08
      597500 -- (-2172.748) (-2172.417) (-2172.832) [-2175.011] * (-2179.294) [-2169.421] (-2175.504) (-2174.701) -- 0:02:08
      598000 -- (-2175.737) (-2172.127) (-2176.229) [-2175.587] * (-2183.302) (-2173.271) (-2175.760) [-2176.866] -- 0:02:08
      598500 -- (-2174.882) (-2173.814) [-2175.787] (-2178.820) * [-2175.978] (-2173.695) (-2181.120) (-2178.811) -- 0:02:08
      599000 -- [-2174.042] (-2176.506) (-2183.747) (-2170.467) * (-2177.913) (-2172.775) [-2174.592] (-2174.644) -- 0:02:07
      599500 -- (-2181.113) (-2181.668) [-2178.493] (-2173.681) * [-2174.217] (-2171.936) (-2176.889) (-2190.342) -- 0:02:07
      600000 -- (-2177.200) (-2172.630) (-2171.810) [-2171.108] * [-2176.649] (-2172.750) (-2177.680) (-2202.350) -- 0:02:08

      Average standard deviation of split frequencies: 0.002354

      600500 -- (-2180.146) (-2169.309) [-2175.661] (-2170.083) * (-2172.141) [-2172.939] (-2169.049) (-2170.458) -- 0:02:07
      601000 -- [-2174.254] (-2170.700) (-2169.955) (-2180.109) * (-2172.393) (-2173.064) (-2173.521) [-2167.883] -- 0:02:07
      601500 -- [-2176.416] (-2175.581) (-2169.294) (-2174.591) * (-2171.698) [-2171.573] (-2169.016) (-2173.487) -- 0:02:07
      602000 -- (-2180.534) [-2176.613] (-2174.848) (-2170.359) * (-2177.529) [-2175.366] (-2175.631) (-2175.332) -- 0:02:06
      602500 -- (-2174.987) (-2176.399) [-2172.899] (-2180.134) * (-2173.539) (-2172.676) [-2174.206] (-2176.653) -- 0:02:06
      603000 -- (-2176.919) (-2174.703) [-2171.058] (-2174.447) * [-2170.047] (-2178.109) (-2177.550) (-2173.467) -- 0:02:07
      603500 -- (-2168.668) [-2173.753] (-2173.464) (-2172.512) * (-2172.085) (-2179.873) (-2172.237) [-2169.692] -- 0:02:06
      604000 -- (-2173.655) (-2173.526) [-2175.310] (-2176.041) * (-2169.375) (-2176.181) [-2179.168] (-2173.877) -- 0:02:06
      604500 -- (-2172.370) [-2170.532] (-2181.844) (-2180.258) * (-2178.410) [-2171.529] (-2169.242) (-2184.508) -- 0:02:06
      605000 -- [-2175.549] (-2182.658) (-2175.537) (-2171.465) * (-2175.378) (-2178.907) (-2177.092) [-2174.774] -- 0:02:06

      Average standard deviation of split frequencies: 0.002334

      605500 -- [-2169.377] (-2182.244) (-2173.109) (-2168.155) * (-2172.160) (-2181.913) [-2173.031] (-2169.110) -- 0:02:06
      606000 -- [-2170.582] (-2178.688) (-2171.839) (-2177.819) * (-2169.944) [-2169.294] (-2176.896) (-2170.617) -- 0:02:06
      606500 -- (-2174.103) (-2180.266) [-2169.792] (-2177.849) * (-2170.819) (-2179.558) [-2170.537] (-2173.748) -- 0:02:05
      607000 -- (-2175.868) (-2170.347) (-2171.059) [-2180.798] * [-2171.137] (-2173.105) (-2174.870) (-2173.069) -- 0:02:05
      607500 -- (-2174.906) (-2172.190) [-2175.089] (-2173.953) * (-2177.049) [-2169.822] (-2171.873) (-2177.014) -- 0:02:05
      608000 -- (-2171.825) (-2170.651) (-2177.250) [-2171.504] * (-2173.175) (-2170.277) [-2169.957] (-2178.772) -- 0:02:05
      608500 -- (-2182.011) (-2172.901) [-2178.179] (-2169.656) * (-2177.713) (-2174.932) [-2168.850] (-2174.698) -- 0:02:05
      609000 -- (-2185.411) (-2174.839) (-2185.422) [-2173.696] * [-2173.339] (-2175.814) (-2176.186) (-2179.915) -- 0:02:05
      609500 -- (-2175.879) (-2173.417) [-2175.452] (-2170.055) * (-2178.877) (-2174.044) [-2175.770] (-2175.544) -- 0:02:04
      610000 -- (-2173.896) (-2174.550) [-2167.280] (-2175.724) * (-2173.533) (-2171.567) [-2171.976] (-2171.995) -- 0:02:04

      Average standard deviation of split frequencies: 0.002509

      610500 -- [-2178.091] (-2173.067) (-2169.713) (-2175.318) * (-2176.935) (-2175.839) (-2181.117) [-2176.554] -- 0:02:04
      611000 -- [-2170.913] (-2171.322) (-2177.441) (-2175.081) * [-2171.409] (-2178.136) (-2172.749) (-2170.268) -- 0:02:04
      611500 -- (-2174.862) (-2180.609) [-2170.420] (-2174.115) * (-2172.425) [-2171.777] (-2173.993) (-2170.477) -- 0:02:04
      612000 -- (-2171.221) (-2171.990) (-2173.974) [-2170.291] * (-2179.523) (-2180.398) (-2170.818) [-2177.364] -- 0:02:04
      612500 -- (-2169.998) (-2183.185) (-2177.365) [-2177.026] * (-2178.087) [-2172.331] (-2174.553) (-2171.203) -- 0:02:04
      613000 -- [-2171.794] (-2172.110) (-2174.227) (-2183.741) * (-2181.765) (-2173.985) (-2176.289) [-2171.761] -- 0:02:03
      613500 -- (-2174.313) (-2186.025) [-2168.287] (-2174.178) * (-2172.015) (-2174.638) (-2183.957) [-2170.223] -- 0:02:03
      614000 -- [-2170.234] (-2173.536) (-2171.717) (-2178.436) * [-2179.074] (-2173.702) (-2174.510) (-2172.951) -- 0:02:03
      614500 -- (-2170.860) (-2175.491) [-2168.256] (-2183.157) * [-2176.957] (-2177.538) (-2178.264) (-2169.806) -- 0:02:02
      615000 -- [-2166.816] (-2169.841) (-2176.208) (-2176.923) * (-2179.087) (-2176.663) [-2176.920] (-2180.202) -- 0:02:03

      Average standard deviation of split frequencies: 0.002296

      615500 -- (-2172.894) (-2175.363) [-2177.396] (-2176.756) * [-2170.152] (-2170.835) (-2176.085) (-2181.662) -- 0:02:03
      616000 -- (-2179.019) (-2181.726) [-2172.696] (-2170.623) * [-2168.711] (-2173.199) (-2174.966) (-2173.289) -- 0:02:02
      616500 -- (-2175.923) [-2177.338] (-2172.437) (-2178.283) * [-2169.497] (-2173.270) (-2177.526) (-2177.807) -- 0:02:02
      617000 -- (-2180.739) [-2173.244] (-2175.908) (-2178.534) * (-2173.880) (-2184.562) (-2177.300) [-2169.492] -- 0:02:02
      617500 -- (-2175.427) (-2170.333) (-2173.284) [-2174.104] * (-2179.647) [-2171.007] (-2179.772) (-2176.585) -- 0:02:02
      618000 -- (-2179.091) [-2183.241] (-2174.369) (-2173.493) * (-2179.010) (-2172.146) (-2170.120) [-2172.991] -- 0:02:02
      618500 -- (-2177.265) (-2177.194) [-2169.811] (-2172.250) * (-2169.617) (-2178.549) [-2172.368] (-2178.882) -- 0:02:02
      619000 -- [-2170.546] (-2174.584) (-2169.002) (-2190.836) * (-2179.281) [-2172.869] (-2186.124) (-2173.746) -- 0:02:01
      619500 -- (-2171.192) (-2173.202) (-2186.553) [-2170.728] * [-2175.470] (-2173.640) (-2186.316) (-2170.082) -- 0:02:01
      620000 -- (-2171.219) (-2169.816) [-2175.788] (-2176.539) * (-2176.913) (-2174.014) [-2173.082] (-2179.594) -- 0:02:01

      Average standard deviation of split frequencies: 0.001899

      620500 -- [-2169.991] (-2171.684) (-2171.958) (-2175.826) * (-2183.520) [-2176.331] (-2168.747) (-2172.934) -- 0:02:01
      621000 -- (-2172.246) (-2174.603) [-2171.609] (-2176.033) * [-2175.824] (-2173.922) (-2170.700) (-2181.897) -- 0:02:01
      621500 -- (-2175.917) [-2172.102] (-2181.759) (-2175.912) * (-2178.839) (-2170.437) [-2173.906] (-2176.473) -- 0:02:01
      622000 -- (-2170.824) [-2177.307] (-2172.681) (-2172.209) * [-2175.779] (-2174.919) (-2178.463) (-2174.750) -- 0:02:00
      622500 -- (-2179.239) [-2173.609] (-2173.235) (-2169.698) * (-2175.410) [-2170.896] (-2173.947) (-2171.203) -- 0:02:00
      623000 -- (-2177.125) (-2175.430) [-2173.690] (-2173.595) * [-2170.187] (-2170.620) (-2174.143) (-2174.005) -- 0:02:00
      623500 -- (-2174.775) (-2174.999) [-2172.706] (-2168.538) * [-2172.571] (-2175.363) (-2173.587) (-2186.046) -- 0:02:00
      624000 -- (-2173.160) (-2184.307) [-2172.135] (-2172.390) * (-2177.153) (-2172.566) [-2174.483] (-2176.389) -- 0:02:00
      624500 -- (-2177.436) (-2174.075) (-2171.706) [-2176.313] * (-2171.329) (-2173.315) (-2177.145) [-2171.019] -- 0:02:00
      625000 -- (-2174.255) (-2181.622) (-2179.092) [-2168.789] * (-2174.536) (-2168.914) (-2177.088) [-2172.478] -- 0:02:00

      Average standard deviation of split frequencies: 0.001883

      625500 -- (-2177.522) (-2180.331) [-2179.760] (-2174.845) * (-2174.055) (-2177.961) (-2167.956) [-2180.098] -- 0:01:59
      626000 -- (-2175.687) (-2170.945) (-2189.234) [-2177.253] * (-2176.011) (-2174.388) [-2172.368] (-2175.794) -- 0:01:59
      626500 -- (-2172.174) (-2169.300) (-2183.096) [-2178.338] * [-2171.339] (-2170.596) (-2177.043) (-2183.021) -- 0:01:59
      627000 -- (-2174.854) (-2170.853) (-2178.725) [-2169.480] * (-2179.756) (-2175.887) [-2169.229] (-2181.920) -- 0:01:58
      627500 -- [-2169.795] (-2172.928) (-2172.393) (-2179.001) * [-2180.721] (-2171.576) (-2176.936) (-2180.924) -- 0:01:59
      628000 -- (-2171.964) [-2169.630] (-2177.621) (-2177.839) * [-2177.212] (-2171.456) (-2171.729) (-2175.969) -- 0:01:59
      628500 -- (-2177.598) (-2180.238) (-2177.289) [-2173.791] * (-2172.139) (-2177.116) [-2172.997] (-2176.037) -- 0:01:58
      629000 -- (-2178.637) (-2179.606) (-2171.624) [-2173.377] * (-2172.155) (-2178.184) [-2169.308] (-2175.688) -- 0:01:58
      629500 -- (-2169.848) (-2171.170) [-2167.487] (-2170.449) * (-2172.628) (-2175.601) (-2173.357) [-2173.550] -- 0:01:58
      630000 -- (-2176.977) (-2174.473) (-2177.583) [-2176.657] * (-2170.674) (-2177.178) [-2168.869] (-2175.760) -- 0:01:58

      Average standard deviation of split frequencies: 0.001495

      630500 -- (-2177.920) (-2174.802) [-2171.537] (-2171.322) * [-2181.117] (-2175.178) (-2175.551) (-2181.310) -- 0:01:58
      631000 -- [-2170.171] (-2170.152) (-2182.050) (-2170.189) * (-2178.155) (-2169.722) [-2175.257] (-2180.309) -- 0:01:58
      631500 -- [-2179.196] (-2178.970) (-2179.376) (-2175.281) * (-2176.916) [-2170.597] (-2187.684) (-2173.482) -- 0:01:57
      632000 -- (-2175.005) [-2175.244] (-2176.834) (-2173.725) * (-2174.000) (-2176.778) (-2176.231) [-2172.829] -- 0:01:57
      632500 -- (-2166.513) [-2174.580] (-2174.390) (-2181.378) * [-2172.531] (-2171.773) (-2178.752) (-2181.599) -- 0:01:57
      633000 -- [-2168.137] (-2176.730) (-2174.052) (-2170.456) * (-2170.330) (-2175.701) [-2168.361] (-2178.731) -- 0:01:57
      633500 -- (-2174.403) (-2177.809) (-2179.203) [-2172.035] * [-2169.950] (-2170.506) (-2172.755) (-2168.773) -- 0:01:57
      634000 -- [-2176.623] (-2174.307) (-2174.964) (-2174.310) * [-2175.051] (-2178.470) (-2183.646) (-2175.871) -- 0:01:57
      634500 -- (-2176.454) (-2170.231) (-2175.010) [-2177.179] * (-2178.394) (-2176.386) (-2180.962) [-2179.871] -- 0:01:56
      635000 -- (-2179.981) [-2169.236] (-2173.530) (-2177.149) * [-2180.462] (-2172.649) (-2173.748) (-2173.497) -- 0:01:56

      Average standard deviation of split frequencies: 0.001668

      635500 -- (-2177.820) [-2171.797] (-2173.109) (-2182.745) * (-2172.195) (-2168.346) [-2173.385] (-2174.928) -- 0:01:56
      636000 -- (-2183.140) (-2172.905) (-2180.237) [-2174.162] * (-2180.157) [-2173.228] (-2177.014) (-2173.329) -- 0:01:56
      636500 -- (-2177.755) (-2169.782) (-2184.145) [-2173.782] * (-2187.276) [-2177.475] (-2181.484) (-2173.552) -- 0:01:56
      637000 -- (-2174.275) (-2173.139) [-2173.181] (-2174.634) * (-2173.104) (-2180.652) [-2174.283] (-2176.305) -- 0:01:56
      637500 -- (-2176.471) (-2171.363) (-2181.287) [-2179.584] * (-2170.815) (-2177.891) [-2167.480] (-2180.842) -- 0:01:56
      638000 -- (-2177.747) (-2171.831) (-2180.512) [-2174.685] * (-2170.780) (-2188.061) (-2178.454) [-2170.871] -- 0:01:55
      638500 -- [-2174.077] (-2171.437) (-2174.359) (-2180.768) * (-2174.690) [-2174.851] (-2177.525) (-2169.598) -- 0:01:55
      639000 -- (-2170.171) (-2174.747) [-2172.202] (-2177.007) * (-2175.672) (-2168.994) [-2177.573] (-2171.470) -- 0:01:55
      639500 -- (-2178.547) (-2175.608) [-2174.390] (-2172.953) * (-2177.731) [-2178.070] (-2173.810) (-2175.026) -- 0:01:55
      640000 -- (-2179.687) [-2170.006] (-2174.585) (-2175.554) * (-2177.927) [-2176.828] (-2171.756) (-2176.436) -- 0:01:55

      Average standard deviation of split frequencies: 0.001472

      640500 -- (-2174.638) [-2167.581] (-2178.002) (-2169.875) * (-2178.167) (-2173.074) [-2173.879] (-2175.383) -- 0:01:55
      641000 -- (-2179.241) (-2174.242) (-2177.123) [-2170.253] * (-2181.323) (-2177.488) [-2179.093] (-2170.048) -- 0:01:54
      641500 -- (-2179.778) [-2174.777] (-2178.339) (-2172.909) * (-2178.114) (-2172.025) (-2171.745) [-2172.121] -- 0:01:54
      642000 -- (-2172.870) (-2168.820) [-2170.703] (-2181.627) * [-2171.398] (-2178.787) (-2176.067) (-2170.231) -- 0:01:54
      642500 -- (-2180.873) (-2171.535) (-2176.853) [-2171.279] * (-2171.472) (-2178.703) (-2182.686) [-2173.149] -- 0:01:54
      643000 -- (-2174.813) (-2176.704) [-2170.419] (-2180.762) * (-2181.056) [-2169.960] (-2179.993) (-2176.256) -- 0:01:54
      643500 -- (-2180.477) (-2176.739) [-2170.585] (-2174.856) * [-2178.345] (-2171.583) (-2173.919) (-2173.706) -- 0:01:54
      644000 -- (-2178.311) (-2175.015) [-2173.787] (-2176.798) * (-2174.201) [-2168.789] (-2183.859) (-2176.607) -- 0:01:53
      644500 -- [-2173.117] (-2175.216) (-2178.555) (-2175.457) * (-2171.303) [-2172.315] (-2179.581) (-2178.372) -- 0:01:53
      645000 -- (-2169.833) (-2177.408) [-2179.813] (-2187.476) * (-2181.769) [-2173.274] (-2169.656) (-2173.824) -- 0:01:53

      Average standard deviation of split frequencies: 0.001642

      645500 -- [-2171.342] (-2181.041) (-2173.173) (-2181.411) * (-2169.335) [-2172.601] (-2176.601) (-2178.264) -- 0:01:53
      646000 -- [-2174.766] (-2173.547) (-2176.131) (-2173.009) * (-2171.040) [-2174.774] (-2182.731) (-2176.838) -- 0:01:53
      646500 -- [-2179.829] (-2177.807) (-2174.986) (-2182.147) * (-2170.791) (-2178.940) (-2171.816) [-2174.875] -- 0:01:53
      647000 -- (-2175.527) [-2174.238] (-2172.440) (-2171.618) * (-2172.274) (-2176.421) (-2179.802) [-2171.277] -- 0:01:52
      647500 -- (-2171.147) [-2171.427] (-2173.624) (-2170.224) * (-2173.320) [-2178.758] (-2172.127) (-2171.832) -- 0:01:52
      648000 -- (-2174.199) (-2174.935) [-2169.959] (-2175.090) * (-2173.933) [-2169.468] (-2176.207) (-2180.148) -- 0:01:52
      648500 -- (-2174.404) (-2173.181) [-2171.132] (-2173.781) * (-2175.960) (-2170.112) (-2178.451) [-2175.324] -- 0:01:52
      649000 -- [-2172.219] (-2170.759) (-2179.549) (-2182.575) * (-2176.332) (-2168.451) [-2171.622] (-2178.905) -- 0:01:52
      649500 -- (-2178.223) [-2172.753] (-2175.633) (-2173.346) * [-2175.154] (-2175.493) (-2173.339) (-2175.974) -- 0:01:52
      650000 -- [-2167.602] (-2182.438) (-2170.542) (-2174.155) * (-2182.611) (-2170.732) (-2178.165) [-2171.252] -- 0:01:52

      Average standard deviation of split frequencies: 0.001630

      650500 -- [-2172.984] (-2173.456) (-2172.893) (-2177.406) * [-2176.727] (-2171.564) (-2181.226) (-2170.875) -- 0:01:51
      651000 -- (-2175.954) [-2182.261] (-2175.108) (-2173.051) * (-2179.740) (-2173.887) [-2172.786] (-2179.063) -- 0:01:51
      651500 -- (-2176.893) [-2171.449] (-2176.176) (-2173.156) * [-2171.277] (-2175.634) (-2176.864) (-2176.325) -- 0:01:51
      652000 -- (-2176.978) (-2175.628) (-2179.239) [-2173.869] * [-2175.585] (-2173.793) (-2181.920) (-2173.522) -- 0:01:51
      652500 -- (-2173.846) (-2168.204) [-2176.699] (-2175.318) * [-2171.859] (-2172.593) (-2177.065) (-2171.550) -- 0:01:51
      653000 -- (-2169.684) (-2179.249) [-2174.028] (-2173.461) * [-2174.903] (-2173.013) (-2177.247) (-2173.771) -- 0:01:51
      653500 -- (-2172.152) (-2178.034) (-2173.990) [-2176.573] * (-2171.900) (-2175.183) [-2171.779] (-2174.918) -- 0:01:50
      654000 -- [-2174.113] (-2184.800) (-2178.090) (-2178.185) * (-2174.401) [-2178.065] (-2177.850) (-2179.579) -- 0:01:50
      654500 -- (-2170.940) (-2178.780) (-2172.878) [-2179.066] * [-2170.970] (-2174.769) (-2173.549) (-2177.369) -- 0:01:50
      655000 -- [-2170.791] (-2173.379) (-2171.092) (-2176.025) * [-2183.883] (-2175.701) (-2176.512) (-2172.705) -- 0:01:50

      Average standard deviation of split frequencies: 0.001437

      655500 -- [-2173.316] (-2182.334) (-2174.251) (-2175.289) * (-2174.655) (-2176.640) (-2180.218) [-2172.849] -- 0:01:50
      656000 -- [-2174.472] (-2174.870) (-2176.928) (-2177.922) * (-2179.110) (-2183.663) (-2171.533) [-2178.965] -- 0:01:50
      656500 -- (-2170.922) (-2176.660) [-2174.654] (-2170.976) * (-2178.548) [-2171.625] (-2186.553) (-2177.144) -- 0:01:49
      657000 -- (-2175.390) (-2174.383) [-2168.747] (-2173.628) * [-2176.269] (-2181.341) (-2175.363) (-2172.513) -- 0:01:49
      657500 -- (-2175.470) (-2173.428) [-2171.031] (-2173.739) * [-2168.687] (-2183.016) (-2180.793) (-2172.746) -- 0:01:49
      658000 -- [-2170.705] (-2177.039) (-2177.277) (-2170.029) * [-2172.399] (-2170.831) (-2173.552) (-2173.286) -- 0:01:49
      658500 -- (-2170.298) (-2169.525) [-2174.094] (-2179.864) * [-2176.346] (-2185.227) (-2171.725) (-2175.923) -- 0:01:49
      659000 -- (-2171.016) (-2169.375) [-2173.762] (-2175.699) * [-2170.063] (-2179.751) (-2173.418) (-2177.435) -- 0:01:49
      659500 -- (-2177.218) [-2169.370] (-2172.146) (-2181.620) * (-2180.227) (-2177.342) (-2182.113) [-2170.958] -- 0:01:48
      660000 -- (-2168.671) (-2176.128) (-2181.321) [-2170.525] * (-2175.932) [-2172.057] (-2178.677) (-2173.783) -- 0:01:48

      Average standard deviation of split frequencies: 0.001605

      660500 -- (-2172.868) (-2172.539) [-2170.285] (-2170.858) * [-2177.396] (-2177.409) (-2176.608) (-2174.116) -- 0:01:48
      661000 -- (-2175.542) (-2174.120) (-2179.295) [-2172.329] * (-2174.349) (-2178.832) (-2180.514) [-2170.568] -- 0:01:48
      661500 -- (-2172.833) (-2172.384) [-2174.244] (-2180.829) * (-2171.834) (-2173.476) (-2175.421) [-2170.783] -- 0:01:48
      662000 -- (-2187.509) (-2183.935) (-2174.475) [-2172.336] * (-2174.816) [-2173.493] (-2171.055) (-2170.381) -- 0:01:48
      662500 -- (-2175.696) (-2173.040) (-2180.222) [-2175.331] * [-2171.595] (-2171.591) (-2176.476) (-2171.575) -- 0:01:48
      663000 -- (-2179.847) (-2175.921) [-2170.913] (-2175.297) * [-2172.886] (-2179.573) (-2179.720) (-2171.174) -- 0:01:47
      663500 -- (-2169.829) (-2175.499) [-2175.722] (-2170.881) * (-2175.424) [-2176.297] (-2179.136) (-2173.912) -- 0:01:47
      664000 -- (-2173.294) (-2170.080) [-2172.121] (-2171.989) * [-2166.503] (-2178.089) (-2176.432) (-2173.415) -- 0:01:47
      664500 -- (-2175.532) (-2175.644) [-2173.470] (-2175.003) * [-2170.514] (-2175.230) (-2179.538) (-2173.996) -- 0:01:47
      665000 -- (-2174.608) (-2182.757) [-2170.966] (-2169.599) * [-2174.136] (-2173.898) (-2172.160) (-2168.990) -- 0:01:47

      Average standard deviation of split frequencies: 0.001946

      665500 -- (-2174.501) (-2181.604) (-2172.156) [-2170.144] * (-2174.093) (-2172.853) [-2178.949] (-2183.581) -- 0:01:47
      666000 -- [-2172.249] (-2176.024) (-2178.098) (-2176.168) * (-2176.826) (-2176.181) [-2173.258] (-2171.816) -- 0:01:46
      666500 -- [-2167.789] (-2169.324) (-2176.916) (-2175.117) * (-2176.404) [-2172.859] (-2182.999) (-2181.980) -- 0:01:46
      667000 -- (-2173.671) (-2181.076) [-2177.154] (-2176.808) * [-2176.883] (-2176.982) (-2187.789) (-2173.163) -- 0:01:46
      667500 -- (-2174.094) (-2170.999) (-2178.854) [-2174.066] * (-2169.986) (-2182.783) (-2179.571) [-2175.302] -- 0:01:46
      668000 -- (-2175.414) (-2175.231) (-2172.006) [-2174.941] * [-2171.042] (-2174.853) (-2193.137) (-2170.869) -- 0:01:46
      668500 -- [-2169.991] (-2179.043) (-2177.454) (-2172.661) * (-2173.738) (-2170.398) [-2188.493] (-2174.912) -- 0:01:46
      669000 -- (-2174.994) (-2177.529) [-2176.346] (-2169.189) * (-2176.940) (-2173.058) (-2191.763) [-2169.610] -- 0:01:45
      669500 -- [-2172.067] (-2174.563) (-2182.271) (-2176.383) * (-2171.767) (-2174.616) (-2176.250) [-2171.713] -- 0:01:45
      670000 -- (-2174.767) [-2173.647] (-2179.766) (-2172.731) * [-2174.349] (-2172.471) (-2178.788) (-2170.680) -- 0:01:45

      Average standard deviation of split frequencies: 0.002284

      670500 -- [-2174.818] (-2176.902) (-2180.940) (-2170.515) * (-2174.631) [-2174.913] (-2177.388) (-2173.515) -- 0:01:45
      671000 -- (-2177.157) (-2179.200) [-2173.979] (-2184.957) * (-2177.030) (-2171.100) (-2174.336) [-2169.225] -- 0:01:45
      671500 -- [-2176.462] (-2173.716) (-2175.600) (-2179.729) * (-2178.769) (-2176.391) (-2175.529) [-2176.423] -- 0:01:45
      672000 -- (-2178.902) [-2174.057] (-2174.033) (-2175.742) * (-2175.837) [-2174.616] (-2172.980) (-2169.983) -- 0:01:44
      672500 -- (-2182.059) (-2183.964) (-2170.071) [-2172.686] * (-2184.222) (-2176.189) [-2172.393] (-2172.821) -- 0:01:44
      673000 -- [-2174.203] (-2177.078) (-2172.649) (-2175.405) * (-2182.319) (-2174.721) (-2176.255) [-2174.581] -- 0:01:44
      673500 -- (-2175.414) (-2170.387) [-2169.263] (-2172.436) * [-2174.098] (-2179.017) (-2170.493) (-2179.706) -- 0:01:44
      674000 -- (-2177.763) (-2173.191) [-2174.091] (-2174.584) * (-2173.288) [-2172.363] (-2174.830) (-2179.400) -- 0:01:44
      674500 -- (-2170.406) (-2177.535) [-2168.807] (-2174.829) * (-2183.453) (-2170.576) (-2170.533) [-2173.159] -- 0:01:44
      675000 -- (-2173.763) [-2168.861] (-2179.812) (-2168.684) * (-2185.530) (-2170.991) [-2179.058] (-2175.522) -- 0:01:44

      Average standard deviation of split frequencies: 0.001918

      675500 -- (-2173.029) (-2177.786) (-2176.500) [-2179.491] * (-2171.522) (-2180.731) (-2174.208) [-2172.281] -- 0:01:43
      676000 -- [-2177.040] (-2174.917) (-2175.661) (-2171.011) * (-2169.741) (-2178.523) (-2175.531) [-2177.784] -- 0:01:43
      676500 -- (-2175.628) (-2174.745) [-2172.472] (-2173.041) * (-2173.642) [-2172.419] (-2185.565) (-2178.379) -- 0:01:43
      677000 -- (-2175.426) [-2176.116] (-2175.969) (-2167.530) * [-2172.386] (-2173.475) (-2183.234) (-2176.129) -- 0:01:43
      677500 -- [-2177.365] (-2178.151) (-2176.995) (-2177.743) * [-2174.556] (-2174.196) (-2182.826) (-2184.190) -- 0:01:43
      678000 -- (-2175.075) (-2179.058) (-2180.170) [-2171.113] * (-2175.439) (-2188.120) [-2176.151] (-2169.549) -- 0:01:43
      678500 -- (-2182.964) (-2181.432) (-2183.633) [-2169.608] * (-2178.253) (-2184.584) [-2168.093] (-2179.582) -- 0:01:42
      679000 -- [-2171.108] (-2176.848) (-2172.417) (-2177.055) * (-2175.730) [-2170.736] (-2169.875) (-2177.892) -- 0:01:42
      679500 -- (-2176.808) (-2173.474) (-2177.744) [-2176.660] * (-2169.938) [-2173.407] (-2174.480) (-2177.423) -- 0:01:42
      680000 -- (-2174.570) [-2171.227] (-2174.748) (-2172.357) * (-2171.228) (-2179.938) [-2174.713] (-2174.094) -- 0:01:42

      Average standard deviation of split frequencies: 0.001731

      680500 -- [-2173.536] (-2178.183) (-2173.058) (-2178.600) * (-2170.924) (-2177.453) (-2177.611) [-2171.403] -- 0:01:42
      681000 -- (-2178.237) [-2175.538] (-2173.688) (-2172.730) * [-2172.457] (-2176.604) (-2168.000) (-2177.632) -- 0:01:42
      681500 -- (-2175.046) (-2183.369) [-2176.009] (-2177.469) * (-2172.986) [-2174.092] (-2181.922) (-2173.923) -- 0:01:41
      682000 -- [-2169.327] (-2177.929) (-2175.909) (-2173.801) * (-2169.659) (-2180.537) (-2173.875) [-2172.871] -- 0:01:41
      682500 -- [-2167.895] (-2170.950) (-2178.993) (-2178.559) * [-2177.196] (-2180.102) (-2173.615) (-2175.473) -- 0:01:41
      683000 -- (-2173.415) [-2174.791] (-2175.572) (-2179.772) * (-2178.299) (-2181.392) [-2180.192] (-2174.629) -- 0:01:41
      683500 -- (-2175.242) (-2176.383) (-2172.160) [-2175.409] * (-2186.263) (-2179.472) (-2182.242) [-2171.821] -- 0:01:41
      684000 -- (-2168.891) (-2180.528) (-2176.457) [-2171.193] * (-2180.170) (-2180.841) (-2171.896) [-2173.543] -- 0:01:41
      684500 -- [-2173.783] (-2176.715) (-2183.655) (-2180.050) * [-2175.698] (-2177.130) (-2173.758) (-2175.038) -- 0:01:40
      685000 -- [-2172.451] (-2175.052) (-2174.456) (-2173.053) * (-2171.861) [-2170.112] (-2177.950) (-2177.644) -- 0:01:40

      Average standard deviation of split frequencies: 0.001546

      685500 -- (-2178.441) (-2176.124) [-2171.783] (-2173.899) * (-2178.961) [-2179.283] (-2176.892) (-2176.833) -- 0:01:40
      686000 -- (-2181.512) [-2174.886] (-2174.276) (-2173.821) * (-2175.582) [-2171.424] (-2176.624) (-2175.576) -- 0:01:40
      686500 -- (-2178.476) (-2173.982) (-2173.573) [-2177.652] * (-2174.577) [-2174.835] (-2177.535) (-2178.151) -- 0:01:40
      687000 -- (-2180.549) (-2185.581) [-2170.188] (-2171.694) * [-2169.912] (-2176.614) (-2172.340) (-2178.065) -- 0:01:40
      687500 -- [-2173.186] (-2175.860) (-2174.791) (-2171.617) * [-2171.582] (-2177.868) (-2173.344) (-2180.809) -- 0:01:40
      688000 -- (-2173.332) (-2173.810) (-2170.808) [-2172.706] * (-2178.611) (-2178.907) [-2173.644] (-2179.945) -- 0:01:39
      688500 -- (-2169.856) (-2172.682) (-2169.165) [-2170.996] * (-2172.850) (-2174.358) (-2170.941) [-2168.892] -- 0:01:39
      689000 -- (-2175.808) (-2172.700) [-2173.267] (-2189.087) * (-2175.366) (-2172.012) [-2173.929] (-2175.626) -- 0:01:39
      689500 -- [-2172.366] (-2175.042) (-2180.003) (-2168.672) * (-2173.568) [-2175.889] (-2170.682) (-2177.152) -- 0:01:39
      690000 -- (-2170.032) (-2173.963) (-2172.229) [-2176.992] * [-2171.912] (-2177.576) (-2175.480) (-2174.736) -- 0:01:39

      Average standard deviation of split frequencies: 0.002218

      690500 -- [-2168.379] (-2170.062) (-2174.400) (-2177.225) * (-2176.192) [-2172.115] (-2174.663) (-2177.293) -- 0:01:39
      691000 -- (-2173.228) (-2175.280) (-2174.840) [-2175.452] * (-2181.256) (-2174.077) (-2175.520) [-2182.668] -- 0:01:38
      691500 -- (-2174.006) (-2189.599) [-2170.763] (-2174.262) * (-2186.334) [-2173.726] (-2173.304) (-2186.449) -- 0:01:38
      692000 -- (-2171.983) (-2172.455) (-2171.313) [-2175.827] * (-2172.956) [-2175.694] (-2177.314) (-2183.329) -- 0:01:38
      692500 -- (-2176.834) (-2179.168) [-2177.769] (-2173.517) * (-2176.572) [-2169.398] (-2171.686) (-2174.454) -- 0:01:38
      693000 -- (-2178.823) (-2172.508) [-2174.734] (-2173.738) * [-2173.754] (-2170.054) (-2174.962) (-2178.862) -- 0:01:38
      693500 -- [-2177.037] (-2186.700) (-2172.652) (-2173.213) * (-2171.925) (-2177.979) [-2172.786] (-2172.627) -- 0:01:38
      694000 -- (-2170.756) (-2175.854) (-2174.238) [-2175.268] * (-2174.981) (-2177.790) [-2172.102] (-2173.855) -- 0:01:37
      694500 -- (-2181.819) (-2176.731) [-2172.997] (-2174.208) * [-2176.915] (-2177.749) (-2177.374) (-2169.813) -- 0:01:37
      695000 -- [-2170.730] (-2177.374) (-2170.923) (-2171.472) * [-2168.644] (-2169.994) (-2173.553) (-2172.037) -- 0:01:37

      Average standard deviation of split frequencies: 0.002371

      695500 -- (-2174.937) [-2175.127] (-2172.820) (-2179.395) * (-2181.067) (-2171.821) [-2174.240] (-2176.824) -- 0:01:37
      696000 -- (-2171.182) (-2169.480) (-2173.954) [-2176.113] * (-2175.309) (-2177.001) [-2171.682] (-2182.260) -- 0:01:37
      696500 -- (-2175.809) (-2177.682) (-2180.818) [-2173.854] * (-2170.526) [-2170.676] (-2174.699) (-2174.985) -- 0:01:37
      697000 -- (-2178.589) (-2172.010) [-2171.726] (-2177.391) * [-2174.315] (-2172.566) (-2176.300) (-2181.854) -- 0:01:36
      697500 -- (-2176.456) (-2172.768) [-2174.184] (-2171.588) * (-2172.878) [-2169.393] (-2182.363) (-2174.286) -- 0:01:36
      698000 -- (-2176.586) (-2177.133) [-2173.566] (-2169.993) * (-2174.295) (-2179.880) (-2174.618) [-2172.642] -- 0:01:36
      698500 -- (-2169.638) [-2173.075] (-2177.411) (-2183.256) * (-2169.816) (-2178.738) [-2182.260] (-2176.628) -- 0:01:36
      699000 -- (-2171.893) (-2173.500) [-2180.515] (-2179.783) * (-2172.993) (-2176.452) [-2170.842] (-2172.110) -- 0:01:36
      699500 -- [-2173.804] (-2177.330) (-2174.619) (-2174.121) * (-2176.643) (-2177.406) (-2179.964) [-2171.528] -- 0:01:36
      700000 -- [-2174.137] (-2171.560) (-2171.328) (-2174.656) * (-2170.872) (-2173.383) [-2174.963] (-2171.019) -- 0:01:36

      Average standard deviation of split frequencies: 0.002859

      700500 -- [-2179.014] (-2170.585) (-2174.476) (-2175.794) * [-2175.765] (-2170.173) (-2176.537) (-2180.741) -- 0:01:35
      701000 -- (-2175.582) [-2171.253] (-2183.533) (-2170.641) * (-2179.387) [-2172.362] (-2171.908) (-2180.147) -- 0:01:35
      701500 -- (-2175.865) [-2173.290] (-2175.634) (-2177.481) * (-2177.878) (-2170.330) (-2168.807) [-2168.187] -- 0:01:35
      702000 -- [-2171.053] (-2174.585) (-2175.790) (-2172.292) * [-2172.901] (-2176.177) (-2173.448) (-2173.518) -- 0:01:35
      702500 -- (-2171.878) (-2172.528) (-2179.038) [-2173.222] * (-2173.931) (-2178.955) [-2173.094] (-2170.683) -- 0:01:35
      703000 -- (-2171.566) (-2173.892) [-2174.805] (-2177.111) * (-2181.185) [-2175.315] (-2180.939) (-2176.482) -- 0:01:35
      703500 -- [-2170.190] (-2173.286) (-2176.032) (-2174.142) * (-2174.342) (-2176.560) [-2171.755] (-2177.486) -- 0:01:34
      704000 -- [-2173.100] (-2167.480) (-2177.974) (-2169.980) * (-2176.942) (-2171.802) [-2173.107] (-2181.601) -- 0:01:34
      704500 -- (-2178.080) (-2171.476) (-2175.706) [-2171.884] * [-2169.318] (-2174.878) (-2170.418) (-2174.056) -- 0:01:34
      705000 -- [-2175.379] (-2171.485) (-2178.910) (-2171.031) * [-2176.447] (-2172.604) (-2178.282) (-2175.144) -- 0:01:34

      Average standard deviation of split frequencies: 0.004140

      705500 -- [-2172.099] (-2169.866) (-2167.393) (-2173.125) * (-2169.041) (-2172.341) [-2175.180] (-2181.616) -- 0:01:34
      706000 -- (-2180.521) [-2173.973] (-2185.564) (-2173.790) * (-2174.739) (-2171.716) (-2174.932) [-2171.717] -- 0:01:34
      706500 -- (-2177.662) (-2177.745) [-2178.648] (-2177.324) * (-2173.280) (-2176.685) [-2176.535] (-2177.559) -- 0:01:33
      707000 -- [-2175.760] (-2174.260) (-2172.000) (-2174.673) * [-2173.886] (-2179.722) (-2176.857) (-2175.414) -- 0:01:33
      707500 -- (-2174.491) (-2170.091) (-2174.223) [-2173.303] * (-2174.735) [-2171.172] (-2187.624) (-2177.668) -- 0:01:33
      708000 -- (-2176.036) (-2171.548) [-2172.434] (-2178.720) * (-2170.877) (-2173.775) [-2179.299] (-2172.478) -- 0:01:33
      708500 -- (-2176.491) (-2180.655) (-2170.577) [-2180.131] * [-2170.612] (-2175.986) (-2179.072) (-2178.119) -- 0:01:33
      709000 -- (-2182.031) (-2175.122) [-2171.053] (-2171.872) * [-2171.023] (-2178.825) (-2177.864) (-2177.571) -- 0:01:33
      709500 -- (-2187.561) [-2172.611] (-2170.120) (-2175.183) * (-2173.368) [-2175.219] (-2173.941) (-2179.446) -- 0:01:32
      710000 -- (-2184.578) [-2166.155] (-2172.939) (-2173.947) * (-2179.767) (-2172.152) [-2176.631] (-2175.227) -- 0:01:32

      Average standard deviation of split frequencies: 0.003715

      710500 -- (-2178.385) (-2169.181) (-2184.855) [-2169.770] * (-2176.502) [-2174.534] (-2174.596) (-2178.652) -- 0:01:32
      711000 -- (-2176.769) [-2173.007] (-2170.995) (-2174.935) * (-2173.179) [-2172.064] (-2177.636) (-2175.999) -- 0:01:32
      711500 -- (-2180.489) (-2171.933) [-2177.134] (-2176.700) * (-2178.625) [-2175.469] (-2173.433) (-2177.974) -- 0:01:32
      712000 -- [-2176.437] (-2174.259) (-2177.644) (-2168.693) * (-2170.253) (-2169.870) [-2179.233] (-2178.101) -- 0:01:32
      712500 -- (-2175.842) [-2174.462] (-2181.576) (-2174.578) * (-2172.455) [-2170.322] (-2173.812) (-2176.594) -- 0:01:32
      713000 -- (-2175.735) (-2178.981) (-2174.217) [-2167.827] * (-2171.853) (-2178.122) (-2186.317) [-2175.706] -- 0:01:31
      713500 -- [-2166.901] (-2178.627) (-2178.609) (-2172.951) * (-2175.995) (-2177.567) [-2169.683] (-2175.670) -- 0:01:31
      714000 -- (-2174.245) (-2176.547) [-2178.011] (-2177.525) * [-2172.258] (-2172.459) (-2176.885) (-2170.319) -- 0:01:31
      714500 -- (-2170.016) (-2178.531) [-2176.258] (-2172.227) * (-2173.316) (-2175.262) (-2184.122) [-2173.266] -- 0:01:31
      715000 -- [-2170.762] (-2178.382) (-2178.951) (-2174.335) * (-2173.253) (-2175.948) (-2178.377) [-2178.984] -- 0:01:31

      Average standard deviation of split frequencies: 0.002798

      715500 -- (-2171.841) [-2170.149] (-2172.304) (-2169.821) * (-2178.210) (-2174.547) (-2179.626) [-2171.463] -- 0:01:31
      716000 -- (-2176.115) (-2170.358) (-2173.281) [-2173.067] * (-2167.838) (-2183.806) (-2179.927) [-2171.092] -- 0:01:30
      716500 -- (-2175.834) (-2182.641) [-2167.834] (-2171.437) * (-2184.325) (-2179.169) (-2174.900) [-2169.201] -- 0:01:30
      717000 -- (-2174.351) (-2182.174) (-2172.585) [-2174.914] * (-2177.378) [-2169.425] (-2182.428) (-2170.588) -- 0:01:30
      717500 -- (-2178.521) (-2172.599) (-2175.792) [-2178.117] * (-2177.495) (-2171.454) (-2174.262) [-2176.568] -- 0:01:30
      718000 -- (-2175.365) (-2181.014) [-2175.621] (-2171.607) * (-2175.179) (-2170.791) (-2174.029) [-2174.926] -- 0:01:30
      718500 -- (-2184.308) [-2172.516] (-2183.073) (-2174.862) * (-2175.100) [-2167.907] (-2173.432) (-2176.325) -- 0:01:30
      719000 -- (-2171.774) (-2174.887) [-2171.526] (-2175.225) * (-2178.565) [-2174.686] (-2180.922) (-2174.231) -- 0:01:29
      719500 -- (-2170.521) [-2174.895] (-2185.526) (-2174.595) * [-2171.026] (-2180.576) (-2189.295) (-2170.972) -- 0:01:29
      720000 -- (-2181.846) [-2173.276] (-2176.186) (-2178.264) * (-2184.307) (-2176.337) [-2175.998] (-2172.671) -- 0:01:29

      Average standard deviation of split frequencies: 0.003663

      720500 -- (-2184.569) (-2175.532) (-2179.262) [-2173.342] * (-2173.462) (-2171.151) [-2171.521] (-2175.173) -- 0:01:29
      721000 -- [-2174.265] (-2176.083) (-2169.708) (-2173.327) * (-2172.484) (-2172.062) [-2172.344] (-2177.826) -- 0:01:29
      721500 -- (-2179.832) (-2180.942) [-2170.289] (-2169.266) * (-2179.271) (-2172.073) (-2172.950) [-2174.852] -- 0:01:29
      722000 -- (-2172.621) [-2175.255] (-2178.079) (-2169.621) * [-2173.237] (-2168.765) (-2169.909) (-2180.231) -- 0:01:28
      722500 -- [-2182.214] (-2179.630) (-2173.845) (-2172.705) * (-2181.397) [-2169.404] (-2172.920) (-2180.738) -- 0:01:28
      723000 -- (-2173.594) (-2175.121) (-2172.352) [-2169.933] * (-2177.312) (-2170.571) (-2170.194) [-2171.694] -- 0:01:28
      723500 -- (-2182.172) (-2173.086) [-2174.410] (-2171.493) * (-2176.052) (-2170.079) [-2173.117] (-2176.339) -- 0:01:28
      724000 -- [-2172.613] (-2178.576) (-2178.555) (-2175.011) * (-2176.917) (-2175.703) (-2173.870) [-2173.844] -- 0:01:28
      724500 -- (-2171.300) [-2175.790] (-2179.565) (-2179.061) * (-2181.541) (-2174.214) [-2177.481] (-2176.792) -- 0:01:28
      725000 -- (-2171.284) [-2175.423] (-2169.939) (-2182.147) * [-2169.828] (-2183.003) (-2171.361) (-2176.599) -- 0:01:28

      Average standard deviation of split frequencies: 0.003506

      725500 -- [-2173.637] (-2177.906) (-2172.834) (-2187.136) * [-2184.032] (-2185.162) (-2171.977) (-2180.324) -- 0:01:27
      726000 -- (-2173.182) (-2177.024) [-2178.126] (-2177.176) * (-2173.474) (-2175.228) [-2173.371] (-2181.295) -- 0:01:27
      726500 -- (-2183.099) [-2174.726] (-2178.991) (-2172.772) * (-2172.302) (-2183.913) [-2174.855] (-2173.251) -- 0:01:27
      727000 -- [-2175.167] (-2171.049) (-2181.813) (-2175.974) * (-2175.378) [-2177.649] (-2179.703) (-2173.204) -- 0:01:27
      727500 -- (-2175.366) (-2176.668) [-2173.440] (-2174.921) * (-2173.884) [-2175.989] (-2173.712) (-2169.445) -- 0:01:27
      728000 -- (-2169.173) (-2175.165) (-2177.181) [-2174.025] * (-2171.907) (-2181.539) (-2172.224) [-2172.511] -- 0:01:27
      728500 -- (-2172.784) [-2168.036] (-2171.952) (-2178.028) * [-2178.289] (-2178.561) (-2172.764) (-2176.155) -- 0:01:26
      729000 -- (-2171.772) (-2175.617) [-2172.164] (-2174.968) * [-2173.129] (-2180.734) (-2177.198) (-2174.164) -- 0:01:26
      729500 -- (-2172.695) [-2173.642] (-2175.210) (-2176.641) * [-2176.242] (-2185.009) (-2176.029) (-2174.826) -- 0:01:26
      730000 -- [-2170.063] (-2173.008) (-2172.108) (-2172.616) * (-2183.859) [-2173.970] (-2173.829) (-2173.711) -- 0:01:26

      Average standard deviation of split frequencies: 0.003355

      730500 -- (-2173.527) (-2174.667) (-2175.949) [-2171.876] * [-2173.259] (-2178.233) (-2174.065) (-2180.524) -- 0:01:26
      731000 -- (-2178.747) (-2179.813) (-2170.454) [-2170.520] * (-2179.649) (-2173.869) [-2176.880] (-2188.507) -- 0:01:26
      731500 -- (-2174.462) [-2175.457] (-2184.263) (-2174.541) * (-2175.854) [-2170.486] (-2176.131) (-2176.254) -- 0:01:25
      732000 -- (-2176.570) (-2179.104) (-2174.067) [-2175.891] * [-2176.126] (-2172.658) (-2183.836) (-2172.238) -- 0:01:25
      732500 -- [-2171.778] (-2171.901) (-2174.392) (-2172.887) * (-2172.375) (-2170.666) [-2182.366] (-2171.301) -- 0:01:25
      733000 -- (-2171.999) (-2176.812) [-2178.588] (-2182.483) * (-2182.560) (-2172.179) (-2174.178) [-2172.621] -- 0:01:25
      733500 -- (-2174.950) [-2170.760] (-2175.008) (-2176.226) * (-2171.181) (-2178.322) (-2177.804) [-2174.084] -- 0:01:25
      734000 -- [-2171.602] (-2182.413) (-2177.827) (-2173.848) * (-2176.173) [-2173.701] (-2177.864) (-2177.201) -- 0:01:25
      734500 -- (-2181.043) (-2170.935) (-2176.466) [-2179.184] * (-2173.828) (-2177.186) [-2167.799] (-2170.936) -- 0:01:24
      735000 -- [-2168.123] (-2170.161) (-2174.377) (-2174.265) * [-2174.308] (-2177.064) (-2177.709) (-2174.867) -- 0:01:24

      Average standard deviation of split frequencies: 0.003971

      735500 -- (-2170.463) [-2176.580] (-2174.374) (-2184.888) * (-2177.556) [-2177.656] (-2175.564) (-2183.530) -- 0:01:24
      736000 -- (-2172.451) [-2172.689] (-2174.009) (-2182.753) * (-2179.185) [-2176.974] (-2181.580) (-2168.738) -- 0:01:24
      736500 -- (-2179.930) [-2171.968] (-2173.526) (-2170.263) * (-2170.523) [-2171.152] (-2181.049) (-2175.708) -- 0:01:24
      737000 -- (-2179.188) (-2172.540) [-2172.692] (-2174.350) * [-2173.472] (-2175.528) (-2177.402) (-2177.257) -- 0:01:24
      737500 -- [-2171.805] (-2173.715) (-2173.125) (-2177.068) * (-2178.608) (-2174.445) (-2172.134) [-2176.830] -- 0:01:24
      738000 -- (-2184.148) [-2170.928] (-2171.599) (-2171.312) * [-2176.535] (-2176.041) (-2174.038) (-2190.652) -- 0:01:23
      738500 -- (-2176.914) (-2175.211) (-2176.067) [-2171.112] * (-2172.134) [-2177.951] (-2177.494) (-2185.223) -- 0:01:23
      739000 -- (-2181.189) (-2176.203) (-2177.059) [-2171.888] * (-2180.243) (-2177.682) (-2175.911) [-2172.808] -- 0:01:23
      739500 -- (-2179.689) [-2168.832] (-2172.603) (-2170.785) * (-2170.852) (-2169.226) [-2172.959] (-2178.155) -- 0:01:23
      740000 -- (-2180.049) (-2173.188) (-2184.747) [-2175.974] * (-2173.323) (-2170.592) (-2177.525) [-2175.204] -- 0:01:23

      Average standard deviation of split frequencies: 0.003437

      740500 -- (-2183.593) (-2176.040) (-2172.329) [-2175.507] * (-2183.726) [-2171.954] (-2168.552) (-2173.855) -- 0:01:23
      741000 -- (-2177.836) (-2179.749) [-2172.456] (-2175.859) * (-2170.424) [-2172.319] (-2181.644) (-2172.043) -- 0:01:22
      741500 -- (-2174.898) (-2175.324) (-2173.649) [-2169.881] * (-2175.702) (-2172.604) [-2173.345] (-2172.137) -- 0:01:22
      742000 -- (-2179.733) [-2172.817] (-2180.164) (-2174.966) * [-2172.161] (-2167.429) (-2175.286) (-2180.708) -- 0:01:22
      742500 -- (-2177.503) [-2174.048] (-2181.719) (-2177.629) * (-2182.524) (-2178.887) [-2176.518] (-2177.117) -- 0:01:22
      743000 -- (-2182.777) [-2182.500] (-2172.989) (-2173.834) * (-2171.947) [-2171.494] (-2174.482) (-2174.174) -- 0:01:22
      743500 -- (-2170.453) (-2174.491) (-2178.233) [-2172.335] * (-2173.854) [-2171.276] (-2177.519) (-2166.383) -- 0:01:22
      744000 -- [-2178.163] (-2181.460) (-2177.961) (-2173.827) * (-2176.436) (-2171.036) (-2174.876) [-2179.008] -- 0:01:21
      744500 -- (-2181.693) [-2176.425] (-2184.123) (-2174.671) * [-2169.894] (-2172.944) (-2173.074) (-2182.345) -- 0:01:21
      745000 -- [-2173.722] (-2176.028) (-2173.479) (-2174.655) * (-2173.019) (-2177.064) (-2176.698) [-2181.229] -- 0:01:21

      Average standard deviation of split frequencies: 0.003665

      745500 -- (-2176.377) (-2174.989) [-2173.381] (-2175.424) * [-2173.419] (-2170.379) (-2179.030) (-2178.580) -- 0:01:21
      746000 -- (-2176.644) (-2167.905) (-2177.527) [-2175.203] * [-2171.812] (-2171.979) (-2174.542) (-2169.203) -- 0:01:21
      746500 -- (-2180.583) [-2174.032] (-2176.484) (-2172.124) * [-2168.795] (-2181.062) (-2175.460) (-2173.630) -- 0:01:21
      747000 -- (-2178.948) (-2171.571) [-2175.717] (-2175.434) * (-2176.842) [-2171.359] (-2167.947) (-2176.176) -- 0:01:20
      747500 -- (-2173.503) [-2177.112] (-2180.132) (-2174.563) * (-2171.558) (-2183.176) [-2175.984] (-2179.406) -- 0:01:20
      748000 -- [-2169.878] (-2179.197) (-2174.061) (-2172.116) * [-2168.928] (-2174.215) (-2175.130) (-2186.231) -- 0:01:20
      748500 -- (-2175.316) (-2177.526) [-2170.991] (-2174.432) * (-2170.609) (-2171.506) [-2178.524] (-2182.504) -- 0:01:20
      749000 -- (-2177.996) (-2174.800) (-2173.777) [-2171.727] * [-2170.976] (-2174.994) (-2172.578) (-2177.169) -- 0:01:20
      749500 -- (-2178.080) (-2169.537) (-2178.982) [-2168.785] * (-2175.923) [-2171.447] (-2180.185) (-2180.601) -- 0:01:20
      750000 -- (-2176.456) [-2180.615] (-2176.541) (-2172.680) * (-2172.759) (-2175.825) (-2173.667) [-2173.746] -- 0:01:20

      Average standard deviation of split frequencies: 0.003014

      750500 -- [-2181.576] (-2175.487) (-2178.211) (-2174.414) * (-2176.338) (-2171.132) [-2173.706] (-2179.009) -- 0:01:19
      751000 -- [-2175.634] (-2175.595) (-2171.276) (-2173.382) * (-2175.677) [-2177.977] (-2176.433) (-2176.653) -- 0:01:19
      751500 -- (-2184.093) (-2174.878) (-2178.790) [-2172.657] * [-2168.731] (-2180.621) (-2178.211) (-2180.065) -- 0:01:19
      752000 -- (-2179.224) (-2170.175) [-2168.808] (-2173.889) * (-2173.171) (-2169.948) (-2173.445) [-2172.190] -- 0:01:19
      752500 -- [-2176.401] (-2174.870) (-2168.750) (-2179.378) * (-2184.554) (-2173.889) [-2170.787] (-2173.550) -- 0:01:19
      753000 -- [-2172.788] (-2174.157) (-2172.987) (-2177.725) * (-2173.942) [-2172.301] (-2174.569) (-2185.136) -- 0:01:19
      753500 -- (-2174.117) (-2167.997) [-2175.823] (-2169.997) * [-2176.074] (-2180.696) (-2172.701) (-2179.538) -- 0:01:18
      754000 -- (-2177.282) (-2180.936) [-2168.139] (-2171.210) * (-2180.376) (-2169.613) [-2173.135] (-2172.297) -- 0:01:18
      754500 -- (-2178.269) [-2170.696] (-2179.774) (-2179.124) * (-2174.836) (-2176.794) (-2174.125) [-2172.852] -- 0:01:18
      755000 -- (-2177.197) (-2180.968) (-2173.309) [-2180.015] * (-2169.863) (-2173.802) (-2176.920) [-2171.314] -- 0:01:18

      Average standard deviation of split frequencies: 0.002868

      755500 -- (-2174.100) (-2171.738) (-2180.277) [-2172.517] * (-2177.154) (-2176.230) (-2175.190) [-2175.310] -- 0:01:18
      756000 -- (-2175.918) (-2170.845) (-2175.055) [-2169.720] * [-2170.372] (-2171.194) (-2177.505) (-2175.571) -- 0:01:18
      756500 -- (-2176.440) [-2183.192] (-2166.447) (-2176.581) * (-2172.245) (-2177.354) (-2171.249) [-2175.593] -- 0:01:17
      757000 -- (-2187.480) (-2175.745) [-2177.721] (-2174.365) * [-2167.388] (-2176.002) (-2172.723) (-2173.932) -- 0:01:17
      757500 -- (-2172.430) (-2172.353) [-2171.515] (-2174.779) * (-2167.716) (-2176.562) (-2174.550) [-2168.226] -- 0:01:17
      758000 -- (-2180.442) (-2171.787) [-2169.027] (-2174.859) * (-2180.865) (-2176.861) [-2170.860] (-2169.868) -- 0:01:17
      758500 -- (-2180.756) (-2173.165) (-2173.671) [-2174.534] * (-2181.720) [-2169.388] (-2177.442) (-2179.527) -- 0:01:17
      759000 -- (-2179.925) (-2169.269) [-2181.154] (-2173.407) * (-2177.795) [-2174.679] (-2177.199) (-2172.837) -- 0:01:17
      759500 -- (-2175.121) [-2167.808] (-2178.960) (-2172.018) * (-2174.594) (-2183.584) (-2168.055) [-2170.597] -- 0:01:16
      760000 -- (-2173.873) [-2168.706] (-2173.688) (-2176.021) * (-2192.978) (-2174.687) (-2177.269) [-2171.182] -- 0:01:16

      Average standard deviation of split frequencies: 0.002851

      760500 -- (-2175.542) (-2171.193) [-2168.834] (-2184.649) * (-2171.416) [-2175.843] (-2179.093) (-2174.974) -- 0:01:16
      761000 -- (-2169.756) [-2176.673] (-2182.153) (-2175.097) * (-2170.909) (-2173.279) [-2172.266] (-2172.991) -- 0:01:16
      761500 -- (-2176.948) (-2184.362) (-2172.768) [-2175.979] * [-2179.797] (-2177.678) (-2174.944) (-2173.034) -- 0:01:16
      762000 -- [-2174.734] (-2178.140) (-2174.726) (-2169.767) * (-2172.953) (-2180.382) [-2170.563] (-2173.511) -- 0:01:16
      762500 -- (-2174.265) [-2177.091] (-2171.521) (-2174.291) * (-2174.975) (-2176.503) [-2174.432] (-2175.248) -- 0:01:16
      763000 -- (-2173.529) [-2174.384] (-2176.245) (-2175.447) * [-2177.589] (-2177.869) (-2173.704) (-2174.229) -- 0:01:15
      763500 -- (-2175.761) (-2175.909) (-2174.446) [-2174.074] * [-2170.967] (-2178.729) (-2172.093) (-2179.196) -- 0:01:15
      764000 -- [-2170.751] (-2170.346) (-2172.009) (-2171.267) * (-2173.556) [-2175.676] (-2175.700) (-2183.865) -- 0:01:15
      764500 -- (-2168.859) [-2175.758] (-2173.812) (-2181.181) * (-2174.707) (-2170.695) (-2173.720) [-2176.258] -- 0:01:15
      765000 -- (-2175.010) (-2173.677) [-2169.779] (-2173.704) * [-2174.261] (-2178.524) (-2173.425) (-2171.816) -- 0:01:15

      Average standard deviation of split frequencies: 0.002954

      765500 -- (-2175.291) [-2171.542] (-2174.383) (-2171.769) * [-2172.300] (-2181.942) (-2169.410) (-2175.116) -- 0:01:15
      766000 -- (-2173.681) (-2169.983) (-2179.401) [-2171.676] * (-2180.112) (-2179.358) [-2170.931] (-2173.624) -- 0:01:14
      766500 -- (-2171.040) (-2173.574) (-2176.519) [-2180.774] * (-2176.663) (-2180.285) [-2169.788] (-2180.701) -- 0:01:14
      767000 -- (-2182.129) [-2171.178] (-2176.386) (-2172.356) * (-2173.386) (-2177.858) [-2179.957] (-2174.060) -- 0:01:14
      767500 -- (-2183.603) (-2173.769) [-2175.367] (-2180.552) * [-2174.593] (-2176.871) (-2172.929) (-2169.929) -- 0:01:14
      768000 -- [-2174.549] (-2172.192) (-2170.758) (-2174.455) * (-2173.882) (-2179.844) [-2173.000] (-2169.072) -- 0:01:14
      768500 -- (-2174.448) [-2171.939] (-2173.236) (-2174.193) * (-2184.286) (-2175.038) (-2175.649) [-2171.026] -- 0:01:14
      769000 -- [-2179.530] (-2175.155) (-2174.196) (-2180.237) * [-2175.929] (-2175.292) (-2170.641) (-2172.174) -- 0:01:13
      769500 -- (-2181.694) [-2181.445] (-2171.590) (-2173.982) * (-2174.860) (-2175.762) [-2174.671] (-2173.334) -- 0:01:13
      770000 -- (-2177.970) (-2183.799) (-2175.251) [-2176.936] * (-2174.637) [-2173.786] (-2173.623) (-2176.219) -- 0:01:13

      Average standard deviation of split frequencies: 0.002569

      770500 -- (-2173.283) (-2174.514) [-2174.200] (-2174.603) * [-2174.521] (-2183.889) (-2169.576) (-2176.590) -- 0:01:13
      771000 -- (-2173.873) [-2176.473] (-2170.350) (-2174.222) * [-2172.421] (-2175.682) (-2170.371) (-2178.619) -- 0:01:13
      771500 -- [-2173.941] (-2172.066) (-2169.624) (-2174.836) * [-2173.603] (-2171.430) (-2177.621) (-2176.761) -- 0:01:13
      772000 -- (-2174.133) (-2174.365) [-2171.879] (-2169.907) * (-2177.781) (-2172.973) [-2174.109] (-2172.385) -- 0:01:12
      772500 -- [-2174.351] (-2172.351) (-2178.842) (-2173.203) * (-2176.131) [-2172.765] (-2175.780) (-2179.964) -- 0:01:12
      773000 -- [-2176.853] (-2178.695) (-2172.867) (-2180.558) * [-2176.680] (-2177.159) (-2176.141) (-2174.013) -- 0:01:12
      773500 -- (-2184.562) (-2178.449) (-2170.397) [-2176.450] * [-2169.156] (-2175.197) (-2180.878) (-2172.266) -- 0:01:12
      774000 -- [-2177.049] (-2176.765) (-2174.093) (-2181.967) * (-2176.413) [-2168.733] (-2174.867) (-2174.358) -- 0:01:12
      774500 -- (-2176.598) [-2174.025] (-2169.073) (-2185.040) * (-2174.352) (-2176.982) (-2178.718) [-2177.192] -- 0:01:12
      775000 -- (-2174.127) (-2179.259) (-2168.455) [-2173.299] * (-2179.088) (-2183.201) [-2176.776] (-2178.895) -- 0:01:12

      Average standard deviation of split frequencies: 0.003037

      775500 -- (-2173.154) (-2182.914) (-2170.908) [-2174.445] * (-2175.436) (-2174.587) (-2186.955) [-2170.219] -- 0:01:11
      776000 -- (-2179.912) (-2174.200) (-2171.992) [-2169.792] * (-2177.934) (-2170.741) [-2180.890] (-2173.674) -- 0:01:11
      776500 -- (-2184.553) [-2174.785] (-2177.431) (-2177.092) * (-2180.524) (-2173.095) [-2174.764] (-2171.801) -- 0:01:11
      777000 -- (-2173.010) (-2186.869) (-2173.579) [-2173.463] * (-2167.573) (-2172.447) [-2175.859] (-2174.472) -- 0:01:11
      777500 -- (-2180.677) (-2174.027) (-2175.409) [-2170.247] * (-2177.005) (-2176.355) (-2181.442) [-2172.755] -- 0:01:11
      778000 -- (-2174.970) [-2172.999] (-2176.562) (-2169.323) * (-2179.984) (-2183.317) [-2172.812] (-2178.750) -- 0:01:11
      778500 -- (-2170.708) (-2182.927) (-2174.919) [-2174.054] * [-2169.662] (-2170.459) (-2175.627) (-2173.334) -- 0:01:10
      779000 -- [-2174.792] (-2181.790) (-2181.760) (-2177.943) * (-2171.364) [-2175.316] (-2173.331) (-2181.510) -- 0:01:10
      779500 -- [-2170.469] (-2170.976) (-2174.367) (-2175.923) * [-2171.191] (-2171.238) (-2183.422) (-2188.160) -- 0:01:10
      780000 -- (-2182.015) [-2172.823] (-2177.293) (-2175.090) * (-2176.830) (-2173.323) [-2173.847] (-2185.837) -- 0:01:10

      Average standard deviation of split frequencies: 0.002898

      780500 -- (-2176.856) (-2176.487) [-2174.425] (-2180.966) * (-2170.454) [-2167.996] (-2176.334) (-2189.946) -- 0:01:10
      781000 -- [-2178.496] (-2169.547) (-2171.079) (-2175.244) * (-2174.235) [-2175.184] (-2171.079) (-2187.378) -- 0:01:10
      781500 -- (-2175.951) [-2176.544] (-2175.544) (-2176.917) * (-2174.741) [-2170.746] (-2175.244) (-2184.628) -- 0:01:09
      782000 -- (-2183.278) (-2173.847) [-2173.894] (-2174.632) * (-2169.182) (-2173.597) [-2178.745] (-2188.997) -- 0:01:09
      782500 -- (-2176.221) [-2172.551] (-2176.062) (-2173.468) * [-2171.752] (-2167.749) (-2175.987) (-2175.838) -- 0:01:09
      783000 -- (-2169.249) (-2171.892) (-2174.497) [-2173.805] * [-2170.546] (-2175.656) (-2176.266) (-2179.227) -- 0:01:09
      783500 -- (-2171.959) [-2176.064] (-2175.994) (-2173.639) * (-2176.870) (-2171.110) (-2184.427) [-2172.132] -- 0:01:09
      784000 -- (-2177.435) [-2171.275] (-2175.867) (-2171.894) * [-2174.953] (-2170.404) (-2173.951) (-2173.189) -- 0:01:09
      784500 -- [-2176.230] (-2177.094) (-2169.091) (-2171.119) * (-2178.890) (-2173.165) (-2173.679) [-2179.304] -- 0:01:08
      785000 -- [-2171.887] (-2183.548) (-2171.811) (-2171.915) * (-2175.985) [-2170.152] (-2174.075) (-2175.815) -- 0:01:08

      Average standard deviation of split frequencies: 0.003479

      785500 -- [-2175.438] (-2177.755) (-2176.923) (-2174.234) * [-2176.214] (-2178.093) (-2179.182) (-2172.592) -- 0:01:08
      786000 -- (-2172.862) [-2170.749] (-2169.222) (-2174.484) * [-2180.967] (-2172.259) (-2173.962) (-2172.908) -- 0:01:08
      786500 -- (-2176.753) (-2177.375) (-2177.628) [-2170.757] * [-2174.540] (-2175.788) (-2171.302) (-2169.244) -- 0:01:08
      787000 -- (-2177.618) (-2175.056) [-2175.170] (-2175.566) * (-2174.575) (-2176.098) [-2172.459] (-2173.681) -- 0:01:08
      787500 -- [-2172.979] (-2181.062) (-2169.743) (-2174.281) * (-2174.566) (-2178.107) [-2174.671] (-2175.807) -- 0:01:08
      788000 -- (-2172.954) [-2171.997] (-2178.534) (-2170.810) * (-2177.090) (-2175.353) [-2175.291] (-2172.813) -- 0:01:07
      788500 -- (-2174.807) (-2171.778) [-2169.768] (-2177.396) * (-2173.022) (-2178.470) (-2170.270) [-2176.424] -- 0:01:07
      789000 -- (-2174.821) [-2170.576] (-2176.686) (-2187.319) * (-2179.717) [-2173.707] (-2178.816) (-2171.383) -- 0:01:07
      789500 -- (-2175.896) (-2181.940) (-2191.574) [-2176.133] * [-2171.791] (-2174.931) (-2170.673) (-2174.653) -- 0:01:07
      790000 -- [-2175.065] (-2173.740) (-2176.902) (-2169.373) * (-2175.038) (-2169.531) [-2170.126] (-2173.948) -- 0:01:07

      Average standard deviation of split frequencies: 0.003339

      790500 -- (-2179.373) (-2175.510) (-2181.834) [-2172.811] * (-2179.435) (-2173.183) (-2170.280) [-2170.815] -- 0:01:07
      791000 -- (-2176.896) (-2175.226) [-2175.270] (-2168.691) * [-2176.920] (-2176.175) (-2171.765) (-2176.834) -- 0:01:06
      791500 -- (-2183.051) (-2178.402) (-2170.836) [-2170.504] * (-2174.884) [-2171.732] (-2180.145) (-2178.445) -- 0:01:06
      792000 -- [-2177.216] (-2173.751) (-2179.786) (-2179.060) * (-2176.752) (-2171.800) (-2170.750) [-2175.268] -- 0:01:06
      792500 -- (-2179.490) (-2172.321) [-2172.996] (-2175.047) * [-2171.733] (-2172.141) (-2171.503) (-2175.023) -- 0:01:06
      793000 -- (-2174.511) [-2169.027] (-2174.139) (-2174.407) * (-2175.395) [-2176.280] (-2172.760) (-2172.958) -- 0:01:06
      793500 -- (-2181.436) (-2176.223) (-2177.908) [-2173.763] * (-2176.633) (-2174.366) (-2171.492) [-2169.097] -- 0:01:06
      794000 -- (-2173.542) (-2179.635) (-2170.430) [-2173.569] * (-2172.578) [-2178.560] (-2173.259) (-2171.205) -- 0:01:05
      794500 -- (-2171.411) [-2175.843] (-2167.467) (-2173.555) * (-2178.012) (-2174.642) [-2171.624] (-2171.584) -- 0:01:05
      795000 -- (-2175.038) (-2174.749) [-2169.714] (-2180.388) * (-2171.358) [-2172.194] (-2174.000) (-2179.708) -- 0:01:05

      Average standard deviation of split frequencies: 0.003080

      795500 -- (-2182.801) (-2176.875) [-2175.593] (-2174.201) * (-2174.103) (-2188.002) [-2171.580] (-2173.050) -- 0:01:05
      796000 -- (-2177.133) (-2175.529) [-2170.902] (-2173.159) * (-2177.405) [-2169.323] (-2177.473) (-2175.923) -- 0:01:05
      796500 -- (-2177.844) (-2172.816) (-2172.969) [-2173.162] * (-2184.349) (-2175.704) (-2175.619) [-2179.115] -- 0:01:05
      797000 -- (-2177.119) (-2174.312) (-2172.799) [-2169.571] * (-2174.660) (-2173.875) [-2183.749] (-2180.373) -- 0:01:04
      797500 -- (-2175.480) [-2176.519] (-2171.637) (-2172.237) * (-2172.505) (-2179.282) (-2168.448) [-2171.441] -- 0:01:04
      798000 -- (-2173.840) (-2175.917) (-2178.255) [-2170.880] * (-2170.951) [-2170.631] (-2172.444) (-2174.176) -- 0:01:04
      798500 -- (-2176.059) [-2174.739] (-2170.188) (-2177.074) * (-2167.135) [-2177.052] (-2183.978) (-2177.072) -- 0:01:04
      799000 -- (-2172.223) (-2173.520) [-2171.478] (-2170.960) * [-2171.368] (-2177.981) (-2175.526) (-2173.707) -- 0:01:04
      799500 -- (-2179.847) (-2173.908) [-2172.755] (-2175.906) * (-2178.720) (-2175.182) [-2170.122] (-2169.762) -- 0:01:04
      800000 -- (-2172.192) (-2174.004) (-2170.860) [-2171.247] * (-2174.342) [-2175.188] (-2173.614) (-2178.124) -- 0:01:04

      Average standard deviation of split frequencies: 0.003533

      800500 -- (-2175.218) (-2187.589) (-2177.016) [-2175.711] * (-2170.730) (-2178.973) [-2172.891] (-2179.907) -- 0:01:03
      801000 -- (-2172.708) (-2177.785) [-2173.848] (-2174.296) * (-2177.114) (-2179.920) [-2169.200] (-2170.360) -- 0:01:03
      801500 -- (-2176.681) [-2173.348] (-2173.909) (-2177.567) * [-2182.545] (-2176.215) (-2171.854) (-2169.625) -- 0:01:03
      802000 -- (-2168.822) [-2179.187] (-2183.541) (-2170.701) * (-2170.106) (-2169.741) (-2174.323) [-2174.743] -- 0:01:03
      802500 -- (-2168.118) (-2174.441) [-2170.561] (-2173.864) * [-2176.128] (-2182.286) (-2175.272) (-2170.115) -- 0:01:03
      803000 -- (-2179.090) (-2175.334) (-2172.224) [-2170.710] * (-2179.044) (-2179.562) [-2177.369] (-2178.868) -- 0:01:03
      803500 -- (-2179.176) (-2176.148) [-2174.707] (-2170.318) * [-2179.483] (-2172.246) (-2171.961) (-2171.691) -- 0:01:02
      804000 -- (-2174.805) (-2169.588) [-2176.504] (-2178.421) * (-2179.931) (-2182.813) [-2171.061] (-2174.652) -- 0:01:02
      804500 -- (-2167.585) (-2171.547) (-2168.997) [-2176.964] * (-2178.557) [-2175.494] (-2174.028) (-2175.317) -- 0:01:02
      805000 -- [-2172.330] (-2176.548) (-2179.187) (-2179.939) * (-2175.645) (-2182.562) (-2171.449) [-2169.066] -- 0:01:02

      Average standard deviation of split frequencies: 0.003860

      805500 -- (-2178.464) (-2173.221) (-2174.539) [-2177.997] * (-2176.728) (-2176.242) (-2181.352) [-2171.810] -- 0:01:02
      806000 -- (-2169.365) [-2175.930] (-2175.518) (-2182.969) * (-2174.573) (-2172.040) [-2180.673] (-2178.147) -- 0:01:02
      806500 -- (-2171.374) [-2173.445] (-2185.624) (-2178.171) * (-2172.818) [-2173.882] (-2170.425) (-2174.046) -- 0:01:01
      807000 -- (-2169.776) (-2175.964) [-2174.364] (-2182.511) * [-2169.547] (-2170.327) (-2176.835) (-2179.625) -- 0:01:01
      807500 -- (-2173.656) [-2169.742] (-2172.453) (-2177.946) * (-2173.514) [-2176.286] (-2175.037) (-2172.869) -- 0:01:01
      808000 -- (-2172.978) (-2174.713) (-2182.876) [-2177.609] * (-2175.082) [-2169.216] (-2177.294) (-2180.709) -- 0:01:01
      808500 -- [-2172.892] (-2174.047) (-2177.640) (-2175.184) * [-2173.681] (-2180.710) (-2171.187) (-2176.654) -- 0:01:01
      809000 -- [-2174.616] (-2168.606) (-2178.112) (-2177.871) * [-2171.007] (-2169.596) (-2170.116) (-2185.357) -- 0:01:01
      809500 -- (-2174.520) [-2170.759] (-2179.123) (-2176.504) * (-2173.401) (-2170.561) [-2167.889] (-2189.445) -- 0:01:00
      810000 -- (-2183.833) (-2170.156) (-2175.903) [-2170.829] * [-2172.196] (-2170.245) (-2173.987) (-2186.869) -- 0:01:00

      Average standard deviation of split frequencies: 0.004071

      810500 -- [-2173.758] (-2172.203) (-2181.207) (-2170.866) * (-2171.653) (-2174.067) (-2177.187) [-2179.229] -- 0:01:00
      811000 -- (-2180.171) (-2174.008) (-2175.458) [-2169.645] * (-2176.354) [-2183.957] (-2168.773) (-2183.945) -- 0:01:00
      811500 -- (-2171.452) [-2174.687] (-2174.617) (-2180.332) * (-2173.612) (-2175.943) [-2178.559] (-2174.338) -- 0:01:00
      812000 -- (-2173.035) (-2173.582) (-2177.242) [-2169.951] * (-2176.114) (-2172.277) (-2176.081) [-2169.094] -- 0:01:00
      812500 -- (-2171.336) (-2187.022) (-2180.428) [-2175.896] * (-2174.107) [-2173.698] (-2172.882) (-2170.029) -- 0:01:00
      813000 -- [-2169.482] (-2173.690) (-2174.870) (-2182.398) * (-2179.351) [-2177.726] (-2176.345) (-2171.511) -- 0:00:59
      813500 -- (-2171.204) (-2175.601) (-2174.282) [-2177.498] * (-2181.622) (-2171.013) [-2175.179] (-2176.044) -- 0:00:59
      814000 -- [-2172.628] (-2174.476) (-2174.311) (-2169.854) * [-2172.709] (-2178.617) (-2171.181) (-2172.257) -- 0:00:59
      814500 -- (-2176.259) [-2178.791] (-2178.299) (-2174.408) * (-2173.891) (-2176.271) (-2173.524) [-2177.396] -- 0:00:59
      815000 -- [-2168.173] (-2174.015) (-2175.688) (-2174.017) * (-2174.564) [-2183.415] (-2172.643) (-2174.807) -- 0:00:59

      Average standard deviation of split frequencies: 0.003582

      815500 -- (-2181.975) (-2169.052) [-2172.891] (-2181.272) * (-2176.596) [-2172.108] (-2171.603) (-2181.434) -- 0:00:59
      816000 -- [-2172.048] (-2170.151) (-2171.754) (-2177.332) * [-2171.928] (-2177.127) (-2186.336) (-2186.525) -- 0:00:58
      816500 -- [-2174.288] (-2180.520) (-2172.009) (-2173.539) * (-2176.050) (-2179.116) (-2176.457) [-2181.956] -- 0:00:58
      817000 -- (-2180.191) (-2175.003) (-2172.483) [-2170.142] * (-2173.824) (-2174.033) (-2177.122) [-2172.439] -- 0:00:58
      817500 -- [-2177.269] (-2175.916) (-2172.726) (-2176.810) * (-2170.082) (-2174.042) (-2177.381) [-2170.607] -- 0:00:58
      818000 -- (-2180.353) (-2174.927) [-2179.735] (-2171.580) * (-2175.391) (-2173.390) [-2174.478] (-2170.813) -- 0:00:58
      818500 -- [-2169.298] (-2171.056) (-2172.621) (-2172.464) * (-2172.049) (-2174.112) [-2171.084] (-2172.612) -- 0:00:58
      819000 -- (-2171.898) (-2170.224) [-2180.950] (-2172.847) * [-2175.576] (-2171.854) (-2180.257) (-2181.128) -- 0:00:57
      819500 -- (-2175.724) [-2169.282] (-2177.339) (-2174.024) * (-2174.291) (-2175.565) [-2173.685] (-2176.492) -- 0:00:57
      820000 -- [-2173.183] (-2171.399) (-2176.323) (-2175.929) * (-2172.171) (-2174.036) (-2177.797) [-2173.282] -- 0:00:57

      Average standard deviation of split frequencies: 0.003446

      820500 -- (-2176.517) (-2180.661) [-2181.915] (-2169.169) * (-2176.988) (-2178.294) (-2179.410) [-2176.772] -- 0:00:57
      821000 -- (-2176.144) (-2169.993) [-2173.032] (-2172.774) * (-2172.065) (-2176.089) (-2174.036) [-2183.055] -- 0:00:57
      821500 -- [-2174.027] (-2188.044) (-2173.484) (-2176.179) * (-2172.530) (-2178.521) (-2175.506) [-2169.747] -- 0:00:57
      822000 -- (-2175.661) [-2173.744] (-2178.484) (-2179.553) * (-2174.069) [-2173.367] (-2174.400) (-2176.899) -- 0:00:56
      822500 -- (-2174.043) (-2170.812) (-2173.181) [-2182.683] * (-2182.114) [-2179.635] (-2183.201) (-2174.490) -- 0:00:56
      823000 -- (-2172.163) [-2173.806] (-2172.996) (-2179.208) * (-2179.215) (-2172.132) [-2172.061] (-2168.634) -- 0:00:56
      823500 -- (-2175.869) (-2174.247) (-2176.792) [-2179.355] * (-2170.702) [-2173.397] (-2170.720) (-2178.795) -- 0:00:56
      824000 -- (-2173.866) (-2184.300) (-2176.471) [-2176.605] * (-2177.484) [-2177.540] (-2173.958) (-2174.266) -- 0:00:56
      824500 -- [-2174.528] (-2176.886) (-2178.190) (-2168.622) * [-2172.817] (-2172.408) (-2176.135) (-2175.107) -- 0:00:56
      825000 -- [-2171.346] (-2173.878) (-2178.981) (-2176.854) * (-2177.209) (-2181.603) [-2178.002] (-2174.808) -- 0:00:56

      Average standard deviation of split frequencies: 0.003653

      825500 -- (-2174.946) (-2181.988) [-2170.076] (-2176.412) * [-2173.397] (-2177.207) (-2175.648) (-2166.238) -- 0:00:55
      826000 -- [-2167.218] (-2172.259) (-2182.658) (-2174.655) * [-2175.201] (-2174.965) (-2173.947) (-2177.319) -- 0:00:55
      826500 -- (-2177.307) (-2173.836) [-2172.054] (-2174.419) * [-2173.156] (-2174.172) (-2171.687) (-2172.975) -- 0:00:55
      827000 -- (-2177.861) (-2179.301) (-2170.985) [-2171.188] * [-2173.678] (-2176.596) (-2184.051) (-2175.495) -- 0:00:55
      827500 -- (-2176.817) [-2175.982] (-2174.849) (-2173.403) * [-2171.638] (-2175.398) (-2172.601) (-2170.654) -- 0:00:55
      828000 -- [-2174.079] (-2178.206) (-2174.016) (-2176.384) * (-2175.879) (-2170.461) (-2180.837) [-2171.356] -- 0:00:55
      828500 -- (-2172.510) (-2175.920) [-2173.266] (-2170.569) * [-2170.997] (-2185.139) (-2174.673) (-2172.429) -- 0:00:54
      829000 -- (-2174.872) (-2174.865) (-2174.890) [-2167.142] * (-2172.392) (-2175.478) (-2181.380) [-2171.633] -- 0:00:54
      829500 -- [-2174.329] (-2173.869) (-2173.586) (-2173.119) * (-2172.162) (-2178.286) [-2171.759] (-2173.102) -- 0:00:54
      830000 -- [-2183.402] (-2169.512) (-2169.039) (-2170.437) * (-2174.624) [-2174.276] (-2176.177) (-2175.340) -- 0:00:54

      Average standard deviation of split frequencies: 0.004200

      830500 -- [-2176.882] (-2178.059) (-2180.545) (-2171.048) * (-2171.850) [-2173.296] (-2168.833) (-2173.669) -- 0:00:54
      831000 -- (-2179.687) [-2171.801] (-2172.464) (-2176.068) * (-2179.325) (-2182.391) [-2168.475] (-2178.654) -- 0:00:54
      831500 -- (-2179.330) [-2172.628] (-2171.233) (-2178.819) * (-2170.071) (-2185.719) (-2174.885) [-2169.293] -- 0:00:53
      832000 -- (-2183.497) [-2171.663] (-2177.811) (-2169.476) * (-2170.132) [-2173.503] (-2180.974) (-2174.343) -- 0:00:53
      832500 -- [-2177.375] (-2175.659) (-2177.230) (-2172.828) * (-2180.272) (-2175.430) (-2171.134) [-2171.283] -- 0:00:53
      833000 -- (-2173.695) (-2168.320) (-2176.349) [-2176.404] * (-2176.731) [-2170.332] (-2169.908) (-2173.121) -- 0:00:53
      833500 -- (-2173.986) [-2176.812] (-2171.886) (-2180.071) * (-2174.388) [-2169.950] (-2176.668) (-2179.243) -- 0:00:53
      834000 -- (-2172.971) [-2176.468] (-2172.623) (-2168.027) * (-2175.078) [-2176.793] (-2177.750) (-2182.374) -- 0:00:53
      834500 -- (-2173.440) [-2173.418] (-2176.350) (-2179.329) * [-2172.018] (-2174.919) (-2172.447) (-2174.204) -- 0:00:52
      835000 -- (-2186.043) (-2166.475) [-2167.651] (-2169.293) * (-2177.150) (-2172.027) (-2172.949) [-2178.020] -- 0:00:52

      Average standard deviation of split frequencies: 0.004173

      835500 -- (-2175.998) [-2171.282] (-2173.471) (-2174.782) * (-2180.751) (-2171.879) (-2173.476) [-2173.573] -- 0:00:52
      836000 -- (-2176.749) [-2171.850] (-2166.902) (-2175.799) * (-2184.836) [-2173.031] (-2176.748) (-2174.822) -- 0:00:52
      836500 -- (-2173.170) [-2174.952] (-2166.412) (-2178.309) * (-2174.577) (-2177.367) (-2181.283) [-2177.492] -- 0:00:52
      837000 -- [-2172.956] (-2176.573) (-2172.709) (-2180.797) * (-2175.167) (-2179.688) [-2176.750] (-2180.922) -- 0:00:52
      837500 -- (-2174.658) (-2186.622) [-2173.165] (-2176.209) * (-2173.970) (-2174.294) (-2170.720) [-2180.132] -- 0:00:52
      838000 -- [-2175.053] (-2174.541) (-2170.311) (-2176.495) * (-2172.801) (-2169.991) [-2176.464] (-2175.128) -- 0:00:51
      838500 -- (-2175.966) (-2177.703) (-2178.595) [-2172.202] * [-2170.816] (-2167.602) (-2169.345) (-2180.292) -- 0:00:51
      839000 -- [-2173.336] (-2175.168) (-2176.120) (-2174.017) * (-2186.449) [-2169.282] (-2174.539) (-2173.562) -- 0:00:51
      839500 -- [-2168.748] (-2170.946) (-2173.698) (-2176.221) * (-2176.713) [-2173.607] (-2174.841) (-2182.928) -- 0:00:51
      840000 -- (-2170.966) (-2173.439) (-2176.512) [-2176.044] * (-2173.191) (-2187.975) [-2172.553] (-2181.880) -- 0:00:51

      Average standard deviation of split frequencies: 0.003813

      840500 -- (-2182.994) (-2167.782) (-2174.123) [-2170.558] * [-2173.072] (-2173.144) (-2180.354) (-2181.085) -- 0:00:51
      841000 -- (-2174.638) [-2178.363] (-2171.596) (-2171.842) * [-2173.244] (-2177.664) (-2182.314) (-2189.676) -- 0:00:50
      841500 -- [-2178.864] (-2170.998) (-2176.304) (-2172.594) * (-2181.008) [-2175.410] (-2170.367) (-2180.472) -- 0:00:50
      842000 -- (-2171.545) (-2172.388) [-2174.578] (-2179.760) * (-2175.893) [-2172.235] (-2172.780) (-2169.476) -- 0:00:50
      842500 -- [-2171.566] (-2173.435) (-2173.065) (-2181.527) * (-2174.990) (-2175.843) [-2177.419] (-2176.057) -- 0:00:50
      843000 -- [-2170.079] (-2174.333) (-2184.022) (-2174.957) * [-2175.133] (-2171.178) (-2180.059) (-2183.997) -- 0:00:50
      843500 -- [-2179.613] (-2172.283) (-2173.443) (-2175.675) * (-2174.469) [-2176.112] (-2177.750) (-2180.037) -- 0:00:50
      844000 -- [-2171.553] (-2176.295) (-2178.667) (-2176.789) * (-2174.031) (-2180.479) [-2178.782] (-2181.535) -- 0:00:49
      844500 -- [-2175.857] (-2169.835) (-2178.898) (-2174.783) * (-2176.710) (-2176.204) [-2174.486] (-2176.984) -- 0:00:49
      845000 -- [-2171.249] (-2174.642) (-2175.398) (-2175.217) * (-2172.820) [-2170.788] (-2179.528) (-2178.998) -- 0:00:49

      Average standard deviation of split frequencies: 0.003009

      845500 -- (-2177.892) (-2178.055) [-2174.592] (-2171.195) * (-2175.314) (-2175.353) [-2172.906] (-2180.137) -- 0:00:49
      846000 -- (-2184.199) (-2173.358) (-2176.562) [-2176.566] * [-2170.155] (-2176.946) (-2177.314) (-2172.322) -- 0:00:49
      846500 -- [-2175.922] (-2173.113) (-2171.932) (-2173.165) * [-2172.337] (-2171.642) (-2171.477) (-2167.032) -- 0:00:49
      847000 -- (-2166.523) (-2173.854) (-2174.113) [-2179.150] * [-2177.951] (-2176.828) (-2179.201) (-2177.484) -- 0:00:48
      847500 -- (-2171.857) (-2171.788) (-2177.862) [-2174.648] * (-2180.741) [-2169.960] (-2178.176) (-2179.455) -- 0:00:48
      848000 -- (-2178.060) (-2172.202) (-2184.005) [-2181.476] * (-2174.806) (-2179.683) (-2172.913) [-2180.140] -- 0:00:48
      848500 -- (-2176.669) [-2172.633] (-2180.545) (-2177.939) * (-2169.783) (-2185.917) [-2168.932] (-2174.014) -- 0:00:48
      849000 -- [-2179.066] (-2175.662) (-2176.514) (-2180.344) * [-2171.585] (-2179.787) (-2179.679) (-2176.538) -- 0:00:48
      849500 -- (-2170.910) (-2173.999) [-2170.901] (-2173.743) * (-2176.135) (-2179.217) (-2175.223) [-2179.938] -- 0:00:48
      850000 -- [-2177.200] (-2170.356) (-2174.849) (-2176.084) * (-2171.454) [-2177.853] (-2178.215) (-2178.963) -- 0:00:48

      Average standard deviation of split frequencies: 0.002660

      850500 -- [-2173.995] (-2176.119) (-2180.363) (-2176.091) * (-2179.687) (-2169.770) (-2177.260) [-2180.895] -- 0:00:47
      851000 -- (-2178.743) [-2177.155] (-2173.731) (-2179.897) * [-2173.413] (-2176.304) (-2185.638) (-2180.583) -- 0:00:47
      851500 -- (-2172.602) (-2173.595) [-2174.467] (-2177.670) * (-2174.848) (-2179.074) [-2174.426] (-2172.124) -- 0:00:47
      852000 -- (-2175.372) (-2175.055) [-2170.067] (-2172.350) * (-2173.415) [-2172.200] (-2174.614) (-2175.275) -- 0:00:47
      852500 -- (-2181.736) [-2176.475] (-2176.109) (-2184.276) * (-2175.123) (-2179.927) [-2173.680] (-2177.470) -- 0:00:47
      853000 -- (-2176.285) [-2177.750] (-2176.417) (-2176.287) * (-2175.941) (-2179.275) [-2174.602] (-2178.247) -- 0:00:47
      853500 -- (-2174.583) (-2174.552) [-2170.690] (-2172.397) * (-2171.793) (-2181.080) [-2169.291] (-2174.878) -- 0:00:46
      854000 -- [-2171.633] (-2175.445) (-2170.584) (-2175.167) * [-2172.278] (-2182.641) (-2175.408) (-2180.206) -- 0:00:46
      854500 -- (-2176.462) (-2173.708) [-2175.721] (-2178.827) * (-2170.513) (-2176.662) [-2171.686] (-2182.305) -- 0:00:46
      855000 -- (-2176.506) (-2176.860) (-2173.888) [-2171.006] * (-2172.851) (-2175.944) [-2171.944] (-2174.243) -- 0:00:46

      Average standard deviation of split frequencies: 0.002533

      855500 -- (-2185.151) (-2173.901) (-2180.338) [-2169.266] * (-2170.716) (-2171.226) [-2176.196] (-2168.150) -- 0:00:46
      856000 -- (-2175.176) [-2179.793] (-2175.574) (-2176.556) * (-2175.571) (-2182.317) (-2174.959) [-2171.102] -- 0:00:46
      856500 -- (-2176.364) [-2169.175] (-2174.370) (-2175.994) * (-2181.179) (-2173.719) (-2181.206) [-2181.085] -- 0:00:45
      857000 -- (-2178.940) [-2180.484] (-2174.906) (-2177.374) * (-2179.778) (-2170.052) [-2176.522] (-2175.648) -- 0:00:45
      857500 -- (-2184.978) [-2176.049] (-2174.288) (-2171.032) * (-2176.183) [-2176.627] (-2187.805) (-2177.117) -- 0:00:45
      858000 -- [-2173.501] (-2176.282) (-2172.256) (-2176.457) * (-2176.676) (-2172.632) [-2174.484] (-2183.411) -- 0:00:45
      858500 -- [-2170.927] (-2174.890) (-2173.408) (-2172.991) * (-2174.226) [-2176.453] (-2177.226) (-2173.581) -- 0:00:45
      859000 -- [-2180.268] (-2175.372) (-2171.269) (-2179.389) * (-2173.929) (-2187.621) (-2168.307) [-2172.497] -- 0:00:45
      859500 -- [-2178.343] (-2173.591) (-2177.696) (-2170.209) * [-2176.528] (-2179.141) (-2170.170) (-2180.192) -- 0:00:44
      860000 -- (-2177.584) (-2173.989) (-2167.470) [-2170.860] * (-2169.013) [-2175.199] (-2178.384) (-2188.101) -- 0:00:44

      Average standard deviation of split frequencies: 0.002848

      860500 -- [-2171.833] (-2176.692) (-2174.185) (-2176.848) * (-2177.694) (-2177.671) (-2171.087) [-2178.588] -- 0:00:44
      861000 -- (-2180.055) (-2174.419) (-2177.505) [-2174.304] * (-2171.471) (-2178.270) [-2171.490] (-2176.813) -- 0:00:44
      861500 -- (-2168.359) (-2171.684) (-2188.787) [-2170.823] * [-2179.417] (-2172.983) (-2180.812) (-2174.728) -- 0:00:44
      862000 -- (-2178.591) (-2175.449) [-2179.026] (-2172.991) * (-2170.852) [-2171.649] (-2181.676) (-2172.961) -- 0:00:44
      862500 -- (-2184.266) (-2179.988) (-2174.235) [-2170.694] * (-2172.032) (-2176.558) (-2174.036) [-2179.656] -- 0:00:44
      863000 -- (-2180.027) (-2181.298) (-2172.013) [-2172.480] * (-2172.067) (-2175.949) (-2173.644) [-2173.677] -- 0:00:43
      863500 -- [-2173.376] (-2177.200) (-2178.991) (-2171.740) * (-2172.908) (-2177.606) [-2173.498] (-2170.681) -- 0:00:43
      864000 -- (-2173.585) (-2171.518) (-2179.997) [-2167.999] * [-2172.546] (-2172.430) (-2170.080) (-2169.225) -- 0:00:43
      864500 -- (-2177.210) (-2173.040) [-2169.516] (-2177.110) * [-2173.495] (-2185.683) (-2173.303) (-2172.569) -- 0:00:43
      865000 -- (-2176.623) (-2175.916) (-2173.905) [-2168.600] * (-2174.447) (-2178.799) [-2168.886] (-2171.736) -- 0:00:43

      Average standard deviation of split frequencies: 0.003048

      865500 -- (-2176.756) (-2175.259) [-2176.465] (-2172.909) * (-2175.573) (-2176.703) [-2170.983] (-2177.886) -- 0:00:43
      866000 -- (-2181.178) (-2171.899) (-2177.715) [-2171.695] * (-2176.213) [-2173.187] (-2176.212) (-2171.591) -- 0:00:42
      866500 -- (-2172.173) (-2179.827) [-2176.768] (-2171.997) * (-2179.949) [-2174.716] (-2171.471) (-2179.649) -- 0:00:42
      867000 -- [-2172.965] (-2173.039) (-2176.708) (-2180.765) * (-2175.269) (-2172.929) [-2176.292] (-2175.747) -- 0:00:42
      867500 -- (-2176.742) [-2169.912] (-2173.634) (-2166.918) * (-2175.357) [-2175.049] (-2182.538) (-2177.967) -- 0:00:42
      868000 -- (-2170.077) [-2178.164] (-2176.663) (-2172.475) * (-2177.113) (-2182.117) (-2175.694) [-2168.420] -- 0:00:42
      868500 -- (-2172.079) (-2176.799) (-2175.793) [-2172.765] * [-2178.954] (-2172.531) (-2178.426) (-2177.334) -- 0:00:42
      869000 -- (-2181.023) (-2173.932) [-2178.435] (-2177.349) * (-2179.295) [-2180.031] (-2171.301) (-2178.027) -- 0:00:41
      869500 -- [-2174.474] (-2175.055) (-2173.171) (-2181.344) * (-2173.124) (-2177.146) [-2168.545] (-2169.326) -- 0:00:41
      870000 -- (-2177.734) (-2170.729) (-2172.764) [-2175.519] * (-2177.501) [-2176.165] (-2171.853) (-2171.808) -- 0:00:41

      Average standard deviation of split frequencies: 0.003140

      870500 -- (-2179.413) (-2175.973) (-2171.135) [-2173.683] * (-2173.471) (-2176.677) [-2168.507] (-2171.223) -- 0:00:41
      871000 -- [-2175.029] (-2168.172) (-2173.670) (-2176.431) * [-2174.306] (-2175.607) (-2171.911) (-2179.193) -- 0:00:41
      871500 -- (-2175.932) (-2172.784) [-2172.068] (-2173.952) * (-2168.949) (-2169.947) (-2177.141) [-2171.427] -- 0:00:41
      872000 -- (-2177.405) (-2175.653) (-2174.814) [-2180.994] * (-2178.966) [-2173.136] (-2175.747) (-2175.884) -- 0:00:40
      872500 -- (-2177.217) (-2177.833) (-2176.072) [-2178.245] * (-2183.632) (-2184.339) [-2175.522] (-2174.161) -- 0:00:40
      873000 -- (-2179.721) [-2179.552] (-2177.795) (-2176.223) * (-2175.113) (-2178.255) [-2178.678] (-2176.206) -- 0:00:40
      873500 -- (-2172.061) (-2177.487) (-2171.808) [-2171.033] * (-2174.627) [-2173.170] (-2170.258) (-2177.060) -- 0:00:40
      874000 -- (-2168.642) [-2170.357] (-2178.945) (-2185.808) * (-2173.638) (-2177.448) [-2165.112] (-2179.055) -- 0:00:40
      874500 -- (-2178.986) (-2180.806) (-2169.441) [-2177.806] * (-2181.251) [-2169.529] (-2175.364) (-2173.994) -- 0:00:40
      875000 -- (-2180.694) (-2176.182) [-2181.344] (-2177.243) * (-2184.393) (-2180.949) (-2178.824) [-2171.705] -- 0:00:40

      Average standard deviation of split frequencies: 0.003229

      875500 -- (-2180.351) (-2174.199) (-2173.819) [-2172.495] * (-2173.046) (-2176.252) (-2179.514) [-2180.840] -- 0:00:39
      876000 -- (-2176.188) (-2175.231) (-2174.759) [-2169.289] * [-2172.065] (-2175.397) (-2174.766) (-2179.053) -- 0:00:39
      876500 -- [-2180.963] (-2177.183) (-2177.335) (-2175.517) * (-2173.075) (-2173.138) [-2173.557] (-2177.337) -- 0:00:39
      877000 -- (-2181.150) (-2172.707) (-2174.642) [-2175.967] * (-2170.819) (-2174.420) (-2175.360) [-2171.435] -- 0:00:39
      877500 -- (-2185.172) (-2178.743) (-2174.762) [-2174.878] * (-2174.319) (-2169.414) (-2175.740) [-2177.947] -- 0:00:39
      878000 -- (-2176.720) (-2176.043) (-2179.074) [-2172.966] * (-2173.582) (-2170.376) [-2173.781] (-2182.377) -- 0:00:39
      878500 -- (-2175.990) (-2183.359) (-2177.623) [-2172.673] * [-2171.814] (-2178.016) (-2171.012) (-2177.790) -- 0:00:38
      879000 -- (-2173.799) (-2176.066) [-2169.495] (-2178.224) * (-2172.643) (-2173.510) (-2173.904) [-2174.269] -- 0:00:38
      879500 -- (-2170.757) [-2174.179] (-2175.601) (-2170.658) * [-2173.902] (-2182.457) (-2172.794) (-2181.771) -- 0:00:38
      880000 -- (-2178.826) [-2175.132] (-2172.584) (-2183.362) * (-2176.025) [-2174.104] (-2184.650) (-2173.101) -- 0:00:38

      Average standard deviation of split frequencies: 0.002891

      880500 -- (-2178.699) (-2171.098) (-2175.626) [-2170.697] * [-2171.797] (-2177.988) (-2176.561) (-2174.118) -- 0:00:38
      881000 -- [-2175.067] (-2178.687) (-2180.282) (-2170.292) * (-2176.915) (-2175.271) (-2172.775) [-2176.958] -- 0:00:38
      881500 -- (-2178.838) (-2177.905) (-2171.012) [-2170.249] * (-2169.530) [-2170.945] (-2174.824) (-2171.853) -- 0:00:37
      882000 -- [-2178.821] (-2170.304) (-2175.737) (-2170.708) * (-2171.694) [-2171.769] (-2176.279) (-2172.763) -- 0:00:37
      882500 -- (-2176.568) [-2173.391] (-2172.907) (-2177.233) * (-2171.180) (-2179.895) [-2176.488] (-2172.119) -- 0:00:37
      883000 -- (-2174.631) [-2172.271] (-2179.297) (-2175.814) * (-2175.553) (-2170.505) (-2175.296) [-2174.156] -- 0:00:37
      883500 -- (-2173.061) [-2173.428] (-2173.077) (-2177.281) * (-2174.989) (-2181.207) [-2174.875] (-2179.189) -- 0:00:37
      884000 -- [-2172.197] (-2176.146) (-2175.189) (-2175.945) * (-2183.063) (-2183.035) [-2172.379] (-2175.059) -- 0:00:37
      884500 -- [-2172.091] (-2171.070) (-2172.222) (-2181.653) * [-2174.200] (-2184.295) (-2174.818) (-2171.078) -- 0:00:36
      885000 -- (-2181.608) [-2173.380] (-2174.770) (-2172.274) * (-2173.429) [-2174.254] (-2171.787) (-2172.828) -- 0:00:36

      Average standard deviation of split frequencies: 0.002660

      885500 -- (-2171.572) (-2176.124) [-2178.818] (-2179.105) * (-2171.943) (-2177.500) (-2171.932) [-2169.009] -- 0:00:36
      886000 -- (-2180.334) (-2180.102) [-2169.647] (-2174.736) * (-2176.105) (-2174.297) [-2171.385] (-2176.235) -- 0:00:36
      886500 -- (-2171.282) (-2176.792) (-2176.074) [-2173.938] * [-2177.521] (-2172.212) (-2176.037) (-2174.457) -- 0:00:36
      887000 -- (-2173.529) [-2176.596] (-2175.920) (-2173.210) * (-2176.468) (-2170.364) (-2176.133) [-2179.255] -- 0:00:36
      887500 -- [-2170.216] (-2175.552) (-2176.303) (-2173.696) * (-2175.323) (-2177.806) [-2174.147] (-2172.090) -- 0:00:36
      888000 -- (-2179.674) (-2177.503) (-2175.710) [-2173.571] * (-2183.265) [-2173.602] (-2173.795) (-2176.689) -- 0:00:35
      888500 -- (-2182.513) (-2172.530) [-2180.733] (-2167.953) * [-2175.065] (-2178.388) (-2176.358) (-2175.129) -- 0:00:35
      889000 -- (-2177.233) (-2182.896) [-2183.052] (-2176.922) * (-2171.900) [-2178.313] (-2176.765) (-2176.429) -- 0:00:35
      889500 -- (-2180.671) (-2179.091) [-2176.016] (-2175.379) * (-2181.250) (-2173.375) (-2175.053) [-2166.671] -- 0:00:35
      890000 -- [-2183.046] (-2177.163) (-2179.081) (-2173.091) * [-2178.605] (-2181.203) (-2173.119) (-2170.042) -- 0:00:35

      Average standard deviation of split frequencies: 0.002646

      890500 -- [-2176.165] (-2177.528) (-2168.412) (-2175.197) * (-2175.814) (-2179.331) [-2176.622] (-2178.252) -- 0:00:35
      891000 -- (-2196.056) (-2176.255) [-2170.301] (-2169.014) * (-2175.597) [-2175.920] (-2174.255) (-2176.632) -- 0:00:34
      891500 -- (-2174.779) [-2169.642] (-2176.020) (-2173.711) * [-2170.471] (-2169.845) (-2182.112) (-2170.822) -- 0:00:34
      892000 -- (-2171.216) (-2179.824) [-2175.880] (-2172.727) * (-2172.712) (-2172.670) (-2179.597) [-2171.550] -- 0:00:34
      892500 -- [-2171.459] (-2176.758) (-2172.179) (-2172.897) * (-2173.231) (-2175.437) [-2174.887] (-2170.580) -- 0:00:34
      893000 -- (-2172.127) (-2177.379) [-2169.804] (-2170.833) * (-2175.204) (-2177.758) (-2170.547) [-2179.688] -- 0:00:34
      893500 -- [-2171.286] (-2170.767) (-2173.015) (-2175.900) * (-2173.890) [-2172.136] (-2175.210) (-2179.033) -- 0:00:34
      894000 -- (-2176.428) [-2170.010] (-2175.571) (-2177.695) * (-2173.269) (-2179.410) (-2174.282) [-2176.398] -- 0:00:33
      894500 -- (-2177.084) (-2170.596) [-2174.158] (-2174.917) * [-2171.815] (-2177.108) (-2177.678) (-2170.417) -- 0:00:33
      895000 -- (-2183.558) (-2177.851) (-2171.670) [-2173.454] * [-2168.560] (-2177.999) (-2178.931) (-2183.843) -- 0:00:33

      Average standard deviation of split frequencies: 0.002104

      895500 -- (-2180.360) [-2169.864] (-2177.689) (-2170.642) * (-2178.966) (-2173.888) (-2174.332) [-2171.197] -- 0:00:33
      896000 -- (-2174.869) (-2180.445) (-2172.375) [-2175.978] * [-2181.991] (-2173.911) (-2176.262) (-2174.373) -- 0:00:33
      896500 -- (-2179.715) [-2173.935] (-2175.626) (-2177.147) * (-2176.948) (-2183.871) (-2182.143) [-2173.444] -- 0:00:33
      897000 -- (-2181.879) [-2173.243] (-2182.282) (-2177.272) * (-2174.792) [-2178.979] (-2177.406) (-2171.205) -- 0:00:32
      897500 -- (-2174.819) (-2175.608) (-2169.462) [-2172.882] * [-2173.337] (-2178.123) (-2173.980) (-2172.650) -- 0:00:32
      898000 -- (-2171.901) (-2183.553) [-2176.589] (-2175.105) * [-2175.399] (-2178.511) (-2182.902) (-2174.204) -- 0:00:32
      898500 -- [-2173.925] (-2171.019) (-2174.392) (-2173.665) * (-2179.114) (-2169.402) (-2170.525) [-2175.316] -- 0:00:32
      899000 -- [-2169.579] (-2178.835) (-2177.751) (-2175.897) * (-2174.045) [-2172.277] (-2172.040) (-2181.323) -- 0:00:32
      899500 -- (-2174.620) [-2179.311] (-2178.774) (-2171.852) * (-2174.276) (-2177.511) (-2172.506) [-2180.536] -- 0:00:32
      900000 -- (-2170.720) (-2179.749) [-2169.031] (-2169.606) * (-2187.195) (-2174.096) [-2174.216] (-2179.216) -- 0:00:32

      Average standard deviation of split frequencies: 0.001570

      900500 -- [-2172.842] (-2177.760) (-2171.786) (-2168.133) * (-2176.328) [-2171.940] (-2178.376) (-2174.367) -- 0:00:31
      901000 -- [-2172.121] (-2179.471) (-2168.673) (-2176.858) * (-2177.163) [-2170.379] (-2172.275) (-2173.507) -- 0:00:31
      901500 -- (-2180.145) [-2176.085] (-2172.776) (-2182.023) * (-2172.469) (-2174.087) (-2178.100) [-2170.286] -- 0:00:31
      902000 -- (-2174.136) (-2175.546) (-2169.191) [-2173.784] * (-2173.502) [-2175.445] (-2181.184) (-2181.156) -- 0:00:31
      902500 -- (-2179.043) (-2168.448) [-2173.855] (-2173.609) * (-2168.243) (-2184.143) [-2170.547] (-2184.797) -- 0:00:31
      903000 -- (-2182.441) (-2171.576) (-2181.076) [-2182.242] * (-2172.108) (-2178.084) (-2172.164) [-2178.366] -- 0:00:31
      903500 -- (-2179.977) [-2170.673] (-2177.097) (-2182.257) * (-2175.695) [-2175.619] (-2172.748) (-2177.602) -- 0:00:30
      904000 -- (-2169.670) (-2175.796) [-2172.678] (-2173.933) * (-2171.770) (-2170.965) (-2172.613) [-2179.527] -- 0:00:30
      904500 -- (-2173.399) (-2175.713) (-2186.778) [-2171.841] * (-2174.643) [-2177.590] (-2175.116) (-2173.732) -- 0:00:30
      905000 -- [-2174.549] (-2180.293) (-2176.598) (-2173.292) * (-2173.577) (-2178.874) (-2172.790) [-2174.375] -- 0:00:30

      Average standard deviation of split frequencies: 0.001561

      905500 -- (-2173.699) (-2173.704) [-2175.747] (-2177.796) * [-2183.895] (-2178.890) (-2184.329) (-2173.608) -- 0:00:30
      906000 -- (-2173.150) (-2168.810) [-2172.106] (-2173.029) * [-2180.281] (-2176.484) (-2183.196) (-2171.430) -- 0:00:30
      906500 -- (-2171.492) (-2176.971) [-2174.362] (-2171.200) * (-2175.350) [-2183.090] (-2180.522) (-2169.434) -- 0:00:29
      907000 -- (-2176.229) (-2178.564) [-2177.545] (-2176.012) * (-2175.502) (-2174.412) (-2170.053) [-2171.916] -- 0:00:29
      907500 -- [-2172.476] (-2170.971) (-2170.374) (-2175.491) * (-2181.744) (-2172.435) [-2175.731] (-2176.116) -- 0:00:29
      908000 -- (-2170.049) (-2174.382) (-2183.602) [-2179.360] * [-2172.786] (-2173.138) (-2173.035) (-2168.573) -- 0:00:29
      908500 -- (-2170.398) (-2176.501) (-2180.745) [-2172.968] * (-2177.775) (-2177.112) [-2169.967] (-2178.259) -- 0:00:29
      909000 -- (-2172.950) (-2171.535) [-2171.077] (-2182.760) * [-2168.991] (-2176.741) (-2170.803) (-2177.624) -- 0:00:29
      909500 -- (-2177.431) (-2176.668) [-2174.126] (-2173.316) * [-2168.810] (-2170.399) (-2179.075) (-2171.085) -- 0:00:28
      910000 -- [-2175.665] (-2166.177) (-2174.555) (-2173.730) * [-2172.665] (-2171.426) (-2174.195) (-2175.128) -- 0:00:28

      Average standard deviation of split frequencies: 0.000932

      910500 -- [-2169.739] (-2175.343) (-2176.960) (-2171.459) * (-2172.672) (-2173.849) (-2173.073) [-2179.559] -- 0:00:28
      911000 -- (-2183.817) (-2172.087) [-2174.090] (-2171.258) * (-2171.888) (-2175.524) (-2173.080) [-2170.569] -- 0:00:28
      911500 -- (-2187.030) (-2180.116) (-2177.780) [-2172.794] * (-2171.340) [-2170.106] (-2173.419) (-2171.975) -- 0:00:28
      912000 -- (-2182.385) (-2180.224) (-2170.679) [-2171.125] * [-2170.924] (-2173.468) (-2176.359) (-2171.680) -- 0:00:28
      912500 -- (-2174.325) [-2169.589] (-2173.900) (-2176.765) * [-2171.600] (-2174.544) (-2171.067) (-2184.491) -- 0:00:28
      913000 -- (-2175.971) [-2173.399] (-2170.205) (-2190.484) * (-2170.878) [-2167.588] (-2178.082) (-2179.713) -- 0:00:27
      913500 -- [-2171.115] (-2175.705) (-2173.741) (-2176.589) * (-2171.797) (-2177.407) (-2181.129) [-2176.880] -- 0:00:27
      914000 -- (-2174.114) (-2175.137) [-2179.140] (-2173.692) * (-2184.036) [-2171.551] (-2177.263) (-2178.251) -- 0:00:27
      914500 -- [-2168.991] (-2171.678) (-2174.292) (-2178.501) * (-2171.632) [-2167.936] (-2173.297) (-2177.660) -- 0:00:27
      915000 -- (-2181.192) (-2172.704) (-2176.525) [-2174.734] * [-2171.513] (-2176.583) (-2182.609) (-2174.364) -- 0:00:27

      Average standard deviation of split frequencies: 0.000926

      915500 -- [-2175.564] (-2173.841) (-2170.971) (-2174.945) * [-2171.209] (-2177.926) (-2170.642) (-2178.563) -- 0:00:27
      916000 -- (-2175.836) [-2173.126] (-2175.017) (-2173.891) * (-2171.294) (-2174.881) [-2169.244] (-2175.537) -- 0:00:26
      916500 -- (-2179.550) [-2181.384] (-2184.872) (-2177.288) * [-2171.474] (-2170.414) (-2171.029) (-2177.793) -- 0:00:26
      917000 -- (-2171.837) (-2174.424) [-2175.730] (-2173.892) * [-2167.113] (-2174.984) (-2187.022) (-2175.908) -- 0:00:26
      917500 -- (-2180.040) (-2176.341) [-2173.309] (-2168.011) * (-2182.181) [-2170.575] (-2178.412) (-2184.009) -- 0:00:26
      918000 -- (-2174.440) (-2168.542) (-2172.743) [-2170.660] * [-2181.115] (-2176.727) (-2179.056) (-2176.800) -- 0:00:26
      918500 -- (-2179.505) (-2172.859) [-2171.295] (-2177.154) * [-2169.688] (-2169.363) (-2171.274) (-2172.067) -- 0:00:26
      919000 -- (-2174.665) (-2175.290) [-2173.518] (-2175.726) * (-2169.338) (-2171.712) (-2178.945) [-2173.533] -- 0:00:25
      919500 -- [-2172.746] (-2173.183) (-2180.740) (-2172.561) * (-2170.490) [-2171.566] (-2173.948) (-2175.754) -- 0:00:25
      920000 -- (-2170.920) (-2177.345) [-2176.591] (-2177.204) * (-2176.572) [-2173.996] (-2171.659) (-2183.359) -- 0:00:25

      Average standard deviation of split frequencies: 0.001331

      920500 -- (-2178.211) (-2170.198) [-2168.974] (-2173.539) * [-2171.967] (-2170.003) (-2170.072) (-2184.342) -- 0:00:25
      921000 -- (-2175.217) (-2171.960) (-2172.502) [-2173.184] * (-2175.365) (-2186.231) [-2171.324] (-2173.549) -- 0:00:25
      921500 -- (-2176.827) (-2171.278) (-2173.822) [-2173.625] * (-2177.784) (-2174.950) (-2174.118) [-2174.356] -- 0:00:25
      922000 -- [-2172.184] (-2171.173) (-2168.511) (-2176.092) * (-2176.428) (-2171.630) (-2181.830) [-2170.126] -- 0:00:24
      922500 -- [-2172.388] (-2171.872) (-2171.082) (-2176.451) * (-2170.266) [-2169.148] (-2177.238) (-2175.452) -- 0:00:24
      923000 -- [-2170.604] (-2176.950) (-2179.485) (-2170.679) * (-2175.138) (-2171.050) (-2176.265) [-2169.679] -- 0:00:24
      923500 -- (-2172.829) [-2173.860] (-2181.298) (-2176.885) * (-2176.596) (-2176.245) [-2178.243] (-2170.135) -- 0:00:24
      924000 -- [-2174.737] (-2179.067) (-2175.113) (-2173.141) * (-2168.922) (-2173.926) (-2173.725) [-2176.276] -- 0:00:24
      924500 -- (-2174.749) [-2176.553] (-2172.524) (-2179.006) * (-2174.044) (-2174.217) (-2171.912) [-2170.456] -- 0:00:24
      925000 -- (-2178.896) (-2176.851) [-2172.267] (-2174.685) * (-2176.098) (-2175.202) [-2174.317] (-2174.300) -- 0:00:24

      Average standard deviation of split frequencies: 0.001425

      925500 -- (-2172.691) (-2182.791) [-2180.448] (-2179.333) * (-2189.205) (-2177.853) [-2173.963] (-2175.963) -- 0:00:23
      926000 -- (-2174.020) (-2177.293) (-2172.937) [-2175.300] * (-2175.011) (-2173.205) (-2174.171) [-2174.925] -- 0:00:23
      926500 -- (-2171.375) [-2174.875] (-2175.765) (-2170.239) * [-2175.360] (-2172.869) (-2176.138) (-2170.369) -- 0:00:23
      927000 -- (-2170.367) [-2172.305] (-2173.622) (-2178.499) * (-2180.427) (-2177.750) [-2174.427] (-2174.039) -- 0:00:23
      927500 -- (-2177.673) [-2172.115] (-2171.044) (-2183.971) * (-2177.065) [-2177.473] (-2172.376) (-2178.087) -- 0:00:23
      928000 -- [-2172.767] (-2177.466) (-2172.341) (-2172.538) * (-2176.237) (-2175.643) [-2174.238] (-2172.614) -- 0:00:23
      928500 -- (-2179.637) (-2179.687) [-2174.947] (-2168.648) * (-2174.050) (-2172.038) [-2176.413] (-2170.195) -- 0:00:22
      929000 -- (-2182.660) (-2177.012) (-2185.811) [-2174.545] * (-2171.732) [-2171.924] (-2167.584) (-2176.857) -- 0:00:22
      929500 -- (-2177.971) (-2177.947) (-2170.171) [-2173.161] * (-2170.290) [-2173.613] (-2172.664) (-2179.460) -- 0:00:22
      930000 -- [-2168.551] (-2177.251) (-2177.012) (-2175.410) * [-2171.754] (-2168.413) (-2173.376) (-2178.698) -- 0:00:22

      Average standard deviation of split frequencies: 0.001317

      930500 -- [-2170.859] (-2178.471) (-2173.628) (-2173.771) * [-2168.730] (-2176.515) (-2179.828) (-2175.357) -- 0:00:22
      931000 -- (-2176.212) (-2178.052) (-2170.433) [-2172.896] * (-2173.667) [-2172.358] (-2174.715) (-2170.623) -- 0:00:22
      931500 -- (-2175.423) [-2173.310] (-2175.113) (-2170.415) * [-2172.793] (-2176.512) (-2178.930) (-2179.489) -- 0:00:21
      932000 -- (-2176.005) (-2185.816) [-2178.392] (-2170.598) * [-2169.817] (-2174.738) (-2172.656) (-2172.251) -- 0:00:21
      932500 -- (-2179.051) (-2171.431) (-2175.801) [-2173.952] * [-2167.504] (-2177.537) (-2176.244) (-2183.451) -- 0:00:21
      933000 -- (-2169.731) (-2174.985) (-2169.536) [-2172.828] * (-2182.073) (-2173.007) [-2169.765] (-2174.031) -- 0:00:21
      933500 -- [-2170.482] (-2171.420) (-2174.708) (-2176.183) * (-2170.586) (-2173.119) (-2178.925) [-2172.245] -- 0:00:21
      934000 -- (-2177.537) [-2174.632] (-2170.891) (-2169.787) * (-2171.826) [-2173.025] (-2173.963) (-2177.207) -- 0:00:21
      934500 -- (-2172.996) (-2175.747) [-2171.381] (-2174.595) * (-2183.614) (-2178.673) [-2174.718] (-2185.076) -- 0:00:20
      935000 -- (-2175.371) [-2173.526] (-2178.193) (-2177.005) * (-2172.973) (-2175.453) [-2175.729] (-2183.106) -- 0:00:20

      Average standard deviation of split frequencies: 0.001410

      935500 -- [-2178.400] (-2178.667) (-2176.302) (-2169.573) * (-2171.221) (-2178.181) (-2182.838) [-2172.087] -- 0:00:20
      936000 -- (-2176.554) (-2176.340) (-2179.343) [-2171.595] * (-2170.976) [-2174.175] (-2178.934) (-2176.993) -- 0:00:20
      936500 -- (-2182.232) (-2177.870) (-2176.181) [-2176.197] * (-2176.811) (-2175.392) [-2173.249] (-2179.067) -- 0:00:20
      937000 -- (-2179.117) (-2175.364) (-2174.370) [-2183.407] * [-2171.164] (-2172.782) (-2171.545) (-2176.582) -- 0:00:20
      937500 -- [-2174.464] (-2176.398) (-2171.287) (-2171.972) * [-2179.063] (-2175.519) (-2175.487) (-2173.711) -- 0:00:20
      938000 -- (-2183.357) [-2176.769] (-2170.417) (-2174.846) * [-2168.320] (-2175.331) (-2179.029) (-2178.504) -- 0:00:19
      938500 -- (-2172.239) (-2176.747) [-2168.540] (-2175.848) * (-2177.773) (-2185.749) [-2175.245] (-2173.206) -- 0:00:19
      939000 -- [-2171.583] (-2176.742) (-2169.000) (-2175.234) * (-2172.690) (-2172.098) (-2174.475) [-2175.117] -- 0:00:19
      939500 -- [-2178.414] (-2179.296) (-2174.764) (-2177.288) * (-2175.925) [-2174.191] (-2178.449) (-2180.942) -- 0:00:19
      940000 -- (-2168.604) [-2172.480] (-2174.479) (-2173.523) * [-2176.925] (-2175.921) (-2173.097) (-2174.062) -- 0:00:19

      Average standard deviation of split frequencies: 0.002305

      940500 -- [-2171.245] (-2172.981) (-2173.837) (-2175.105) * (-2173.069) (-2172.050) [-2173.878] (-2171.105) -- 0:00:19
      941000 -- (-2173.816) (-2175.121) (-2167.895) [-2170.704] * (-2175.342) [-2178.071] (-2176.736) (-2177.918) -- 0:00:18
      941500 -- (-2178.502) [-2173.586] (-2175.702) (-2170.813) * (-2174.860) (-2176.466) (-2177.236) [-2168.736] -- 0:00:18
      942000 -- (-2181.274) (-2182.402) [-2177.599] (-2176.650) * (-2172.619) (-2189.191) [-2175.895] (-2174.951) -- 0:00:18
      942500 -- (-2173.693) (-2181.838) [-2174.839] (-2178.924) * (-2180.440) (-2178.011) (-2182.609) [-2171.605] -- 0:00:18
      943000 -- (-2174.457) (-2172.351) (-2175.072) [-2172.687] * (-2177.781) (-2174.761) [-2169.937] (-2173.879) -- 0:00:18
      943500 -- (-2172.192) [-2173.925] (-2171.979) (-2173.071) * (-2170.447) [-2179.531] (-2171.779) (-2177.498) -- 0:00:18
      944000 -- [-2170.146] (-2171.762) (-2175.235) (-2176.368) * (-2171.776) [-2175.338] (-2171.391) (-2181.475) -- 0:00:17
      944500 -- [-2174.171] (-2179.742) (-2174.658) (-2178.281) * [-2170.752] (-2170.303) (-2171.136) (-2173.186) -- 0:00:17
      945000 -- (-2174.845) [-2181.324] (-2173.862) (-2169.974) * (-2174.643) [-2175.480] (-2179.098) (-2174.470) -- 0:00:17

      Average standard deviation of split frequencies: 0.002591

      945500 -- (-2171.208) [-2173.325] (-2179.106) (-2172.708) * [-2173.089] (-2172.108) (-2173.023) (-2182.461) -- 0:00:17
      946000 -- [-2178.226] (-2177.370) (-2170.068) (-2176.682) * (-2175.618) (-2174.389) [-2173.790] (-2180.697) -- 0:00:17
      946500 -- [-2170.996] (-2176.940) (-2167.285) (-2177.719) * [-2173.567] (-2170.858) (-2175.114) (-2175.439) -- 0:00:17
      947000 -- [-2169.116] (-2177.445) (-2174.630) (-2174.398) * (-2182.151) (-2178.754) [-2168.255] (-2170.683) -- 0:00:16
      947500 -- (-2171.069) (-2169.070) [-2175.345] (-2175.339) * (-2173.859) (-2183.357) (-2175.623) [-2172.120] -- 0:00:16
      948000 -- (-2174.543) (-2179.965) (-2171.840) [-2171.781] * (-2176.265) (-2185.661) (-2171.968) [-2172.249] -- 0:00:16
      948500 -- (-2173.698) (-2171.365) [-2172.630] (-2173.721) * (-2175.681) [-2177.470] (-2171.049) (-2175.598) -- 0:00:16
      949000 -- (-2175.098) [-2171.614] (-2184.100) (-2178.985) * (-2175.363) [-2176.628] (-2176.569) (-2183.598) -- 0:00:16
      949500 -- (-2172.516) (-2172.971) [-2172.058] (-2175.965) * (-2178.650) (-2174.112) (-2177.471) [-2174.308] -- 0:00:16
      950000 -- (-2174.449) (-2179.911) (-2173.637) [-2174.753] * (-2175.980) (-2170.459) [-2172.105] (-2182.384) -- 0:00:16

      Average standard deviation of split frequencies: 0.003174

      950500 -- (-2173.617) (-2173.269) [-2172.864] (-2171.859) * [-2172.811] (-2179.029) (-2179.919) (-2176.500) -- 0:00:15
      951000 -- [-2176.705] (-2174.902) (-2169.444) (-2179.025) * [-2169.858] (-2173.452) (-2180.829) (-2173.915) -- 0:00:15
      951500 -- [-2177.578] (-2171.112) (-2173.533) (-2170.941) * (-2187.076) (-2168.475) (-2175.834) [-2174.216] -- 0:00:15
      952000 -- (-2184.868) (-2176.445) (-2175.035) [-2175.492] * (-2177.957) (-2169.038) [-2173.519] (-2179.568) -- 0:00:15
      952500 -- (-2173.044) (-2168.815) [-2173.135] (-2173.253) * [-2174.550] (-2170.349) (-2175.660) (-2172.723) -- 0:00:15
      953000 -- [-2169.827] (-2180.672) (-2181.311) (-2170.995) * (-2184.473) (-2175.755) [-2174.351] (-2171.363) -- 0:00:15
      953500 -- [-2174.929] (-2177.964) (-2175.582) (-2174.305) * [-2173.281] (-2173.126) (-2173.623) (-2172.582) -- 0:00:14
      954000 -- [-2169.186] (-2172.490) (-2180.030) (-2175.328) * [-2170.460] (-2181.065) (-2175.900) (-2174.660) -- 0:00:14
      954500 -- (-2172.684) [-2175.503] (-2177.717) (-2175.500) * (-2173.210) (-2175.826) [-2173.712] (-2174.056) -- 0:00:14
      955000 -- [-2169.206] (-2174.307) (-2179.707) (-2174.310) * (-2170.164) (-2183.239) [-2174.227] (-2174.915) -- 0:00:14

      Average standard deviation of split frequencies: 0.003353

      955500 -- (-2170.504) [-2178.739] (-2175.742) (-2176.698) * (-2181.099) (-2178.781) [-2179.657] (-2174.835) -- 0:00:14
      956000 -- (-2175.732) (-2176.968) (-2178.425) [-2173.353] * (-2178.087) (-2182.831) (-2178.474) [-2178.195] -- 0:00:14
      956500 -- [-2170.822] (-2174.023) (-2173.974) (-2176.051) * (-2173.509) [-2176.250] (-2176.556) (-2171.345) -- 0:00:13
      957000 -- (-2171.926) (-2182.684) (-2170.407) [-2173.899] * (-2175.146) (-2174.930) [-2179.373] (-2178.159) -- 0:00:13
      957500 -- (-2174.017) (-2175.177) (-2178.103) [-2173.458] * [-2176.651] (-2173.243) (-2179.086) (-2177.377) -- 0:00:13
      958000 -- (-2181.381) (-2170.827) (-2172.060) [-2174.986] * (-2178.425) [-2172.987] (-2179.784) (-2172.005) -- 0:00:13
      958500 -- (-2176.095) (-2177.521) [-2174.578] (-2172.948) * [-2171.298] (-2173.982) (-2178.172) (-2175.273) -- 0:00:13
      959000 -- (-2176.197) (-2176.039) [-2176.251] (-2176.706) * (-2180.141) (-2170.962) (-2180.071) [-2169.507] -- 0:00:13
      959500 -- (-2176.280) (-2174.146) (-2179.309) [-2171.256] * (-2175.285) (-2171.250) [-2171.893] (-2175.723) -- 0:00:12
      960000 -- (-2178.681) (-2177.970) [-2176.795] (-2176.576) * (-2176.516) (-2173.043) (-2172.317) [-2172.116] -- 0:00:12

      Average standard deviation of split frequencies: 0.003435

      960500 -- [-2180.481] (-2170.853) (-2181.546) (-2174.846) * (-2177.433) [-2176.306] (-2170.151) (-2177.257) -- 0:00:12
      961000 -- (-2172.457) (-2177.245) [-2173.146] (-2172.783) * (-2175.246) (-2176.150) [-2170.444] (-2175.654) -- 0:00:12
      961500 -- (-2171.107) (-2172.424) (-2173.371) [-2171.765] * (-2180.845) (-2176.896) [-2178.576] (-2183.445) -- 0:00:12
      962000 -- [-2174.015] (-2177.507) (-2173.020) (-2170.630) * (-2168.676) (-2181.759) (-2180.631) [-2178.292] -- 0:00:12
      962500 -- [-2176.777] (-2178.702) (-2175.280) (-2168.825) * (-2178.826) [-2173.598] (-2189.748) (-2178.930) -- 0:00:12
      963000 -- (-2171.031) [-2176.462] (-2175.925) (-2173.682) * (-2177.957) (-2174.135) (-2179.444) [-2172.244] -- 0:00:11
      963500 -- (-2176.776) [-2173.550] (-2180.580) (-2174.812) * (-2178.637) [-2176.157] (-2173.454) (-2178.585) -- 0:00:11
      964000 -- (-2174.802) [-2172.918] (-2174.667) (-2177.290) * (-2176.608) [-2178.435] (-2171.984) (-2179.074) -- 0:00:11
      964500 -- (-2183.690) (-2174.326) (-2174.160) [-2175.499] * (-2175.549) [-2173.852] (-2175.558) (-2172.474) -- 0:00:11
      965000 -- (-2184.037) (-2172.919) (-2178.304) [-2177.744] * (-2176.851) (-2171.071) (-2172.355) [-2175.316] -- 0:00:11

      Average standard deviation of split frequencies: 0.003904

      965500 -- (-2175.261) (-2170.317) (-2173.486) [-2169.060] * [-2176.480] (-2169.797) (-2178.183) (-2172.401) -- 0:00:11
      966000 -- (-2178.873) (-2174.455) [-2175.316] (-2172.535) * (-2178.929) [-2167.879] (-2177.192) (-2181.873) -- 0:00:10
      966500 -- (-2170.295) (-2178.176) (-2173.039) [-2170.849] * (-2173.121) [-2170.280] (-2171.538) (-2178.433) -- 0:00:10
      967000 -- [-2173.606] (-2170.083) (-2176.755) (-2179.585) * (-2169.824) [-2174.593] (-2175.683) (-2176.260) -- 0:00:10
      967500 -- [-2168.484] (-2175.785) (-2175.371) (-2172.707) * [-2172.703] (-2175.114) (-2179.283) (-2186.574) -- 0:00:10
      968000 -- [-2174.153] (-2186.978) (-2178.265) (-2169.997) * [-2172.729] (-2175.686) (-2181.719) (-2175.966) -- 0:00:10
      968500 -- (-2174.560) (-2177.313) (-2169.398) [-2168.222] * [-2171.349] (-2180.570) (-2175.420) (-2176.289) -- 0:00:10
      969000 -- [-2175.163] (-2186.795) (-2172.539) (-2175.454) * [-2170.073] (-2177.982) (-2180.260) (-2183.233) -- 0:00:09
      969500 -- (-2178.919) [-2173.607] (-2174.058) (-2174.688) * (-2174.824) (-2179.865) (-2186.665) [-2171.524] -- 0:00:09
      970000 -- [-2170.550] (-2173.682) (-2180.137) (-2179.414) * (-2179.406) (-2169.806) (-2180.231) [-2171.311] -- 0:00:09

      Average standard deviation of split frequencies: 0.003788

      970500 -- [-2171.999] (-2178.908) (-2174.634) (-2172.694) * (-2171.181) (-2175.499) [-2168.102] (-2176.931) -- 0:00:09
      971000 -- [-2175.298] (-2178.838) (-2178.744) (-2173.345) * (-2170.240) (-2175.884) [-2170.145] (-2167.171) -- 0:00:09
      971500 -- [-2172.593] (-2177.970) (-2168.818) (-2176.550) * (-2177.959) [-2171.569] (-2175.995) (-2171.962) -- 0:00:09
      972000 -- [-2174.507] (-2176.340) (-2172.640) (-2175.363) * (-2179.867) [-2174.895] (-2175.260) (-2177.905) -- 0:00:08
      972500 -- (-2168.297) (-2171.434) (-2167.922) [-2171.144] * [-2177.236] (-2171.758) (-2177.527) (-2177.122) -- 0:00:08
      973000 -- [-2169.179] (-2179.099) (-2175.432) (-2179.081) * [-2169.914] (-2172.043) (-2184.336) (-2171.839) -- 0:00:08
      973500 -- (-2177.185) (-2174.925) [-2167.553] (-2178.557) * (-2179.008) (-2173.346) [-2171.341] (-2186.517) -- 0:00:08
      974000 -- (-2184.819) (-2178.030) [-2172.339] (-2177.006) * (-2180.346) (-2175.529) [-2177.159] (-2174.393) -- 0:00:08
      974500 -- (-2178.564) [-2177.095] (-2176.685) (-2175.767) * [-2173.945] (-2175.951) (-2172.602) (-2174.257) -- 0:00:08
      975000 -- (-2174.860) (-2175.994) (-2186.567) [-2174.266] * [-2168.911] (-2169.715) (-2179.485) (-2172.911) -- 0:00:08

      Average standard deviation of split frequencies: 0.004347

      975500 -- (-2173.581) (-2172.249) (-2177.175) [-2170.388] * [-2179.183] (-2171.269) (-2179.739) (-2181.652) -- 0:00:07
      976000 -- (-2173.829) (-2173.479) [-2175.786] (-2181.391) * (-2172.977) (-2179.815) (-2179.601) [-2171.752] -- 0:00:07
      976500 -- (-2173.961) (-2183.035) [-2174.729] (-2173.787) * (-2175.657) (-2178.840) (-2175.842) [-2171.059] -- 0:00:07
      977000 -- [-2169.182] (-2184.603) (-2173.443) (-2178.280) * (-2179.667) (-2177.407) (-2179.446) [-2172.913] -- 0:00:07
      977500 -- [-2173.080] (-2172.619) (-2178.711) (-2175.332) * (-2185.402) (-2174.113) (-2171.195) [-2168.036] -- 0:00:07
      978000 -- (-2181.076) [-2177.784] (-2174.760) (-2173.170) * [-2181.380] (-2176.580) (-2175.103) (-2171.965) -- 0:00:07
      978500 -- (-2174.497) [-2173.016] (-2179.073) (-2172.509) * (-2181.236) [-2180.412] (-2171.193) (-2178.516) -- 0:00:06
      979000 -- (-2176.103) [-2178.206] (-2170.192) (-2175.053) * (-2177.022) (-2180.877) [-2179.986] (-2176.807) -- 0:00:06
      979500 -- (-2177.250) (-2179.952) [-2169.642] (-2179.786) * (-2175.574) (-2187.242) (-2175.035) [-2170.994] -- 0:00:06
      980000 -- (-2174.329) [-2173.537] (-2173.748) (-2172.610) * (-2170.634) [-2175.105] (-2173.241) (-2172.862) -- 0:00:06

      Average standard deviation of split frequencies: 0.004422

      980500 -- (-2174.786) (-2178.479) [-2167.948] (-2169.959) * (-2172.169) (-2172.836) (-2182.751) [-2173.123] -- 0:00:06
      981000 -- (-2176.730) (-2171.271) [-2169.824] (-2173.367) * [-2174.612] (-2170.895) (-2178.404) (-2180.731) -- 0:00:06
      981500 -- [-2172.880] (-2173.707) (-2171.242) (-2175.928) * (-2177.747) (-2182.661) (-2182.140) [-2174.992] -- 0:00:05
      982000 -- (-2170.469) (-2176.648) (-2175.867) [-2174.143] * (-2182.461) (-2175.425) [-2171.840] (-2172.653) -- 0:00:05
      982500 -- (-2173.174) [-2173.733] (-2173.902) (-2173.580) * (-2187.330) (-2173.202) [-2174.556] (-2169.765) -- 0:00:05
      983000 -- (-2180.294) (-2177.614) [-2171.984] (-2179.063) * (-2172.034) (-2183.841) (-2176.228) [-2168.018] -- 0:00:05
      983500 -- (-2177.390) (-2173.186) [-2170.992] (-2172.070) * (-2178.367) (-2173.792) (-2176.623) [-2171.551] -- 0:00:05
      984000 -- (-2175.958) (-2173.687) [-2169.898] (-2171.847) * (-2177.020) (-2170.425) [-2172.343] (-2169.910) -- 0:00:05
      984500 -- (-2174.335) (-2179.753) (-2176.589) [-2170.395] * (-2177.149) (-2173.692) [-2174.762] (-2169.379) -- 0:00:04
      985000 -- (-2178.758) (-2179.519) (-2177.152) [-2174.966] * (-2173.388) [-2171.205] (-2172.429) (-2180.595) -- 0:00:04

      Average standard deviation of split frequencies: 0.004494

      985500 -- (-2180.536) (-2170.287) [-2178.169] (-2174.401) * (-2177.881) (-2180.678) (-2184.865) [-2171.939] -- 0:00:04
      986000 -- (-2175.595) (-2177.543) (-2183.483) [-2172.936] * (-2178.783) [-2169.720] (-2175.310) (-2170.731) -- 0:00:04
      986500 -- (-2171.679) [-2174.037] (-2174.675) (-2170.130) * (-2168.892) (-2173.874) [-2183.959] (-2171.115) -- 0:00:04
      987000 -- (-2172.184) (-2177.864) [-2174.201] (-2180.106) * (-2173.282) (-2176.928) (-2175.367) [-2178.281] -- 0:00:04
      987500 -- [-2175.241] (-2181.310) (-2179.398) (-2173.750) * (-2174.123) [-2174.402] (-2177.479) (-2177.627) -- 0:00:04
      988000 -- (-2181.065) (-2178.011) (-2171.623) [-2168.570] * (-2177.012) [-2170.251] (-2170.692) (-2177.428) -- 0:00:03
      988500 -- (-2175.397) (-2174.594) (-2175.204) [-2170.723] * (-2181.403) [-2170.641] (-2172.212) (-2183.337) -- 0:00:03
      989000 -- (-2175.947) (-2176.341) [-2169.484] (-2173.625) * [-2175.290] (-2178.897) (-2173.155) (-2175.197) -- 0:00:03
      989500 -- (-2183.471) (-2175.560) [-2170.249] (-2172.292) * (-2173.680) (-2172.249) [-2170.184] (-2172.638) -- 0:00:03
      990000 -- (-2181.838) (-2169.546) (-2172.896) [-2176.361] * (-2171.600) (-2178.032) [-2175.611] (-2172.495) -- 0:00:03

      Average standard deviation of split frequencies: 0.003902

      990500 -- (-2178.651) [-2170.911] (-2175.268) (-2175.017) * (-2170.351) (-2179.183) (-2174.236) [-2175.219] -- 0:00:03
      991000 -- (-2169.462) [-2175.185] (-2171.423) (-2172.015) * [-2171.460] (-2174.102) (-2169.912) (-2173.646) -- 0:00:02
      991500 -- (-2172.592) (-2175.600) (-2173.574) [-2174.564] * (-2176.279) (-2173.178) (-2178.975) [-2172.237] -- 0:00:02
      992000 -- (-2176.148) (-2174.296) (-2172.328) [-2173.025] * (-2178.712) [-2172.289] (-2180.801) (-2187.752) -- 0:00:02
      992500 -- (-2178.288) (-2180.208) (-2175.788) [-2175.013] * [-2171.822] (-2176.910) (-2181.527) (-2182.228) -- 0:00:02
      993000 -- [-2170.776] (-2170.639) (-2170.482) (-2179.629) * (-2172.471) (-2181.874) (-2172.138) [-2181.651] -- 0:00:02
      993500 -- (-2170.170) [-2176.955] (-2169.420) (-2179.380) * (-2167.398) (-2176.379) (-2180.125) [-2175.986] -- 0:00:02
      994000 -- [-2175.239] (-2174.921) (-2167.767) (-2174.316) * [-2169.029] (-2174.835) (-2185.753) (-2180.009) -- 0:00:01
      994500 -- (-2181.546) [-2174.728] (-2176.035) (-2172.748) * (-2173.823) (-2176.334) (-2180.733) [-2177.907] -- 0:00:01
      995000 -- [-2171.280] (-2172.014) (-2178.845) (-2178.406) * [-2176.965] (-2172.460) (-2177.585) (-2179.403) -- 0:00:01

      Average standard deviation of split frequencies: 0.003786

      995500 -- (-2171.046) (-2181.044) [-2175.676] (-2168.025) * (-2193.065) [-2172.598] (-2172.315) (-2174.824) -- 0:00:01
      996000 -- (-2175.731) [-2171.179] (-2167.448) (-2171.460) * [-2180.881] (-2170.937) (-2171.523) (-2174.971) -- 0:00:01
      996500 -- (-2176.005) (-2172.656) (-2169.650) [-2172.639] * (-2178.078) [-2167.252] (-2171.007) (-2169.218) -- 0:00:01
      997000 -- (-2178.327) [-2171.138] (-2172.702) (-2178.743) * (-2175.738) [-2171.971] (-2185.098) (-2173.741) -- 0:00:00
      997500 -- [-2176.110] (-2171.245) (-2168.493) (-2174.839) * (-2171.620) (-2173.265) [-2171.513] (-2176.302) -- 0:00:00
      998000 -- (-2180.330) [-2170.479] (-2178.278) (-2176.213) * [-2177.521] (-2179.949) (-2173.546) (-2174.935) -- 0:00:00
      998500 -- (-2181.127) (-2179.248) (-2178.830) [-2175.621] * (-2169.237) (-2174.894) (-2174.480) [-2175.286] -- 0:00:00
      999000 -- (-2171.072) [-2174.867] (-2172.517) (-2177.732) * [-2169.503] (-2171.914) (-2179.297) (-2177.142) -- 0:00:00
      999500 -- (-2176.070) (-2169.926) (-2168.810) [-2181.349] * (-2170.809) [-2172.885] (-2173.114) (-2173.704) -- 0:00:00
      1000000 -- (-2176.045) [-2175.276] (-2180.330) (-2178.016) * (-2170.598) (-2180.265) [-2171.488] (-2177.593) -- 0:00:00

      Average standard deviation of split frequencies: 0.003863
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -2176.045382 -- 20.253119
         Chain 1 -- -2176.045383 -- 20.253119
         Chain 2 -- -2175.275689 -- 17.727360
         Chain 2 -- -2175.275689 -- 17.727360
         Chain 3 -- -2180.330032 -- 18.860062
         Chain 3 -- -2180.330040 -- 18.860062
         Chain 4 -- -2178.016220 -- 19.959862
         Chain 4 -- -2178.016218 -- 19.959862
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -2170.598086 -- 19.932868
         Chain 1 -- -2170.598086 -- 19.932868
         Chain 2 -- -2180.264995 -- 19.280560
         Chain 2 -- -2180.264995 -- 19.280560
         Chain 3 -- -2171.488276 -- 19.020967
         Chain 3 -- -2171.488276 -- 19.020967
         Chain 4 -- -2177.592636 -- 21.152997
         Chain 4 -- -2177.592638 -- 21.152997

      Analysis completed in 5 mins 20 seconds
      Analysis used 319.86 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -2164.96
      Likelihood of best state for "cold" chain of run 2 was -2164.95

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            46.3 %     ( 42 %)     Dirichlet(Revmat{all})
            63.9 %     ( 52 %)     Slider(Revmat{all})
            25.1 %     ( 31 %)     Dirichlet(Pi{all})
            27.8 %     ( 31 %)     Slider(Pi{all})
            49.4 %     ( 32 %)     Multiplier(Alpha{1,2})
            53.6 %     ( 25 %)     Multiplier(Alpha{3})
            74.9 %     ( 55 %)     Slider(Pinvar{all})
             6.7 %     ( 13 %)     ExtSPR(Tau{all},V{all})
             3.2 %     (  5 %)     ExtTBR(Tau{all},V{all})
             6.2 %     (  7 %)     NNI(Tau{all},V{all})
             7.1 %     ( 10 %)     ParsSPR(Tau{all},V{all})
            26.3 %     ( 26 %)     Multiplier(V{all})
            32.5 %     ( 41 %)     Nodeslider(V{all})
            25.0 %     ( 23 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            46.5 %     ( 35 %)     Dirichlet(Revmat{all})
            62.0 %     ( 43 %)     Slider(Revmat{all})
            25.5 %     ( 27 %)     Dirichlet(Pi{all})
            28.0 %     ( 26 %)     Slider(Pi{all})
            48.9 %     ( 23 %)     Multiplier(Alpha{1,2})
            53.6 %     ( 26 %)     Multiplier(Alpha{3})
            75.3 %     ( 47 %)     Slider(Pinvar{all})
             6.6 %     (  4 %)     ExtSPR(Tau{all},V{all})
             3.2 %     (  4 %)     ExtTBR(Tau{all},V{all})
             6.4 %     (  6 %)     NNI(Tau{all},V{all})
             7.1 %     (  4 %)     ParsSPR(Tau{all},V{all})
            26.3 %     ( 22 %)     Multiplier(V{all})
            32.8 %     ( 28 %)     Nodeslider(V{all})
            25.4 %     ( 26 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.65    0.51 
         2 |  167070            0.83    0.68 
         3 |  166200  165778            0.84 
         4 |  166751  166579  167622         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.81    0.65    0.51 
         2 |  166777            0.83    0.68 
         3 |  167241  166402            0.84 
         4 |  166660  166957  165963         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -2171.93
      |                                                     2      |
      |                                                            |
      |            2            1                                  |
      |  2       2                 2           2                   |
      |     1   1     1   2    22   2       2     1             *  |
      |2  2   1            1        1 1 1            2       2   1 |
      |          1    2              1 1  2 1        1  2          |
      | 2            1      1 2  121     1   11  1          1 1   *|
      |     21    1 *                 22   1  2 2 21       1       |
      |        1       2 2  21   21     22 2     2      1     2    |
      |1 1      2       11     1     2    1           2  *1  1 * 2 |
      | 1  1  2   21 2  2  2 2                 1   2       2       |
      |   12 2                1                        1           |
      |                1                              12  2        |
      |        2          1                  2  1   *              |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2175.03
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -2170.37         -2182.12
        2      -2170.31         -2182.62
      --------------------------------------
      TOTAL    -2170.34         -2182.40
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.296725    0.000675    0.245401    0.344745    0.295780   1344.42   1422.71    1.000
      r(A<->C){all}   0.120200    0.000650    0.070784    0.168646    0.119392    909.09    987.91    1.000
      r(A<->G){all}   0.239513    0.001193    0.175024    0.307715    0.238396    923.33    927.48    1.000
      r(A<->T){all}   0.135747    0.000721    0.084164    0.188177    0.134125   1025.45   1038.76    1.001
      r(C<->G){all}   0.117920    0.000676    0.071020    0.172710    0.115986   1160.32   1180.84    1.000
      r(C<->T){all}   0.309875    0.001541    0.234620    0.387386    0.309105    923.16    940.72    1.000
      r(G<->T){all}   0.076746    0.000445    0.039363    0.120003    0.075351   1191.63   1224.99    1.001
      pi(A){all}      0.278964    0.000226    0.250224    0.308742    0.278930   1311.63   1345.58    1.000
      pi(C){all}      0.232562    0.000190    0.206309    0.259725    0.232253   1174.23   1238.77    1.000
      pi(G){all}      0.248120    0.000211    0.218584    0.274629    0.247951   1136.20   1147.11    1.000
      pi(T){all}      0.240354    0.000204    0.213288    0.268990    0.240204   1352.34   1353.81    1.000
      alpha{1,2}      0.622238    0.104769    0.166565    1.267592    0.544318   1483.16   1488.64    1.000
      alpha{3}        1.225757    0.381416    0.367951    2.461108    1.109182   1501.00   1501.00    1.000
      pinvar{all}     0.142587    0.010385    0.000038    0.337315    0.125752   1273.30   1327.26    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6
      7 -- C7

   Key to taxon bipartitions (saved to file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   -------------
    1 -- .******
    2 -- .*.....
    3 -- ..*....
    4 -- ...*...
    5 -- ....*..
    6 -- .....*.
    7 -- ......*
    8 -- .**....
    9 -- .....**
   10 -- ...****
   11 -- ...*.**
   12 -- ....***
   -------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    8  3002    1.000000    0.000000    1.000000    1.000000    2
    9  3002    1.000000    0.000000    1.000000    1.000000    2
   10  3002    1.000000    0.000000    1.000000    1.000000    2
   11  2451    0.816456    0.012719    0.807462    0.825450    2
   12   320    0.106596    0.006595    0.101932    0.111259    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.011541    0.000016    0.004291    0.019407    0.011064    1.000    2
   length{all}[2]     0.036718    0.000054    0.022015    0.049972    0.036309    1.000    2
   length{all}[3]     0.002466    0.000003    0.000001    0.006068    0.002061    1.001    2
   length{all}[4]     0.050912    0.000097    0.033762    0.071257    0.050115    1.000    2
   length{all}[5]     0.015027    0.000025    0.006321    0.025126    0.014487    1.000    2
   length{all}[6]     0.066307    0.000130    0.044604    0.088697    0.065392    1.000    2
   length{all}[7]     0.045081    0.000089    0.027305    0.063662    0.044343    1.000    2
   length{all}[8]     0.008234    0.000012    0.002108    0.015203    0.007738    1.000    2
   length{all}[9]     0.044732    0.000098    0.026140    0.064597    0.044023    1.000    2
   length{all}[10]    0.008439    0.000014    0.002277    0.016180    0.007947    1.000    2
   length{all}[11]    0.008096    0.000020    0.000367    0.016550    0.007428    1.000    2
   length{all}[12]    0.003898    0.000006    0.000026    0.008332    0.003391    1.003    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.003863
       Maximum standard deviation of split frequencies = 0.012719
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.003


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |                                                     /------------------ C2 (2)
   |-------------------------100-------------------------+                         
   |                                                     \------------------ C3 (3)
   +                                                                               
   |                                   /------------------------------------ C4 (4)
   |                                   |                                           
   |                 /--------82-------+                 /------------------ C6 (6)
   |                 |                 \-------100-------+                         
   \-------100-------+                                   \------------------ C7 (7)
                     |                                                             
                     \------------------------------------------------------ C5 (5)
                                                                                   

   Phylogram (based on average branch lengths):

   /------ C1 (1)
   |                                                                               
   |   /--------------------- C2 (2)
   |---+                                                                           
   |   \-- C3 (3)
   +                                                                               
   |        /----------------------------- C4 (4)
   |        |                                                                      
   |    /---+                        /-------------------------------------- C6 (6)
   |    |   \------------------------+                                             
   \----+                            \-------------------------- C7 (7)
        |                                                                          
        \-------- C5 (5)
                                                                                   
   |----------| 0.020 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (3 trees sampled):
      90 % credible set contains 2 trees
      95 % credible set contains 3 trees
      99 % credible set contains 3 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 7  	ls = 804
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Reading seq # 7: C7     
Sites with gaps or missing data are removed.

     9 ambiguity characters in seq. 1
     9 ambiguity characters in seq. 2
     9 ambiguity characters in seq. 3
    12 ambiguity characters in seq. 4
     9 ambiguity characters in seq. 5
     9 ambiguity characters in seq. 6
     9 ambiguity characters in seq. 7
7 sites are removed.  55 60 170 171 207 208 268
Sequences read..
Counting site patterns..  0:00

         153 patterns at      261 /      261 sites (100.0%),  0:00
Counting codons..


      168 bytes for distance
   149328 bytes for conP
    20808 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
   373320 bytes for conP, adjusted

    0.035925    0.015973    0.102107    0.003815    0.020087    0.014476    0.128281    0.104427    0.173856    0.114961    0.039661    0.300000    1.300000

ntime & nrate & np:    11     2    13

Bounds (np=13):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    13
lnL0 = -2182.721773

Iterating by ming2
Initial: fx=  2182.721773
x=  0.03592  0.01597  0.10211  0.00382  0.02009  0.01448  0.12828  0.10443  0.17386  0.11496  0.03966  0.30000  1.30000

  1 h-m-p  0.0000 0.0004 271.7404 +++    2169.696642  m 0.0004    19 | 0/13
  2 h-m-p  0.0000 0.0001 4076.8510 CYYCC  2168.269170  4 0.0000    42 | 0/13
  3 h-m-p  0.0001 0.0005 463.7711 +YCYYCCC  2145.698253  6 0.0004    69 | 0/13
  4 h-m-p  0.0000 0.0001 1277.8297 +YYCCCC  2138.255990  5 0.0001    94 | 0/13
  5 h-m-p  0.0000 0.0001 1213.9570 +YYCCC  2128.892022  4 0.0001   117 | 0/13
  6 h-m-p  0.0000 0.0002 244.2140 +YCYCC  2127.235486  4 0.0001   140 | 0/13
  7 h-m-p  0.0003 0.0015  79.3816 CCCCC  2126.372964  4 0.0003   164 | 0/13
  8 h-m-p  0.0004 0.0028  69.8297 YCC    2125.986124  2 0.0003   183 | 0/13
  9 h-m-p  0.0004 0.0250  48.1656 ++YYYCYCYCCC  2115.694516  9 0.0123   215 | 0/13
 10 h-m-p  0.0002 0.0009 669.8818 YCCCCCC  2113.212637  6 0.0002   242 | 0/13
 11 h-m-p  0.0030 0.0152   9.1778 YC     2113.183069  1 0.0005   259 | 0/13
 12 h-m-p  0.0033 0.1320   1.5051 +YC    2112.944873  1 0.0102   277 | 0/13
 13 h-m-p  0.0018 0.0187   8.5951 +YCYCCC  2107.830751  5 0.0095   302 | 0/13
 14 h-m-p  0.0006 0.0031  49.0148 CCYC   2107.019128  3 0.0006   323 | 0/13
 15 h-m-p  0.1010 1.9987   0.2890 +CCCC  2102.580828  3 0.4629   346 | 0/13
 16 h-m-p  0.7092 8.0000   0.1886 +YCCCC  2096.172883  4 1.9435   383 | 0/13
 17 h-m-p  1.5121 7.5606   0.1400 CCCCC  2092.114561  4 2.1635   420 | 0/13
 18 h-m-p  1.6000 8.0000   0.1012 CYCC   2091.389777  3 2.0655   454 | 0/13
 19 h-m-p  1.6000 8.0000   0.0586 CCC    2091.223019  2 1.8634   487 | 0/13
 20 h-m-p  1.6000 8.0000   0.0116 CC     2091.185169  1 1.4766   518 | 0/13
 21 h-m-p  1.6000 8.0000   0.0046 CC     2091.172543  1 1.7038   549 | 0/13
 22 h-m-p  1.6000 8.0000   0.0038 YC     2091.171131  1 1.1810   579 | 0/13
 23 h-m-p  1.6000 8.0000   0.0007 CC     2091.170848  1 2.2654   610 | 0/13
 24 h-m-p  1.3668 8.0000   0.0011 C      2091.170809  0 1.6226   639 | 0/13
 25 h-m-p  1.6000 8.0000   0.0001 C      2091.170808  0 1.3906   668 | 0/13
 26 h-m-p  1.6000 8.0000   0.0000 C      2091.170808  0 1.6000   697 | 0/13
 27 h-m-p  1.3211 8.0000   0.0000 C      2091.170808  0 1.3211   726 | 0/13
 28 h-m-p  1.6000 8.0000   0.0000 Y      2091.170808  0 0.4000   755 | 0/13
 29 h-m-p  0.7803 8.0000   0.0000 -C     2091.170808  0 0.0488   785 | 0/13
 30 h-m-p  0.0160 8.0000   0.0001 Y      2091.170808  0 0.0040   814 | 0/13
 31 h-m-p  0.1429 8.0000   0.0000 C      2091.170808  0 0.1940   843 | 0/13
 32 h-m-p  0.1292 8.0000   0.0000 C      2091.170808  0 0.1292   872 | 0/13
 33 h-m-p  0.1045 8.0000   0.0000 C      2091.170808  0 0.1045   901 | 0/13
 34 h-m-p  0.3068 8.0000   0.0000 ---------------..  | 0/13
 35 h-m-p  0.0160 8.0000   0.0047 ---------C  2091.170808  0 0.0000   981 | 0/13
 36 h-m-p  0.0020 1.0179   0.0527 ------------..  | 0/13
 37 h-m-p  0.0160 8.0000   0.0047 ------------- | 0/13
 38 h-m-p  0.0160 8.0000   0.0047 -------------
Out..
lnL  = -2091.170808
1101 lfun, 1101 eigenQcodon, 12111 P(t)

Time used:  0:05


Model 1: NearlyNeutral

TREE #  1
(1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
    0.035925    0.015973    0.102107    0.003815    0.020087    0.014476    0.128281    0.104427    0.173856    0.114961    0.039661    1.948165    0.534390    0.193110

ntime & nrate & np:    11     2    14

Bounds (np=14):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 6.802206

np =    14
lnL0 = -2072.841984

Iterating by ming2
Initial: fx=  2072.841984
x=  0.03592  0.01597  0.10211  0.00382  0.02009  0.01448  0.12828  0.10443  0.17386  0.11496  0.03966  1.94816  0.53439  0.19311

  1 h-m-p  0.0000 0.0012 143.3788 ++CCCC  2071.550025  3 0.0001    41 | 0/14
  2 h-m-p  0.0000 0.0001 111.9674 +YCYCC  2071.119532  4 0.0001    79 | 0/14
  3 h-m-p  0.0000 0.0002 707.4144 +YCCCCC  2068.184956  5 0.0001   120 | 0/14
  4 h-m-p  0.0000 0.0002 694.9286 ++     2062.207536  m 0.0002   151 | 1/14
  5 h-m-p  0.0005 0.0023  31.5464 CCC    2062.156793  2 0.0002   186 | 1/14
  6 h-m-p  0.0004 0.0032  13.7139 YCC    2062.110879  2 0.0003   219 | 1/14
  7 h-m-p  0.0001 0.0080  28.9711 +CCCC  2061.736966  3 0.0009   256 | 1/14
  8 h-m-p  0.0009 0.0078  29.3205 CCC    2061.327292  2 0.0008   290 | 1/14
  9 h-m-p  0.0008 0.0079  28.9973 YCCC   2060.274322  3 0.0013   325 | 1/14
 10 h-m-p  0.0011 0.0056  24.2527 CCC    2059.550308  2 0.0013   359 | 1/14
 11 h-m-p  0.0023 0.0128  13.1743 YC     2059.433261  1 0.0012   390 | 1/14
 12 h-m-p  0.0043 0.0748   3.7643 CC     2059.424382  1 0.0012   422 | 1/14
 13 h-m-p  0.0022 0.2778   2.0137 +CC    2059.395734  1 0.0108   455 | 1/14
 14 h-m-p  0.0010 0.0841  22.4833 +YCCC  2059.145962  3 0.0081   491 | 1/14
 15 h-m-p  0.6235 3.1176   0.1250 CYC    2058.338408  2 0.5922   524 | 1/14
 16 h-m-p  1.6000 8.0000   0.0101 YCC    2058.261074  2 0.8807   557 | 1/14
 17 h-m-p  1.6000 8.0000   0.0026 YC     2058.258026  1 0.8796   588 | 1/14
 18 h-m-p  1.6000 8.0000   0.0002 Y      2058.257961  0 1.1406   618 | 1/14
 19 h-m-p  1.6000 8.0000   0.0001 Y      2058.257958  0 1.0881   648 | 1/14
 20 h-m-p  1.6000 8.0000   0.0000 Y      2058.257957  0 1.0600   678 | 1/14
 21 h-m-p  1.6000 8.0000   0.0000 Y      2058.257957  0 1.0079   708 | 1/14
 22 h-m-p  1.6000 8.0000   0.0000 C      2058.257957  0 1.6000   738 | 1/14
 23 h-m-p  1.6000 8.0000   0.0000 +Y     2058.257957  0 6.4000   769 | 1/14
 24 h-m-p  1.1833 8.0000   0.0000 ----------------..  | 1/14
 25 h-m-p  0.0160 8.0000   0.0023 -------------
Out..
lnL  = -2058.257957
855 lfun, 2565 eigenQcodon, 18810 P(t)

Time used:  0:12


Model 2: PositiveSelection

TREE #  1
(1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
initial w for M2:NSpselection reset.

    0.035925    0.015973    0.102107    0.003815    0.020087    0.014476    0.128281    0.104427    0.173856    0.114961    0.039661    1.773875    1.131355    0.291249    0.418683    2.981222

ntime & nrate & np:    11     3    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 4.734753

np =    16
lnL0 = -2072.091090

Iterating by ming2
Initial: fx=  2072.091090
x=  0.03592  0.01597  0.10211  0.00382  0.02009  0.01448  0.12828  0.10443  0.17386  0.11496  0.03966  1.77387  1.13136  0.29125  0.41868  2.98122

  1 h-m-p  0.0000 0.0007 128.2304 ++CYCC  2071.053991  3 0.0001    44 | 0/16
  2 h-m-p  0.0002 0.0021  91.1157 CYCC   2070.514775  3 0.0002    84 | 0/16
  3 h-m-p  0.0000 0.0002 352.0286 +YCYCC  2069.069371  4 0.0001   126 | 0/16
  4 h-m-p  0.0001 0.0007 292.8864 +YCYC  2065.983419  3 0.0004   166 | 0/16
  5 h-m-p  0.0002 0.0009 257.7820 ++     2058.363987  m 0.0009   201 | 0/16
  6 h-m-p  0.0000 0.0001 538.5314 ++     2056.912226  m 0.0001   236 | 1/16
  7 h-m-p  0.0001 0.0015  90.2185 CYC    2056.787029  2 0.0001   274 | 1/16
  8 h-m-p  0.0006 0.0127  14.1129 +YCC   2056.585716  2 0.0016   312 | 1/16
  9 h-m-p  0.0009 0.0049  23.9554 YCC    2056.509893  2 0.0004   349 | 1/16
 10 h-m-p  0.0007 0.0122  15.6938 +CCC   2056.281480  2 0.0028   388 | 1/16
 11 h-m-p  0.0043 0.0595  10.2424 YC     2056.205632  1 0.0021   423 | 1/16
 12 h-m-p  0.0022 0.2628   9.9913 +YC    2055.548920  1 0.0211   459 | 1/16
 13 h-m-p  0.0036 0.0503  59.1913 YC     2054.186564  1 0.0075   494 | 1/16
 14 h-m-p  0.0047 0.0236  30.0154 CCC    2054.013715  2 0.0019   532 | 1/16
 15 h-m-p  0.0312 1.3068   1.8248 ++YYCC  2051.619677  3 0.3743   572 | 1/16
 16 h-m-p  0.4455 2.2273   1.3291 YYCC   2050.958469  3 0.3973   610 | 1/16
 17 h-m-p  0.5372 3.0595   0.9828 CYCCC  2050.200737  4 0.9374   651 | 1/16
 18 h-m-p  0.9315 4.6575   0.7474 YYCC   2049.962971  3 0.6995   689 | 1/16
 19 h-m-p  1.6000 8.0000   0.1943 CCC    2049.923866  2 0.6135   727 | 1/16
 20 h-m-p  1.6000 8.0000   0.0253 CC     2049.897874  1 1.6987   763 | 1/16
 21 h-m-p  0.6037 8.0000   0.0711 +YC    2049.876422  1 1.6736   799 | 1/16
 22 h-m-p  1.6000 8.0000   0.0714 CC     2049.857295  1 1.5914   835 | 1/16
 23 h-m-p  1.6000 8.0000   0.0578 YCC    2049.813774  2 2.4685   872 | 1/16
 24 h-m-p  0.5110 8.0000   0.2790 +YCCC  2049.741747  3 1.5200   912 | 1/16
 25 h-m-p  1.6000 8.0000   0.1425 YC     2049.716193  1 0.8461   947 | 1/16
 26 h-m-p  0.6193 8.0000   0.1947 YC     2049.698740  1 1.4925   982 | 1/16
 27 h-m-p  1.6000 8.0000   0.1481 CYC    2049.685679  2 1.4034  1019 | 1/16
 28 h-m-p  0.8444 8.0000   0.2461 CCC    2049.677476  2 1.1215  1057 | 1/16
 29 h-m-p  1.6000 8.0000   0.1263 YC     2049.673158  1 0.9590  1092 | 1/16
 30 h-m-p  0.5074 8.0000   0.2387 YC     2049.669540  1 1.1310  1127 | 1/16
 31 h-m-p  1.6000 8.0000   0.1370 C      2049.666823  0 1.6000  1161 | 1/16
 32 h-m-p  1.1179 8.0000   0.1961 CCC    2049.665133  2 1.4449  1199 | 1/16
 33 h-m-p  1.6000 8.0000   0.1063 CC     2049.664082  1 1.2503  1235 | 1/16
 34 h-m-p  0.4705 8.0000   0.2826 YC     2049.663432  1 0.8485  1270 | 1/16
 35 h-m-p  1.2213 8.0000   0.1963 C      2049.662886  0 1.3165  1304 | 1/16
 36 h-m-p  1.6000 8.0000   0.1043 C      2049.662499  0 1.6000  1338 | 1/16
 37 h-m-p  0.5619 8.0000   0.2971 YC     2049.662216  1 1.0897  1373 | 1/16
 38 h-m-p  1.6000 8.0000   0.1863 YC     2049.662056  1 1.1258  1408 | 1/16
 39 h-m-p  0.8530 8.0000   0.2458 C      2049.661922  0 1.1663  1442 | 1/16
 40 h-m-p  1.6000 8.0000   0.1528 C      2049.661832  0 1.5157  1476 | 1/16
 41 h-m-p  0.7561 8.0000   0.3064 C      2049.661769  0 0.8429  1510 | 1/16
 42 h-m-p  1.1960 8.0000   0.2159 C      2049.661720  0 1.3244  1544 | 1/16
 43 h-m-p  1.6000 8.0000   0.1421 C      2049.661680  0 2.3861  1578 | 1/16
 44 h-m-p  1.0743 8.0000   0.3156 C      2049.661649  0 1.1168  1612 | 1/16
 45 h-m-p  1.6000 8.0000   0.2147 Y      2049.661635  0 0.7951  1646 | 1/16
 46 h-m-p  0.4866 8.0000   0.3508 +Y     2049.661620  0 1.4591  1681 | 1/16
 47 h-m-p  1.6000 8.0000   0.2563 C      2049.661606  0 2.5470  1715 | 1/16
 48 h-m-p  1.6000 8.0000   0.3124 C      2049.661599  0 1.3832  1749 | 1/16
 49 h-m-p  1.6000 8.0000   0.1967 C      2049.661595  0 1.5417  1783 | 1/16
 50 h-m-p  0.7754 8.0000   0.3912 +Y     2049.661592  0 1.9394  1818 | 1/16
 51 h-m-p  1.6000 8.0000   0.3314 C      2049.661591  0 1.5585  1852 | 1/16
 52 h-m-p  1.3264 8.0000   0.3894 Y      2049.661590  0 2.2580  1886 | 1/16
 53 h-m-p  1.6000 8.0000   0.2742 C      2049.661589  0 2.4957  1920 | 1/16
 54 h-m-p  1.6000 8.0000   0.4128 Y      2049.661589  0 3.0821  1954 | 1/16
 55 h-m-p  1.6000 8.0000   0.3174 C      2049.661589  0 1.6000  1988 | 1/16
 56 h-m-p  1.6000 8.0000   0.2678 C      2049.661589  0 2.3149  2022 | 1/16
 57 h-m-p  0.3968 8.0000   1.5624 C      2049.661589  0 0.4626  2056 | 1/16
 58 h-m-p  1.6000 8.0000   0.0535 C      2049.661589  0 1.4838  2090 | 1/16
 59 h-m-p  0.2190 8.0000   0.3627 +C     2049.661589  0 1.1678  2125 | 1/16
 60 h-m-p  1.6000 8.0000   0.0017 Y      2049.661589  0 1.2112  2159 | 1/16
 61 h-m-p  0.0160 8.0000   0.1657 --Y    2049.661589  0 0.0005  2195 | 1/16
 62 h-m-p  0.0160 8.0000   0.0079 Y      2049.661589  0 0.0160  2229 | 1/16
 63 h-m-p  0.3744 8.0000   0.0003 ---------------..  | 1/16
 64 h-m-p  0.0160 8.0000   0.0002 -C     2049.661589  0 0.0010  2311 | 1/16
 65 h-m-p  0.0160 8.0000   0.0001 --------C  2049.661589  0 0.0000  2353
Out..
lnL  = -2049.661589
2354 lfun, 9416 eigenQcodon, 77682 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -2058.070785  S = -1900.204707  -150.178287
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 153 patterns   0:42
	did  20 / 153 patterns   0:42
	did  30 / 153 patterns   0:42
	did  40 / 153 patterns   0:42
	did  50 / 153 patterns   0:42
	did  60 / 153 patterns   0:42
	did  70 / 153 patterns   0:42
	did  80 / 153 patterns   0:42
	did  90 / 153 patterns   0:42
	did 100 / 153 patterns   0:42
	did 110 / 153 patterns   0:42
	did 120 / 153 patterns   0:42
	did 130 / 153 patterns   0:42
	did 140 / 153 patterns   0:42
	did 150 / 153 patterns   0:42
	did 153 / 153 patterns   0:42
Time used:  0:42


Model 3: discrete

TREE #  1
(1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
    0.035925    0.015973    0.102107    0.003815    0.020087    0.014476    0.128281    0.104427    0.173856    0.114961    0.039661    2.029192    0.960589    0.897086    0.298955    0.769030    1.047307

ntime & nrate & np:    11     4    17

Bounds (np=17):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 6.351429

np =    17
lnL0 = -2081.927271

Iterating by ming2
Initial: fx=  2081.927271
x=  0.03592  0.01597  0.10211  0.00382  0.02009  0.01448  0.12828  0.10443  0.17386  0.11496  0.03966  2.02919  0.96059  0.89709  0.29896  0.76903  1.04731

  1 h-m-p  0.0000 0.0011 133.3112 ++YCCC  2081.031906  3 0.0001    46 | 0/17
  2 h-m-p  0.0000 0.0002  66.4089 YCYCCC  2080.804882  5 0.0001    91 | 0/17
  3 h-m-p  0.0000 0.0002 498.6983 +YYC   2080.183065  2 0.0000   131 | 0/17
  4 h-m-p  0.0001 0.0013 235.9892 ++     2070.001298  m 0.0013   168 | 1/17
  5 h-m-p  0.0013 0.0067  37.5796 -CCC   2069.968148  2 0.0001   210 | 1/17
  6 h-m-p  0.0001 0.0104  33.1381 ++YYC  2069.553927  2 0.0019   250 | 1/17
  7 h-m-p  0.0003 0.0013 240.7547 +YCCC  2068.349467  3 0.0008   292 | 1/17
  8 h-m-p  0.0004 0.0019 425.9370 CCC    2067.269718  2 0.0004   332 | 1/17
  9 h-m-p  0.0006 0.0088 279.8211 YC     2064.887730  1 0.0014   369 | 1/17
 10 h-m-p  0.0032 0.0159  81.7372 YCC    2063.887239  2 0.0021   408 | 1/17
 11 h-m-p  0.0036 0.0180  18.6413 CCC    2063.356627  2 0.0050   448 | 1/17
 12 h-m-p  0.0024 0.0688  38.7271 +CCC   2060.652600  2 0.0123   489 | 1/17
 13 h-m-p  0.0032 0.0160  57.9194 CYC    2059.730745  2 0.0028   528 | 1/17
 14 h-m-p  0.0141 0.1041  11.6660 +CCCC  2055.142212  3 0.0650   571 | 1/17
 15 h-m-p  0.0615 0.3075   4.8376 YCCCC  2053.134549  4 0.1408   614 | 1/17
 16 h-m-p  0.2861 1.4752   2.3804 YCC    2052.249804  2 0.1657   653 | 1/17
 17 h-m-p  0.3022 2.5832   1.3049 CCCCC  2050.941292  4 0.4592   697 | 1/17
 18 h-m-p  0.3771 1.8853   1.5235 YCC    2050.617619  2 0.1722   736 | 1/17
 19 h-m-p  0.7532 7.8210   0.3483 CYC    2050.393195  2 0.7226   775 | 1/17
 20 h-m-p  0.8302 5.6425   0.3031 YCCC   2050.106424  3 1.8159   816 | 1/17
 21 h-m-p  0.6372 3.1862   0.3686 YC     2049.841781  1 1.2387   853 | 1/17
 22 h-m-p  0.4022 2.0109   0.1682 YC     2049.736894  1 0.9943   890 | 1/17
 23 h-m-p  0.1608 0.8041   0.2581 ++     2049.676340  m 0.8041   926 | 1/17
 24 h-m-p  0.0063 0.1595  27.3381 --YC   2049.676118  1 0.0002   965 | 1/17
 25 h-m-p  0.0164 0.0821   0.0561 ++     2049.673761  m 0.0821  1001 | 2/17
 26 h-m-p  0.2192 8.0000   0.0210 +C     2049.662890  0 0.9031  1038 | 2/17
 27 h-m-p  0.3089 8.0000   0.0613 YC     2049.662064  1 0.1608  1074 | 2/17
 28 h-m-p  1.6000 8.0000   0.0044 YC     2049.661668  1 0.8156  1110 | 2/17
 29 h-m-p  1.6000 8.0000   0.0019 Y      2049.661595  0 1.0703  1145 | 2/17
 30 h-m-p  1.6000 8.0000   0.0002 Y      2049.661589  0 1.0043  1180 | 2/17
 31 h-m-p  0.8218 8.0000   0.0003 C      2049.661589  0 0.8743  1215 | 2/17
 32 h-m-p  0.7558 8.0000   0.0003 C      2049.661589  0 0.6115  1250 | 2/17
 33 h-m-p  1.6000 8.0000   0.0000 Y      2049.661589  0 0.6556  1285 | 2/17
 34 h-m-p  1.6000 8.0000   0.0000 C      2049.661589  0 0.6055  1320 | 2/17
 35 h-m-p  1.5482 8.0000   0.0000 ---Y   2049.661589  0 0.0060  1358
Out..
lnL  = -2049.661589
1359 lfun, 5436 eigenQcodon, 44847 P(t)

Time used:  0:59


Model 7: beta

TREE #  1
(1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
    0.035925    0.015973    0.102107    0.003815    0.020087    0.014476    0.128281    0.104427    0.173856    0.114961    0.039661    2.029192    0.496071    1.323761

ntime & nrate & np:    11     1    14

Bounds (np=14):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 9.840125

np =    14
lnL0 = -2079.588119

Iterating by ming2
Initial: fx=  2079.588119
x=  0.03592  0.01597  0.10211  0.00382  0.02009  0.01448  0.12828  0.10443  0.17386  0.11496  0.03966  2.02919  0.49607  1.32376

  1 h-m-p  0.0000 0.0004 108.0166 ++YCCC  2079.028135  3 0.0001    40 | 0/14
  2 h-m-p  0.0001 0.0009  81.8349 YCCC   2078.980437  3 0.0000    76 | 0/14
  3 h-m-p  0.0000 0.0011  60.8666 +CCCC  2078.801064  3 0.0002   114 | 0/14
  4 h-m-p  0.0001 0.0042  63.2823 +CCCC  2078.153643  3 0.0008   152 | 0/14
  5 h-m-p  0.0007 0.0044  65.3691 CYC    2077.608681  2 0.0008   186 | 0/14
  6 h-m-p  0.0002 0.0021 276.6142 +YCC   2076.165709  2 0.0005   221 | 0/14
  7 h-m-p  0.0017 0.0087  48.6029 CYC    2075.985685  2 0.0004   255 | 0/14
  8 h-m-p  0.0005 0.0061  41.6614 CC     2075.831601  1 0.0005   288 | 0/14
  9 h-m-p  0.0016 0.0300  13.3068 YC     2075.674328  1 0.0028   320 | 0/14
 10 h-m-p  0.0004 0.0022  98.5516 YYC    2075.544978  2 0.0003   353 | 0/14
 11 h-m-p  0.0002 0.0087 143.9562 ++YCYYCCCC  2070.894228  7 0.0055   398 | 0/14
 12 h-m-p  0.0003 0.0016 294.3018 YYYCC  2070.517280  4 0.0003   434 | 0/14
 13 h-m-p  0.0382 0.4053   2.3502 CYC    2070.281689  2 0.0329   468 | 0/14
 14 h-m-p  0.0008 0.0124  93.9398 +YYYYYYYYY  2069.214270  8 0.0033   508 | 0/14
 15 h-m-p  0.0112 0.0561   7.1311 CCCCC  2067.029933  4 0.0314   548 | 0/14
 16 h-m-p  0.0799 0.3993   0.4289 YCYCCCC  2066.213980  6 0.1231   589 | 0/14
 17 h-m-p  0.0382 1.0916   1.3812 +CCCC  2064.098711  3 0.2063   627 | 0/14
 18 h-m-p  0.1771 0.8854   0.3506 +YYCYC  2060.196963  4 0.6075   665 | 0/14
 19 h-m-p  0.0560 0.2802   0.3300 CYCC   2059.957339  3 0.0731   701 | 0/14
 20 h-m-p  0.0230 0.1150   0.9047 +YYC   2058.562576  2 0.1000   735 | 0/14
 21 h-m-p  0.6068 3.0341   0.0422 YCCC   2058.275164  3 1.2708   771 | 0/14
 22 h-m-p  0.9168 4.5839   0.0258 YC     2058.260468  1 1.5589   803 | 0/14
 23 h-m-p  1.6000 8.0000   0.0027 YC     2058.260083  1 1.0274   835 | 0/14
 24 h-m-p  1.6000 8.0000   0.0002 C      2058.260064  0 1.9709   866 | 0/14
 25 h-m-p  1.6000 8.0000   0.0001 ++     2058.260019  m 8.0000   897 | 0/14
 26 h-m-p  1.2461 6.2307   0.0003 C      2058.260004  0 1.7359   928 | 0/14
 27 h-m-p  1.1427 5.7134   0.0002 Y      2058.259999  0 2.8328   959 | 0/14
 28 h-m-p  0.6287 3.1435   0.0002 +Y     2058.259998  0 2.0881   991 | 0/14
 29 h-m-p  0.2251 1.1256   0.0002 ++     2058.259997  m 1.1256  1022 | 0/14
 30 h-m-p -0.0000 -0.0000   0.0003 
h-m-p:     -0.00000000e+00     -0.00000000e+00      3.39192185e-04  2058.259997
..  | 0/14
 31 h-m-p  0.0012 0.5961   0.0135 Y      2058.259997  0 0.0002  1081 | 0/14
 32 h-m-p  0.0004 0.1965   0.0339 -Y     2058.259997  0 0.0000  1113 | 0/14
 33 h-m-p  0.0007 0.3389   0.0133 C      2058.259997  0 0.0010  1144 | 0/14
 34 h-m-p  0.0004 0.1407   0.0305 Y      2058.259997  0 0.0002  1175 | 0/14
 35 h-m-p  0.0005 0.2411   0.0171 Y      2058.259997  0 0.0008  1206 | 0/14
 36 h-m-p  0.0009 0.2847   0.0153 C      2058.259997  0 0.0002  1237 | 0/14
 37 h-m-p  0.0021 1.0644   0.0047 -C     2058.259997  0 0.0001  1269 | 0/14
 38 h-m-p  0.0029 1.4660   0.0033 Y      2058.259997  0 0.0004  1300 | 0/14
 39 h-m-p  0.0007 0.0556   0.0019 --C    2058.259997  0 0.0000  1333 | 0/14
 40 h-m-p  0.0001 0.0303   0.0020 -------C  2058.259997  0 0.0000  1371 | 0/14
 41 h-m-p  0.0000 0.0063   0.0101 --------..  | 0/14
 42 h-m-p  0.0005 0.2302   0.0153 -----------
Out..
lnL  = -2058.259997
1449 lfun, 15939 eigenQcodon, 159390 P(t)

Time used:  2:00


Model 8: beta&w>1

TREE #  1
(1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
initial w for M8:NSbetaw>1 reset.

    0.035925    0.015973    0.102107    0.003815    0.020087    0.014476    0.128281    0.104427    0.173856    0.114961    0.039661    1.772034    0.900000    0.225525    1.016293    2.374037

ntime & nrate & np:    11     2    16

Bounds (np=16):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 8.790674

np =    16
lnL0 = -2057.692615

Iterating by ming2
Initial: fx=  2057.692615
x=  0.03592  0.01597  0.10211  0.00382  0.02009  0.01448  0.12828  0.10443  0.17386  0.11496  0.03966  1.77203  0.90000  0.22553  1.01629  2.37404

  1 h-m-p  0.0000 0.0001 142.2259 +YCYCCC  2056.892514  5 0.0001    46 | 0/16
  2 h-m-p  0.0000 0.0001 851.6481 +YYCC  2055.179498  3 0.0000    86 | 0/16
  3 h-m-p  0.0002 0.0011 178.4789 YCCC   2052.633726  3 0.0003   126 | 0/16
  4 h-m-p  0.0002 0.0010  56.6642 CCCC   2052.223344  3 0.0003   167 | 0/16
  5 h-m-p  0.0003 0.0021  57.5227 CCC    2051.931114  2 0.0003   206 | 0/16
  6 h-m-p  0.0003 0.0035  67.1910 CCC    2051.748484  2 0.0002   245 | 0/16
  7 h-m-p  0.0004 0.0021  43.5955 CCCC   2051.546597  3 0.0005   286 | 0/16
  8 h-m-p  0.0003 0.0029  75.5328 +YCCC  2051.094961  3 0.0007   327 | 0/16
  9 h-m-p  0.0003 0.0014  77.1343 CCCC   2050.908499  3 0.0003   368 | 0/16
 10 h-m-p  0.0003 0.0016  91.9513 YCCC   2050.602688  3 0.0005   408 | 0/16
 11 h-m-p  0.0028 0.0138  11.9839 CC     2050.553334  1 0.0010   445 | 0/16
 12 h-m-p  0.0028 0.1845   4.4278 CC     2050.521840  1 0.0038   482 | 0/16
 13 h-m-p  0.0009 0.4062  19.0485 ++CYC  2050.034238  2 0.0157   522 | 0/16
 14 h-m-p  0.0043 0.0217  22.6286 CC     2050.000385  1 0.0009   559 | 0/16
 15 h-m-p  0.0266 7.8623   0.7943 +YC    2049.901642  1 0.2128   596 | 0/16
 16 h-m-p  0.3029 1.5143   0.4970 YCCC   2049.780640  3 0.5325   636 | 0/16
 17 h-m-p  0.3754 1.8771   0.1137 YCC    2049.706670  2 0.6456   674 | 0/16
 18 h-m-p  0.3015 1.5076   0.0804 ++     2049.668522  m 1.5076   709 | 0/16
 19 h-m-p -0.0000 -0.0000   0.0232 
h-m-p:     -7.64827072e-17     -3.82413536e-16      2.31578437e-02  2049.668522
..  | 0/16
 20 h-m-p  0.0000 0.0046   6.7904 ++YC   2049.666010  1 0.0001   779 | 1/16
 21 h-m-p  0.0001 0.0007  11.4069 YC     2049.665221  1 0.0000   815 | 1/16
 22 h-m-p  0.0001 0.0327   3.5519 +C     2049.663709  0 0.0003   850 | 1/16
 23 h-m-p  0.0003 0.0275   4.2019 C      2049.662701  0 0.0002   884 | 1/16
 24 h-m-p  0.0011 0.3403   0.9085 C      2049.662619  0 0.0002   918 | 1/16
 25 h-m-p  0.0003 0.1329   0.7446 Y      2049.662532  0 0.0005   952 | 1/16
 26 h-m-p  0.0005 0.1555   0.7037 C      2049.662508  0 0.0002   986 | 1/16
 27 h-m-p  0.0007 0.3300   0.3299 Y      2049.662491  0 0.0005  1020 | 1/16
 28 h-m-p  0.0015 0.7664   0.4407 Y      2049.662466  0 0.0007  1054 | 1/16
 29 h-m-p  0.0036 1.7903   0.2638 Y      2049.662425  0 0.0026  1088 | 1/16
 30 h-m-p  0.0081 4.0700   0.8923 C      2049.662064  0 0.0072  1122 | 1/16
 31 h-m-p  0.0015 0.7592   5.0847 C      2049.661663  0 0.0014  1156 | 1/16
 32 h-m-p  0.0860 3.7650   0.0842 --C    2049.661660  0 0.0011  1192 | 1/16
 33 h-m-p  0.0160 8.0000   0.0462 +C     2049.661589  0 0.0947  1227 | 1/16
 34 h-m-p  1.6000 8.0000   0.0000 Y      2049.661589  0 1.0643  1261 | 1/16
 35 h-m-p  1.6000 8.0000   0.0000 ----------Y  2049.661589  0 0.0000  1305
Out..
lnL  = -2049.661589
1306 lfun, 15672 eigenQcodon, 158026 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -2057.320176  S = -1900.242880  -150.043584
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 153 patterns   3:01
	did  20 / 153 patterns   3:01
	did  30 / 153 patterns   3:01
	did  40 / 153 patterns   3:02
	did  50 / 153 patterns   3:02
	did  60 / 153 patterns   3:02
	did  70 / 153 patterns   3:02
	did  80 / 153 patterns   3:02
	did  90 / 153 patterns   3:03
	did 100 / 153 patterns   3:03
	did 110 / 153 patterns   3:03
	did 120 / 153 patterns   3:03
	did 130 / 153 patterns   3:03
	did 140 / 153 patterns   3:03
	did 150 / 153 patterns   3:04
	did 153 / 153 patterns   3:04
Time used:  3:04
CodeML output code: -1

CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 

D_melanogaster_Bsg-PI   MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS
D_sechellia_Bsg-PI      MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS
D_simulans_Bsg-PI       MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS
D_yakuba_Bsg-PI         MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
D_erecta_Bsg-PI         MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
D_ficusphila_Bsg-PI     MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS
D_elegans_Bsg-PI        MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS
                        *****  . :   ****** *************  ********: *****

D_melanogaster_Bsg-PI   CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD
D_sechellia_Bsg-PI      CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD
D_simulans_Bsg-PI       CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
D_yakuba_Bsg-PI         CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD
D_erecta_Bsg-PI         CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
D_ficusphila_Bsg-PI     CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD
D_elegans_Bsg-PI        CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD
                        **** .*.. :***:**.* **:*.** ****:*  **********..**

D_melanogaster_Bsg-PI   GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
D_sechellia_Bsg-PI      GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
D_simulans_Bsg-PI       GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT
D_yakuba_Bsg-PI         GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
D_erecta_Bsg-PI         GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
D_ficusphila_Bsg-PI     GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS
D_elegans_Bsg-PI        GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI
                        * ***. .  :: * *****:*******************:**** *:* 

D_melanogaster_Bsg-PI   WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
D_sechellia_Bsg-PI      WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
D_simulans_Bsg-PI       WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
D_yakuba_Bsg-PI         WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA
D_erecta_Bsg-PI         WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
D_ficusphila_Bsg-PI     WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA
D_elegans_Bsg-PI        WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA
                        ***.****** *** ::*.  :.********:****:***:*** *:***

D_melanogaster_Bsg-PI   NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
D_sechellia_Bsg-PI      NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
D_simulans_Bsg-PI       NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
D_yakuba_Bsg-PI         NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK
D_erecta_Bsg-PI         DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
D_ficusphila_Bsg-PI     NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
D_elegans_Bsg-PI        NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
                        : .. *  .*: * * **:***.***************************

D_melanogaster_Bsg-PI   RRNKSELEESDTDPQEQ-
D_sechellia_Bsg-PI      RRNKSELEESDTDPQEQ-
D_simulans_Bsg-PI       RRNKSELEESDTDPQEQ-
D_yakuba_Bsg-PI         RRNKSELEESDTDPQEQo
D_erecta_Bsg-PI         RRNKSELEESDTDPQEQ-
D_ficusphila_Bsg-PI     RRNKSELEESDTDPQEQ-
D_elegans_Bsg-PI        RRNKSELEESDTDPQEQ-
                        ***************** 

>D_melanogaster_Bsg-PI
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
CCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGATGTACCTTCTCTCAGAGGTCGCTTTAAGTTAA
TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTTGACGGCGTGTCCAAGGAAATCGAAGTAAT
TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAAACCAGAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAATGCCACAGATCGCTTCATTCT
CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGATAATG
TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
AATGTCTACGGTGGGAAC------ACCACCACTCCTGCCAGCGACGTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>D_sechellia_Bsg-PI
ATGGAGGCAAAATTCTGGCTAGCGCTCTTTCATTCCTCCTCGATATTTTT
AGCAATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG
CCATGCATCAAATGAAATTTTACGACATCAGATCGCCACTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTACCTTCTCTAATAGGTCGCTTTAAGTTAA
TCCCAGACGAGAATAAGTTCATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT
TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AAAAGATGTCGGTGACCTGCAGTGTTGTGGGTACCAAACCAGAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT
CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG
TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
AATGTCCACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACTTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>D_simulans_Bsg-PI
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG
CCAAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA
TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT
TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAATCCAGAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT
CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG
TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
AATGTCTACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACGTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>D_yakuba_Bsg-PI
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
TCGAACATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACAGTACGCCGGGCGGCCTGCTCATATGGAGAAAGAA
CGGCACCGTTGTGACGGAAGTAGCTTCTCTAAGAGGTCGCTTTAAGTTAA
TCCCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGACCGACGAT
GGCGAATACAGTTGCGAGTACAGTGGAGAGACCAAGAAAATCGAAGTAAT
TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCACAGTTGACA
TGGACCTTTGGCAATGTAACGCTGACAAACGACACAGATCGCGTCATCGT
CAAACCAGAT---AATGGTGTTCCTAACGCCATTCTGACACTGGACAATG
TGACATTGGACGACAGAGGCGAATACAAATGCACTGGAAAAAATGCGGCC
AATGAATACGCTAAGAAC------ACCACTACTCTTGCCACCGACGCCAC
AACTCTTCGTGTTAAGAGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>D_erecta_Bsg-PI
ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG
TCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC
TGCAACGTGAAAGACGGTACGCCAGGCGGCGTGCTCATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA
TCGCAGACGAGAACAAGTTTATCATCGATAAGACGGATACGAACGACGAT
GGCAAATACAGTTGCGAGTTCGACGGAGTGTCCAAGGAAATCGAAGTGAT
TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCTCAGTTGACA
TGGACCTTTGCCAATGTAACGCTGACAAACGGCACAGATCGCTTCATCCT
CAAACCAGACGATAATGGTGTTCCCAACGCCATTCTGACACTGGATAATG
TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC
GATGCCTTCGGTGGGAAC------AACACCACTCCTGCCAGCGACTTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>D_ficusphila_Bsg-PI
ATGGAGGCGAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA
TCGAGCATCAAATGAAATTTTACGACATCAGACACCCGCTGGTTCTCAGC
TGCAACGTGAAA---GACACGCCGGGC---GTGCTTATATGGAAAAAGAA
CAACACCGATGTGACGCAGGTGCCTTCGCTGAAAGGTCGCTTTAAGCTAA
TCGAAGCCGAGAACAAGTTCATCATCGACAAGACGGACGCATCCGACGAT
GGTCTTTACAGTTGCTCGATCAACGAAGAGTCCCGGAATATCACAGTGAT
TGCCCGCGTTATTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG
AGAAGATGTCGGTGACCTGCAGCGTTGTTGGTACCGATCCCCAGTTGTCA
TGGACCTTTGGCAATGTAACGCTGACAAACTCCACAGATCGTTACATCCT
CAAGGCGGACGAGGACAATGTCCCCAACGCCATTCTGACATTGGACAATG
TGACATTGGACGACAGAGGCGACTACAAATGCATTGGACGCAATGCGGCC
AATGACTACGGTGTGAATGGCACCAACACCGCCCCTGCCATCGACGTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTACGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA
G---
>D_elegans_Bsg-PI
ATGGAGGCAAAATTCTTGGCTGGCGCTCTTTCATTCCTCTCGATATTTTT
AGCGATTAATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA
TCGAGCATCAAATGAAATTTTACGACATCAAAACGCCGCTGGTTCTCAGC
TGCAACGTGAAAGAAGATACGTCGAGC---GTTCTTATATGGAAAAAGAA
CGGCACCGCTGTGACGGAGGTGCCTTCGCTAAAGGGTCGCTTTAAGATAA
TCGCAGCCGAGAATAAGTTCATCATCGACAAGACGGATGTAAGCGATGAT
GGCGATTACAGTTGCGAGATCGACGGAGAGTCCAAGATAATCAAAGTGAT
TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGAG
AGAAGATGTCGGTGACTTGCACCGTTGTGGGTACCGCACCACAGTTGATA
TGGACTTTTGGCAATGTAACGCTGACAAACTCAACGGATCGCTTCGTCCT
CAAACCA---GAAAACAATGTCCCCAACGCCATTCTGACACTGGACAATG
TGACATTGCAAGACAGAGGCGAGTACAAATGCATTGGACGCAATGCGGCC
AATGACTATGGTGTGAACGGCACCAGCACTGCTCCTGCCAGCGACTTCAC
AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA
TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTATGAGAAG
CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCTCAAGAACA
G---

>D_melanogaster_Bsg-PI
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>D_sechellia_Bsg-PI
MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>D_simulans_Bsg-PI
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT
WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA
NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>D_yakuba_Bsg-PI
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD
GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA
NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>D_erecta_Bsg-PI
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS
CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD
GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT
WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA
DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>D_ficusphila_Bsg-PI
MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS
CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD
GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS
WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA
NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ
>D_elegans_Bsg-PI
MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS
CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD
GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI
WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA
NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK
RRNKSELEESDTDPQEQ

#NEXUS

[ID: 8781855650]
begin taxa;
	dimensions ntax=7;
	taxlabels
		D_melanogaster_Bsg-PI
		D_sechellia_Bsg-PI
		D_simulans_Bsg-PI
		D_yakuba_Bsg-PI
		D_erecta_Bsg-PI
		D_ficusphila_Bsg-PI
		D_elegans_Bsg-PI
		;
end;
begin trees;
	translate
		1	D_melanogaster_Bsg-PI,
		2	D_sechellia_Bsg-PI,
		3	D_simulans_Bsg-PI,
		4	D_yakuba_Bsg-PI,
		5	D_erecta_Bsg-PI,
		6	D_ficusphila_Bsg-PI,
		7	D_elegans_Bsg-PI
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.01106371,(2:0.03630922,3:0.002061144)1.000:0.007738398,((4:0.05011493,(6:0.06539171,7:0.04434277)1.000:0.04402326)0.816:0.00742761,5:0.01448691)1.000:0.007946853);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.01106371,(2:0.03630922,3:0.002061144):0.007738398,((4:0.05011493,(6:0.06539171,7:0.04434277):0.04402326):0.00742761,5:0.01448691):0.007946853);
end;

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2170.37         -2182.12
2      -2170.31         -2182.62
--------------------------------------
TOTAL    -2170.34         -2182.40
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/27/Bsg-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.296725    0.000675    0.245401    0.344745    0.295780   1344.42   1422.71    1.000
r(A<->C){all}   0.120200    0.000650    0.070784    0.168646    0.119392    909.09    987.91    1.000
r(A<->G){all}   0.239513    0.001193    0.175024    0.307715    0.238396    923.33    927.48    1.000
r(A<->T){all}   0.135747    0.000721    0.084164    0.188177    0.134125   1025.45   1038.76    1.001
r(C<->G){all}   0.117920    0.000676    0.071020    0.172710    0.115986   1160.32   1180.84    1.000
r(C<->T){all}   0.309875    0.001541    0.234620    0.387386    0.309105    923.16    940.72    1.000
r(G<->T){all}   0.076746    0.000445    0.039363    0.120003    0.075351   1191.63   1224.99    1.001
pi(A){all}      0.278964    0.000226    0.250224    0.308742    0.278930   1311.63   1345.58    1.000
pi(C){all}      0.232562    0.000190    0.206309    0.259725    0.232253   1174.23   1238.77    1.000
pi(G){all}      0.248120    0.000211    0.218584    0.274629    0.247951   1136.20   1147.11    1.000
pi(T){all}      0.240354    0.000204    0.213288    0.268990    0.240204   1352.34   1353.81    1.000
alpha{1,2}      0.622238    0.104769    0.166565    1.267592    0.544318   1483.16   1488.64    1.000
alpha{3}        1.225757    0.381416    0.367951    2.461108    1.109182   1501.00   1501.00    1.000
pinvar{all}     0.142587    0.010385    0.000038    0.337315    0.125752   1273.30   1327.26    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple

CODONML (in paml version 4.8, March 2014)  /opt/ADOPS/27/Bsg-PI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =   7  ls = 261

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   6   6   5   5   6   5 | Ser TCT   1   1   1   1   1   0 | Tyr TAT   3   3   3   3   3   2 | Cys TGT   1   1   1   1   1   1
    TTC   5   6   6   4   7   4 |     TCC   1   3   1   0   1   3 |     TAC   4   3   4   5   3   6 |     TGC   5   5   5   5   5   5
Leu TTA   2   2   2   2   2   1 |     TCA   3   2   3   3   3   4 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   4   4   5   4   4   5 |     TCG   3   3   3   3   3   4 |     TAG   0   0   0   0   0   0 | Trp TGG   3   4   3   3   3   3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   2   1   2   4   2   4 | Pro CCT   5   5   5   3   5   4 | His CAT   1   2   1   1   1   1 | Arg CGT   1   1   1   1   1   2
    CTC   7   6   6   5   6   4 |     CCC   1   1   1   1   2   3 |     CAC   0   1   0   0   0   1 |     CGC   4   4   4   4   4   4
    CTA   0   2   1   1   1   1 |     CCA   3   5   3   4   3   1 | Gln CAA   3   3   3   3   3   3 |     CGA   3   3   3   1   2   1
    CTG   8   7   7   9   8   9 |     CCG   2   1   2   2   1   2 |     CAG   1   1   1   2   2   3 |     CGG   0   0   0   0   0   1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   8   7   7   6   7   7 | Thr ACT   3   2   2   5   3   2 | Asn AAT   8   8   8   7   6   9 | Ser AGT   2   3   2   4   2   2
    ATC   8   9   9   9   9  13 |     ACC   6   6   6   8   5   5 |     AAC   8   8   9   8  10  10 |     AGC   5   3   5   5   5   4
    ATA   2   3   2   2   2   2 |     ACA   7   7   7   7   7   7 | Lys AAA   9   9   8   9   9   7 | Arg AGA   3   2   3   5   4   3
Met ATG   3   4   3   3   3   3 |     ACG   5   5   5   5   5   4 |     AAG  10  10  11  11  10  10 |     AGG   0   0   0   0   0   0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   7   7   7   8   7   6 | Ala GCT   5   4   6   6   5   4 | Asp GAT  10   8   8   8  10   8 | Gly GGT   6   6   6   3   5   5
    GTC   2   1   2   3   1   2 |     GCC  10  10  10   8   9   9 |     GAC   7   6   6   8   7  12 |     GGC   7   6   6   6   7   5
    GTA   4   3   3   4   3   2 |     GCA   2   2   2   1   2   1 | Glu GAA   6   8   8   8   5   4 |     GGA   1   2   2   3   3   1
    GTG  12  12  12   9  13  13 |     GCG   2   2   2   2   2   4 |     GAG  10  11  11  10  11  10 |     GGG   1   1   1   0   1   0
--------------------------------------------------------------------------------------------------------------------------------------

------------------------------------------------------
Phe TTT   5 | Ser TCT   0 | Tyr TAT   3 | Cys TGT   1
    TTC   6 |     TCC   1 |     TAC   3 |     TGC   5
Leu TTA   1 |     TCA   4 | *** TAA   0 | *** TGA   0
    TTG   4 |     TCG   4 |     TAG   0 | Trp TGG   3
------------------------------------------------------
Leu CTT   3 | Pro CCT   5 | His CAT   1 | Arg CGT   1
    CTC   4 |     CCC   1 |     CAC   0 |     CGC   5
    CTA   1 |     CCA   3 | Gln CAA   4 |     CGA   1
    CTG   9 |     CCG   1 |     CAG   2 |     CGG   0
------------------------------------------------------
Ile ATT   6 | Thr ACT   5 | Asn AAT   9 | Ser AGT   2
    ATC  11 |     ACC   3 |     AAC   8 |     AGC   6
    ATA   5 |     ACA   5 | Lys AAA   9 | Arg AGA   2
Met ATG   3 |     ACG   6 |     AAG  11 |     AGG   0
------------------------------------------------------
Val GTT   7 | Ala GCT   6 | Asp GAT  10 | Gly GGT   3
    GTC   2 |     GCC   8 |     GAC   7 |     GGC   7
    GTA   3 |     GCA   3 | Glu GAA   2 |     GGA   3
    GTG  13 |     GCG   2 |     GAG  13 |     GGG   0
------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: D_melanogaster_Bsg-PI             
position  1:    T:0.15709    C:0.15709    A:0.33333    G:0.35249
position  2:    T:0.30651    C:0.22605    A:0.30651    G:0.16092
position  3:    T:0.26437    C:0.30651    A:0.18391    G:0.24521
Average         T:0.24266    C:0.22989    A:0.27458    G:0.25287

#2: D_sechellia_Bsg-PI             
position  1:    T:0.16475    C:0.16475    A:0.32950    G:0.34100
position  2:    T:0.30651    C:0.22605    A:0.31034    G:0.15709
position  3:    T:0.24904    C:0.29885    A:0.20307    G:0.24904
Average         T:0.24010    C:0.22989    A:0.28097    G:0.24904

#3: D_simulans_Bsg-PI             
position  1:    T:0.16092    C:0.15326    A:0.33333    G:0.35249
position  2:    T:0.30268    C:0.22605    A:0.31034    G:0.16092
position  3:    T:0.24904    C:0.30651    A:0.19157    G:0.25287
Average         T:0.23755    C:0.22861    A:0.27842    G:0.25543

#4: D_yakuba_Bsg-PI             
position  1:    T:0.14943    C:0.15709    A:0.36015    G:0.33333
position  2:    T:0.29885    C:0.22605    A:0.31801    G:0.15709
position  3:    T:0.25287    C:0.30268    A:0.20307    G:0.24138
Average         T:0.23372    C:0.22861    A:0.29374    G:0.24393

#5: D_erecta_Bsg-PI             
position  1:    T:0.16092    C:0.15709    A:0.33333    G:0.34866
position  2:    T:0.31034    C:0.21839    A:0.30651    G:0.16475
position  3:    T:0.24904    C:0.31034    A:0.18774    G:0.25287
Average         T:0.24010    C:0.22861    A:0.27586    G:0.25543

#6: D_ficusphila_Bsg-PI             
position  1:    T:0.16475    C:0.16858    A:0.33716    G:0.32950
position  2:    T:0.31034    C:0.21839    A:0.32950    G:0.14176
position  3:    T:0.23755    C:0.34483    A:0.14559    G:0.27203
Average         T:0.23755    C:0.24393    A:0.27075    G:0.24777

#7: D_elegans_Bsg-PI             
position  1:    T:0.15326    C:0.15709    A:0.34866    G:0.34100
position  2:    T:0.31801    C:0.21839    A:0.31418    G:0.14943
position  3:    T:0.25670    C:0.29502    A:0.17625    G:0.27203
Average         T:0.24266    C:0.22350    A:0.27969    G:0.25415

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      38 | Ser S TCT       5 | Tyr Y TAT      20 | Cys C TGT       7
      TTC      38 |       TCC      10 |       TAC      28 |       TGC      35
Leu L TTA      12 |       TCA      22 | *** * TAA       0 | *** * TGA       0
      TTG      30 |       TCG      23 |       TAG       0 | Trp W TGG      22
------------------------------------------------------------------------------
Leu L CTT      18 | Pro P CCT      32 | His H CAT       8 | Arg R CGT       8
      CTC      38 |       CCC      10 |       CAC       2 |       CGC      29
      CTA       7 |       CCA      22 | Gln Q CAA      22 |       CGA      14
      CTG      57 |       CCG      11 |       CAG      12 |       CGG       1
------------------------------------------------------------------------------
Ile I ATT      48 | Thr T ACT      22 | Asn N AAT      55 | Ser S AGT      17
      ATC      68 |       ACC      39 |       AAC      61 |       AGC      33
      ATA      18 |       ACA      47 | Lys K AAA      60 | Arg R AGA      22
Met M ATG      22 |       ACG      35 |       AAG      73 |       AGG       0
------------------------------------------------------------------------------
Val V GTT      49 | Ala A GCT      36 | Asp D GAT      62 | Gly G GGT      34
      GTC      13 |       GCC      64 |       GAC      53 |       GGC      44
      GTA      22 |       GCA      13 | Glu E GAA      41 |       GGA      15
      GTG      84 |       GCG      16 |       GAG      76 |       GGG       4
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.15873    C:0.15928    A:0.33935    G:0.34264
position  2:    T:0.30761    C:0.22277    A:0.31363    G:0.15599
position  3:    T:0.25123    C:0.30925    A:0.18446    G:0.25506
Average         T:0.23919    C:0.23043    A:0.27915    G:0.25123


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

D_melanogaster_Bsg-PI                  
D_sechellia_Bsg-PI                   0.5187 (0.0424 0.0817)
D_simulans_Bsg-PI                   0.3086 (0.0118 0.0384) 0.8183 (0.0335 0.0410)
D_yakuba_Bsg-PI                   0.7269 (0.0575 0.0791) 0.8835 (0.0923 0.1045) 1.0223 (0.0629 0.0615)
D_erecta_Bsg-PI                   0.2085 (0.0152 0.0731) 0.5812 (0.0512 0.0881) 0.5390 (0.0238 0.0442) 0.8762 (0.0592 0.0676)
D_ficusphila_Bsg-PI                   0.3954 (0.0864 0.2186) 0.4923 (0.1190 0.2417) 0.4463 (0.0836 0.1873) 0.5134 (0.1092 0.2126) 0.4545 (0.0854 0.1878)
D_elegans_Bsg-PI                   0.3504 (0.0705 0.2012) 0.4674 (0.0922 0.1974) 0.4133 (0.0677 0.1638) 0.6009 (0.1018 0.1694) 0.4088 (0.0686 0.1677) 0.4345 (0.0737 0.1696)


Model 0: one-ratio


TREE #  1:  (1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
check convergence..
lnL(ntime: 11  np: 13):  -2091.170808      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..11   11..4    11..12   12..6    12..7    10..5  
 0.030256 0.020901 0.104349 0.003790 0.020820 0.023810 0.130089 0.112963 0.176251 0.119432 0.042099 1.948165 0.597911

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.78476

(1: 0.030256, (2: 0.104349, 3: 0.003790): 0.020901, ((4: 0.130089, (6: 0.176251, 7: 0.119432): 0.112963): 0.023810, 5: 0.042099): 0.020820);

(D_melanogaster_Bsg-PI: 0.030256, (D_sechellia_Bsg-PI: 0.104349, D_simulans_Bsg-PI: 0.003790): 0.020901, ((D_yakuba_Bsg-PI: 0.130089, (D_ficusphila_Bsg-PI: 0.176251, D_elegans_Bsg-PI: 0.119432): 0.112963): 0.023810, D_erecta_Bsg-PI: 0.042099): 0.020820);

Detailed output identifying parameters

kappa (ts/tv) =  1.94816

omega (dN/dS) =  0.59791

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1      0.030   580.8   202.2  0.5979  0.0086  0.0144   5.0   2.9
   8..9      0.021   580.8   202.2  0.5979  0.0059  0.0099   3.4   2.0
   9..2      0.104   580.8   202.2  0.5979  0.0296  0.0496  17.2  10.0
   9..3      0.004   580.8   202.2  0.5979  0.0011  0.0018   0.6   0.4
   8..10     0.021   580.8   202.2  0.5979  0.0059  0.0099   3.4   2.0
  10..11     0.024   580.8   202.2  0.5979  0.0068  0.0113   3.9   2.3
  11..4      0.130   580.8   202.2  0.5979  0.0369  0.0618  21.5  12.5
  11..12     0.113   580.8   202.2  0.5979  0.0321  0.0537  18.6  10.8
  12..6      0.176   580.8   202.2  0.5979  0.0501  0.0837  29.1  16.9
  12..7      0.119   580.8   202.2  0.5979  0.0339  0.0567  19.7  11.5
  10..5      0.042   580.8   202.2  0.5979  0.0120  0.0200   6.9   4.0

tree length for dN:       0.2229
tree length for dS:       0.3728


Time used:  0:05


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
check convergence..
lnL(ntime: 11  np: 14):  -2058.257957      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..11   11..4    11..12   12..6    12..7    10..5  
 0.031002 0.021340 0.108297 0.003684 0.021575 0.020949 0.139656 0.121326 0.189186 0.124640 0.043208 1.773875 0.597034 0.000001

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.82486

(1: 0.031002, (2: 0.108297, 3: 0.003684): 0.021340, ((4: 0.139656, (6: 0.189186, 7: 0.124640): 0.121326): 0.020949, 5: 0.043208): 0.021575);

(D_melanogaster_Bsg-PI: 0.031002, (D_sechellia_Bsg-PI: 0.108297, D_simulans_Bsg-PI: 0.003684): 0.021340, ((D_yakuba_Bsg-PI: 0.139656, (D_ficusphila_Bsg-PI: 0.189186, D_elegans_Bsg-PI: 0.124640): 0.121326): 0.020949, D_erecta_Bsg-PI: 0.043208): 0.021575);

Detailed output identifying parameters

kappa (ts/tv) =  1.77387


dN/dS (w) for site classes (K=2)

p:   0.59703  0.40297
w:   0.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.031    583.6    199.4   0.4030   0.0075   0.0186    4.4    3.7
   8..9       0.021    583.6    199.4   0.4030   0.0052   0.0128    3.0    2.6
   9..2       0.108    583.6    199.4   0.4030   0.0262   0.0650   15.3   13.0
   9..3       0.004    583.6    199.4   0.4030   0.0009   0.0022    0.5    0.4
   8..10      0.022    583.6    199.4   0.4030   0.0052   0.0130    3.0    2.6
  10..11      0.021    583.6    199.4   0.4030   0.0051   0.0126    3.0    2.5
  11..4       0.140    583.6    199.4   0.4030   0.0338   0.0839   19.7   16.7
  11..12      0.121    583.6    199.4   0.4030   0.0294   0.0729   17.1   14.5
  12..6       0.189    583.6    199.4   0.4030   0.0458   0.1136   26.7   22.7
  12..7       0.125    583.6    199.4   0.4030   0.0302   0.0749   17.6   14.9
  10..5       0.043    583.6    199.4   0.4030   0.0105   0.0260    6.1    5.2


Time used:  0:12


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
lnL(ntime: 11  np: 16):  -2049.661589      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..11   11..4    11..12   12..6    12..7    10..5  
 0.031522 0.021394 0.110795 0.003593 0.022026 0.018427 0.147291 0.127655 0.197319 0.127859 0.043726 2.029192 0.669631 0.000000 0.000001 2.171020

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.85161

(1: 0.031522, (2: 0.110795, 3: 0.003593): 0.021394, ((4: 0.147291, (6: 0.197319, 7: 0.127859): 0.127655): 0.018427, 5: 0.043726): 0.022026);

(D_melanogaster_Bsg-PI: 0.031522, (D_sechellia_Bsg-PI: 0.110795, D_simulans_Bsg-PI: 0.003593): 0.021394, ((D_yakuba_Bsg-PI: 0.147291, (D_ficusphila_Bsg-PI: 0.197319, D_elegans_Bsg-PI: 0.127859): 0.127655): 0.018427, D_erecta_Bsg-PI: 0.043726): 0.022026);

Detailed output identifying parameters

kappa (ts/tv) =  2.02919


dN/dS (w) for site classes (K=3)

p:   0.66963  0.00000  0.33037
w:   0.00000  1.00000  2.17102

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.032    579.6    203.4   0.7172   0.0095   0.0133    5.5    2.7
   8..9       0.021    579.6    203.4   0.7172   0.0065   0.0090    3.7    1.8
   9..2       0.111    579.6    203.4   0.7172   0.0335   0.0467   19.4    9.5
   9..3       0.004    579.6    203.4   0.7172   0.0011   0.0015    0.6    0.3
   8..10      0.022    579.6    203.4   0.7172   0.0067   0.0093    3.9    1.9
  10..11      0.018    579.6    203.4   0.7172   0.0056   0.0078    3.2    1.6
  11..4       0.147    579.6    203.4   0.7172   0.0445   0.0621   25.8   12.6
  11..12      0.128    579.6    203.4   0.7172   0.0386   0.0538   22.4   10.9
  12..6       0.197    579.6    203.4   0.7172   0.0597   0.0832   34.6   16.9
  12..7       0.128    579.6    203.4   0.7172   0.0387   0.0539   22.4   11.0
  10..5       0.044    579.6    203.4   0.7172   0.0132   0.0184    7.7    3.7


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      1.000**       2.171
     7 A      1.000**       2.171
     8 S      1.000**       2.171
     9 A      1.000**       2.171
    10 L      1.000**       2.171
    11 S      1.000**       2.171
    12 F      1.000**       2.171
    13 L      1.000**       2.171
    20 Y      1.000**       2.171
    34 A      1.000**       2.171
    35 E      1.000**       2.171
    44 R      1.000**       2.171
    45 S      1.000**       2.171
    55 G      1.000**       2.171
    57 P      1.000**       2.171
    58 G      1.000**       2.171
    59 V      1.000**       2.171
    63 K      1.000**       2.171
    66 G      1.000**       2.171
    68 A      1.000**       2.171
    71 D      1.000**       2.171
    73 P      1.000**       2.171
    76 R      1.000**       2.171
    81 L      1.000**       2.171
    83 A      1.000**       2.171
    84 D      1.000**       2.171
    95 T      1.000**       2.171
    96 N      1.000**       2.171
   100 K      1.000**       2.171
   104 E      1.000**       2.171
   105 F      1.000**       2.171
   106 D      1.000**       2.171
   107 G      1.000**       2.171
   108 V      1.000**       2.171
   109 S      1.000**       2.171
   110 K      1.000**       2.171
   111 E      1.000**       2.171
   113 E      1.000**       2.171
   119 V      1.000**       2.171
   139 S      1.000**       2.171
   144 K      1.000**       2.171
   146 E      1.000**       2.171
   148 T      1.000**       2.171
   152 A      1.000**       2.171
   159 A      1.000**       2.171
   163 F      1.000**       2.171
   164 I      1.000**       2.171
   165 L      1.000**       2.171
   167 P      1.000**       2.171
   168 N      1.000**       2.171
   169 G      1.000**       2.171
   178 D      1.000**       2.171
   183 D      1.000**       2.171
   187 E      1.000**       2.171
   191 I      1.000**       2.171
   193 R      1.000**       2.171
   197 N      1.000**       2.171
   198 V      1.000**       2.171
   199 Y      1.000**       2.171
   200 G      1.000**       2.171
   201 G      1.000**       2.171
   203 T      1.000**       2.171
   205 T      1.000**       2.171
   206 P      1.000**       2.171
   208 S      1.000**       2.171
   210 V      1.000**       2.171
   213 V      1.000**       2.171
   217 G      1.000**       2.171


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      0.593         1.868 +- 1.097
     7 A      0.805         2.401 +- 0.837
     8 S      0.927         2.669 +- 0.696
     9 A      0.799         2.388 +- 0.840
    10 L      0.566         1.802 +- 1.105
    11 S      0.920         2.657 +- 0.721
    13 L      0.806         2.403 +- 0.835
    20 Y      0.575         1.824 +- 1.103
    34 A      0.766         2.315 +- 0.865
    35 E      0.748         2.275 +- 0.874
    44 R      0.551         1.764 +- 1.108
    45 S      0.971*        2.763 +- 0.627
    55 G      0.801         2.393 +- 0.843
    57 P      0.612         1.915 +- 1.091
    66 G      0.761         2.304 +- 0.863
    68 A      0.804         2.398 +- 0.837
    71 D      0.770         2.325 +- 0.862
    73 P      0.600         1.885 +- 1.095
    76 R      0.828         2.454 +- 0.822
    81 L      0.722         2.186 +- 1.018
    83 A      0.944         2.707 +- 0.674
    95 T      0.844         2.490 +- 0.807
    96 N      0.943         2.703 +- 0.672
   100 K      0.981*        2.783 +- 0.603
   104 E      0.779         2.344 +- 0.855
   105 F      0.786         2.360 +- 0.852
   106 D      0.867         2.534 +- 0.764
   107 G      0.591         1.864 +- 1.098
   108 V      0.749         2.278 +- 0.872
   109 S      0.548         1.758 +- 1.109
   110 K      0.644         1.999 +- 1.048
   111 E      0.933         2.683 +- 0.689
   113 E      0.806         2.402 +- 0.836
   144 K      0.972*        2.765 +- 0.622
   146 E      0.524         1.699 +- 1.113
   148 T      0.856         2.514 +- 0.795
   159 A      0.926         2.666 +- 0.700
   163 F      0.793         2.374 +- 0.844
   165 L      0.515         1.676 +- 1.114
   167 P      0.654         2.017 +- 1.072
   169 G      0.808         2.409 +- 0.834
   183 D      0.895         2.597 +- 0.738
   193 R      0.802         2.380 +- 0.925
   198 V      0.887         2.580 +- 0.747
   199 Y      0.808         2.407 +- 0.834
   200 G      0.527         1.706 +- 1.112
   201 G      0.922         2.658 +- 0.705
   203 T      0.893         2.593 +- 0.737
   205 T      0.809         2.410 +- 0.834
   206 P      0.598         1.879 +- 1.096
   208 S      0.764         2.310 +- 0.861
   210 V      0.970*        2.761 +- 0.626
   213 V      0.510         1.662 +- 1.122



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   0.935  0.064  0.001  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.002  0.714  0.253  0.026  0.004  0.001  0.000  0.000  0.000  0.000

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.007 0.001
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.024 0.084 0.006 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.009 0.125 0.143 0.033 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.044 0.227 0.242 0.037 0.003 0.000 0.000

sum of density on p0-p1 =   1.000000

Time used:  0:42


Model 3: discrete (3 categories)


TREE #  1:  (1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
lnL(ntime: 11  np: 17):  -2049.661589      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..11   11..4    11..12   12..6    12..7    10..5  
 0.031522 0.021394 0.110795 0.003594 0.022026 0.018427 0.147291 0.127655 0.197319 0.127859 0.043726 2.029192 0.562242 0.107389 0.000001 0.000001 2.171017

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.85161

(1: 0.031522, (2: 0.110795, 3: 0.003594): 0.021394, ((4: 0.147291, (6: 0.197319, 7: 0.127859): 0.127655): 0.018427, 5: 0.043726): 0.022026);

(D_melanogaster_Bsg-PI: 0.031522, (D_sechellia_Bsg-PI: 0.110795, D_simulans_Bsg-PI: 0.003594): 0.021394, ((D_yakuba_Bsg-PI: 0.147291, (D_ficusphila_Bsg-PI: 0.197319, D_elegans_Bsg-PI: 0.127859): 0.127655): 0.018427, D_erecta_Bsg-PI: 0.043726): 0.022026);

Detailed output identifying parameters

kappa (ts/tv) =  2.02919


dN/dS (w) for site classes (K=3)

p:   0.56224  0.10739  0.33037
w:   0.00000  0.00000  2.17102

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.032    579.6    203.4   0.7172   0.0095   0.0133    5.5    2.7
   8..9       0.021    579.6    203.4   0.7172   0.0065   0.0090    3.7    1.8
   9..2       0.111    579.6    203.4   0.7172   0.0335   0.0467   19.4    9.5
   9..3       0.004    579.6    203.4   0.7172   0.0011   0.0015    0.6    0.3
   8..10      0.022    579.6    203.4   0.7172   0.0067   0.0093    3.9    1.9
  10..11      0.018    579.6    203.4   0.7172   0.0056   0.0078    3.2    1.6
  11..4       0.147    579.6    203.4   0.7172   0.0445   0.0621   25.8   12.6
  11..12      0.128    579.6    203.4   0.7172   0.0386   0.0538   22.4   10.9
  12..6       0.197    579.6    203.4   0.7172   0.0597   0.0832   34.6   16.9
  12..7       0.128    579.6    203.4   0.7172   0.0387   0.0539   22.4   11.0
  10..5       0.044    579.6    203.4   0.7172   0.0132   0.0184    7.7    3.7


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      1.000**       2.171
     7 A      1.000**       2.171
     8 S      1.000**       2.171
     9 A      1.000**       2.171
    10 L      1.000**       2.171
    11 S      1.000**       2.171
    12 F      1.000**       2.171
    13 L      1.000**       2.171
    20 Y      1.000**       2.171
    34 A      1.000**       2.171
    35 E      1.000**       2.171
    44 R      1.000**       2.171
    45 S      1.000**       2.171
    55 G      1.000**       2.171
    57 P      1.000**       2.171
    58 G      1.000**       2.171
    59 V      1.000**       2.171
    63 K      1.000**       2.171
    66 G      1.000**       2.171
    68 A      1.000**       2.171
    71 D      1.000**       2.171
    73 P      1.000**       2.171
    76 R      1.000**       2.171
    81 L      1.000**       2.171
    83 A      1.000**       2.171
    84 D      1.000**       2.171
    95 T      1.000**       2.171
    96 N      1.000**       2.171
   100 K      1.000**       2.171
   104 E      1.000**       2.171
   105 F      1.000**       2.171
   106 D      1.000**       2.171
   107 G      1.000**       2.171
   108 V      1.000**       2.171
   109 S      1.000**       2.171
   110 K      1.000**       2.171
   111 E      1.000**       2.171
   113 E      1.000**       2.171
   119 V      1.000**       2.171
   139 S      1.000**       2.171
   144 K      1.000**       2.171
   146 E      1.000**       2.171
   148 T      1.000**       2.171
   152 A      1.000**       2.171
   159 A      1.000**       2.171
   163 F      1.000**       2.171
   164 I      1.000**       2.171
   165 L      1.000**       2.171
   167 P      1.000**       2.171
   168 N      1.000**       2.171
   169 G      1.000**       2.171
   178 D      1.000**       2.171
   183 D      1.000**       2.171
   187 E      1.000**       2.171
   191 I      1.000**       2.171
   193 R      1.000**       2.171
   197 N      1.000**       2.171
   198 V      1.000**       2.171
   199 Y      1.000**       2.171
   200 G      1.000**       2.171
   201 G      1.000**       2.171
   203 T      1.000**       2.171
   205 T      1.000**       2.171
   206 P      1.000**       2.171
   208 S      1.000**       2.171
   210 V      1.000**       2.171
   213 V      1.000**       2.171
   217 G      1.000**       2.171


Time used:  0:59


Model 7: beta (10 categories)


TREE #  1:  (1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
check convergence..
lnL(ntime: 11  np: 14):  -2058.259997      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..11   11..4    11..12   12..6    12..7    10..5  
 0.030948 0.021302 0.108114 0.003676 0.021538 0.020895 0.139441 0.121144 0.188903 0.124434 0.043132 1.772034 0.005026 0.007580

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.82353

(1: 0.030948, (2: 0.108114, 3: 0.003676): 0.021302, ((4: 0.139441, (6: 0.188903, 7: 0.124434): 0.121144): 0.020895, 5: 0.043132): 0.021538);

(D_melanogaster_Bsg-PI: 0.030948, (D_sechellia_Bsg-PI: 0.108114, D_simulans_Bsg-PI: 0.003676): 0.021302, ((D_yakuba_Bsg-PI: 0.139441, (D_ficusphila_Bsg-PI: 0.188903, D_elegans_Bsg-PI: 0.124434): 0.121144): 0.020895, D_erecta_Bsg-PI: 0.043132): 0.021538);

Detailed output identifying parameters

kappa (ts/tv) =  1.77203

Parameters in M7 (beta):
 p =   0.00503  q =   0.00758


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  1.00000  1.00000  1.00000  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.031    583.6    199.4   0.4000   0.0075   0.0187    4.4    3.7
   8..9       0.021    583.6    199.4   0.4000   0.0051   0.0128    3.0    2.6
   9..2       0.108    583.6    199.4   0.4000   0.0261   0.0652   15.2   13.0
   9..3       0.004    583.6    199.4   0.4000   0.0009   0.0022    0.5    0.4
   8..10      0.022    583.6    199.4   0.4000   0.0052   0.0130    3.0    2.6
  10..11      0.021    583.6    199.4   0.4000   0.0050   0.0126    2.9    2.5
  11..4       0.139    583.6    199.4   0.4000   0.0336   0.0841   19.6   16.8
  11..12      0.121    583.6    199.4   0.4000   0.0292   0.0731   17.1   14.6
  12..6       0.189    583.6    199.4   0.4000   0.0456   0.1139   26.6   22.7
  12..7       0.124    583.6    199.4   0.4000   0.0300   0.0750   17.5   15.0
  10..5       0.043    583.6    199.4   0.4000   0.0104   0.0260    6.1    5.2


Time used:  2:00


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, (2, 3), ((4, (6, 7)), 5));   MP score: 168
lnL(ntime: 11  np: 16):  -2049.661589      +0.000000
   8..1     8..9     9..2     9..3     8..10   10..11   11..4    11..12   12..6    12..7    10..5  
 0.031522 0.021394 0.110795 0.003593 0.022026 0.018427 0.147291 0.127655 0.197319 0.127860 0.043726 2.029191 0.669632 0.005000 1.392371 2.171023

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.85161

(1: 0.031522, (2: 0.110795, 3: 0.003593): 0.021394, ((4: 0.147291, (6: 0.197319, 7: 0.127860): 0.127655): 0.018427, 5: 0.043726): 0.022026);

(D_melanogaster_Bsg-PI: 0.031522, (D_sechellia_Bsg-PI: 0.110795, D_simulans_Bsg-PI: 0.003593): 0.021394, ((D_yakuba_Bsg-PI: 0.147291, (D_ficusphila_Bsg-PI: 0.197319, D_elegans_Bsg-PI: 0.127860): 0.127655): 0.018427, D_erecta_Bsg-PI: 0.043726): 0.022026);

Detailed output identifying parameters

kappa (ts/tv) =  2.02919

Parameters in M8 (beta&w>1):
  p0 =   0.66963  p =   0.00500 q =   1.39237
 (p1 =   0.33037) w =   2.17102


dN/dS (w) for site classes (K=11)

p:   0.06696  0.06696  0.06696  0.06696  0.06696  0.06696  0.06696  0.06696  0.06696  0.06696  0.33037
w:   0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00000  0.00002  2.17102

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   8..1       0.032    579.6    203.4   0.7172   0.0095   0.0133    5.5    2.7
   8..9       0.021    579.6    203.4   0.7172   0.0065   0.0090    3.7    1.8
   9..2       0.111    579.6    203.4   0.7172   0.0335   0.0467   19.4    9.5
   9..3       0.004    579.6    203.4   0.7172   0.0011   0.0015    0.6    0.3
   8..10      0.022    579.6    203.4   0.7172   0.0067   0.0093    3.9    1.9
  10..11      0.018    579.6    203.4   0.7172   0.0056   0.0078    3.2    1.6
  11..4       0.147    579.6    203.4   0.7172   0.0445   0.0621   25.8   12.6
  11..12      0.128    579.6    203.4   0.7172   0.0386   0.0538   22.4   10.9
  12..6       0.197    579.6    203.4   0.7172   0.0597   0.0832   34.6   16.9
  12..7       0.128    579.6    203.4   0.7172   0.0387   0.0539   22.4   11.0
  10..5       0.044    579.6    203.4   0.7172   0.0132   0.0184    7.7    3.7


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      1.000**       2.171
     7 A      1.000**       2.171
     8 S      1.000**       2.171
     9 A      1.000**       2.171
    10 L      1.000**       2.171
    11 S      1.000**       2.171
    12 F      1.000**       2.171
    13 L      1.000**       2.171
    20 Y      1.000**       2.171
    34 A      1.000**       2.171
    35 E      1.000**       2.171
    44 R      1.000**       2.171
    45 S      1.000**       2.171
    55 G      1.000**       2.171
    57 P      1.000**       2.171
    58 G      1.000**       2.171
    59 V      1.000**       2.171
    63 K      1.000**       2.171
    66 G      1.000**       2.171
    68 A      1.000**       2.171
    71 D      1.000**       2.171
    73 P      1.000**       2.171
    76 R      1.000**       2.171
    81 L      1.000**       2.171
    83 A      1.000**       2.171
    84 D      1.000**       2.171
    95 T      1.000**       2.171
    96 N      1.000**       2.171
   100 K      1.000**       2.171
   104 E      1.000**       2.171
   105 F      1.000**       2.171
   106 D      1.000**       2.171
   107 G      1.000**       2.171
   108 V      1.000**       2.171
   109 S      1.000**       2.171
   110 K      1.000**       2.171
   111 E      1.000**       2.171
   113 E      1.000**       2.171
   119 V      1.000**       2.171
   139 S      1.000**       2.171
   144 K      1.000**       2.171
   146 E      1.000**       2.171
   148 T      1.000**       2.171
   152 A      1.000**       2.171
   159 A      1.000**       2.171
   163 F      1.000**       2.171
   164 I      1.000**       2.171
   165 L      1.000**       2.171
   167 P      1.000**       2.171
   168 N      1.000**       2.171
   169 G      1.000**       2.171
   178 D      1.000**       2.171
   183 D      1.000**       2.171
   187 E      1.000**       2.171
   191 I      1.000**       2.171
   193 R      1.000**       2.171
   197 N      1.000**       2.171
   198 V      1.000**       2.171
   199 Y      1.000**       2.171
   200 G      1.000**       2.171
   201 G      1.000**       2.171
   203 T      1.000**       2.171
   205 T      1.000**       2.171
   206 P      1.000**       2.171
   208 S      1.000**       2.171
   210 V      1.000**       2.171
   213 V      1.000**       2.171
   217 G      1.000**       2.171


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      0.667         1.858 +- 1.109
     7 A      0.906         2.447 +- 0.691
     8 S      0.980*        2.615 +- 0.469
     9 A      0.903         2.439 +- 0.698
    10 L      0.638         1.789 +- 1.128
    11 S      0.969*        2.592 +- 0.516
    12 F      0.524         1.510 +- 1.165
    13 L      0.908         2.450 +- 0.687
    20 Y      0.648         1.812 +- 1.122
    34 A      0.878         2.381 +- 0.751
    35 E      0.865         2.350 +- 0.775
    44 R      0.622         1.749 +- 1.136
    45 S      0.993**       2.643 +- 0.419
    55 G      0.902         2.437 +- 0.702
    57 P      0.686         1.906 +- 1.094
    58 G      0.509         1.473 +- 1.166
    59 V      0.564         1.607 +- 1.160
    63 K      0.534         1.534 +- 1.164
    66 G      0.877         2.379 +- 0.750
    68 A      0.906         2.446 +- 0.692
    71 D      0.881         2.389 +- 0.745
    73 P      0.674         1.876 +- 1.104
    76 R      0.920         2.479 +- 0.661
    81 L      0.797         2.178 +- 0.965
    83 A      0.985*        2.626 +- 0.451
    95 T      0.930         2.502 +- 0.635
    96 N      0.985*        2.627 +- 0.448
   100 K      0.996**       2.650 +- 0.404
   104 E      0.889         2.406 +- 0.729
   105 F      0.893         2.415 +- 0.722
   106 D      0.957*        2.563 +- 0.541
   107 G      0.665         1.854 +- 1.110
   108 V      0.866         2.354 +- 0.772
   109 S      0.619         1.742 +- 1.138
   110 K      0.730         2.014 +- 1.040
   111 E      0.981*        2.619 +- 0.463
   113 E      0.907         2.449 +- 0.688
   119 V      0.547         1.566 +- 1.163
   144 K      0.994**       2.646 +- 0.412
   146 E      0.593         1.678 +- 1.149
   148 T      0.937         2.518 +- 0.615
   152 A      0.555         1.584 +- 1.162
   159 A      0.979*        2.613 +- 0.472
   163 F      0.899         2.430 +- 0.706
   165 L      0.583         1.653 +- 1.153
   167 P      0.728         2.009 +- 1.056
   169 G      0.909         2.453 +- 0.685
   183 D      0.967*        2.588 +- 0.510
   187 E      0.556         1.587 +- 1.160
   193 R      0.873         2.363 +- 0.819
   198 V      0.964*        2.581 +- 0.520
   199 Y      0.909         2.453 +- 0.685
   200 G      0.596         1.686 +- 1.148
   201 G      0.977*        2.610 +- 0.477
   203 T      0.967*        2.588 +- 0.509
   205 T      0.909         2.454 +- 0.684
   206 P      0.672         1.870 +- 1.105
   208 S      0.879         2.383 +- 0.747
   210 V      0.994**       2.645 +- 0.415
   213 V      0.574         1.632 +- 1.159



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.030  0.844  0.126  0.000
p :   0.813  0.154  0.028  0.005  0.001  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.022  0.044  0.071  0.099  0.120  0.137  0.153  0.169  0.184
ws:   0.001  0.847  0.144  0.007  0.000  0.000  0.000  0.000  0.000  0.000

Time used:  3:04

Model 1: NearlyNeutral	-2058.257957
Model 2: PositiveSelection	-2049.661589
Model 0: one-ratio	-2091.170808
Model 3: discrete	-2049.661589
Model 7: beta	-2058.259997
Model 8: beta&w>1	-2049.661589


Model 0 vs 1	65.82570200000009

Model 2 vs 1	17.192735999999968

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      1.000**       2.171
     7 A      1.000**       2.171
     8 S      1.000**       2.171
     9 A      1.000**       2.171
    10 L      1.000**       2.171
    11 S      1.000**       2.171
    12 F      1.000**       2.171
    13 L      1.000**       2.171
    20 Y      1.000**       2.171
    34 A      1.000**       2.171
    35 E      1.000**       2.171
    44 R      1.000**       2.171
    45 S      1.000**       2.171
    55 G      1.000**       2.171
    57 P      1.000**       2.171
    58 G      1.000**       2.171
    59 V      1.000**       2.171
    63 K      1.000**       2.171
    66 G      1.000**       2.171
    68 A      1.000**       2.171
    71 D      1.000**       2.171
    73 P      1.000**       2.171
    76 R      1.000**       2.171
    81 L      1.000**       2.171
    83 A      1.000**       2.171
    84 D      1.000**       2.171
    95 T      1.000**       2.171
    96 N      1.000**       2.171
   100 K      1.000**       2.171
   104 E      1.000**       2.171
   105 F      1.000**       2.171
   106 D      1.000**       2.171
   107 G      1.000**       2.171
   108 V      1.000**       2.171
   109 S      1.000**       2.171
   110 K      1.000**       2.171
   111 E      1.000**       2.171
   113 E      1.000**       2.171
   119 V      1.000**       2.171
   139 S      1.000**       2.171
   144 K      1.000**       2.171
   146 E      1.000**       2.171
   148 T      1.000**       2.171
   152 A      1.000**       2.171
   159 A      1.000**       2.171
   163 F      1.000**       2.171
   164 I      1.000**       2.171
   165 L      1.000**       2.171
   167 P      1.000**       2.171
   168 N      1.000**       2.171
   169 G      1.000**       2.171
   178 D      1.000**       2.171
   183 D      1.000**       2.171
   187 E      1.000**       2.171
   191 I      1.000**       2.171
   193 R      1.000**       2.171
   197 N      1.000**       2.171
   198 V      1.000**       2.171
   199 Y      1.000**       2.171
   200 G      1.000**       2.171
   201 G      1.000**       2.171
   203 T      1.000**       2.171
   205 T      1.000**       2.171
   206 P      1.000**       2.171
   208 S      1.000**       2.171
   210 V      1.000**       2.171
   213 V      1.000**       2.171
   217 G      1.000**       2.171

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      0.593         1.868 +- 1.097
     7 A      0.805         2.401 +- 0.837
     8 S      0.927         2.669 +- 0.696
     9 A      0.799         2.388 +- 0.840
    10 L      0.566         1.802 +- 1.105
    11 S      0.920         2.657 +- 0.721
    13 L      0.806         2.403 +- 0.835
    20 Y      0.575         1.824 +- 1.103
    34 A      0.766         2.315 +- 0.865
    35 E      0.748         2.275 +- 0.874
    44 R      0.551         1.764 +- 1.108
    45 S      0.971*        2.763 +- 0.627
    55 G      0.801         2.393 +- 0.843
    57 P      0.612         1.915 +- 1.091
    66 G      0.761         2.304 +- 0.863
    68 A      0.804         2.398 +- 0.837
    71 D      0.770         2.325 +- 0.862
    73 P      0.600         1.885 +- 1.095
    76 R      0.828         2.454 +- 0.822
    81 L      0.722         2.186 +- 1.018
    83 A      0.944         2.707 +- 0.674
    95 T      0.844         2.490 +- 0.807
    96 N      0.943         2.703 +- 0.672
   100 K      0.981*        2.783 +- 0.603
   104 E      0.779         2.344 +- 0.855
   105 F      0.786         2.360 +- 0.852
   106 D      0.867         2.534 +- 0.764
   107 G      0.591         1.864 +- 1.098
   108 V      0.749         2.278 +- 0.872
   109 S      0.548         1.758 +- 1.109
   110 K      0.644         1.999 +- 1.048
   111 E      0.933         2.683 +- 0.689
   113 E      0.806         2.402 +- 0.836
   144 K      0.972*        2.765 +- 0.622
   146 E      0.524         1.699 +- 1.113
   148 T      0.856         2.514 +- 0.795
   159 A      0.926         2.666 +- 0.700
   163 F      0.793         2.374 +- 0.844
   165 L      0.515         1.676 +- 1.114
   167 P      0.654         2.017 +- 1.072
   169 G      0.808         2.409 +- 0.834
   183 D      0.895         2.597 +- 0.738
   193 R      0.802         2.380 +- 0.925
   198 V      0.887         2.580 +- 0.747
   199 Y      0.808         2.407 +- 0.834
   200 G      0.527         1.706 +- 1.112
   201 G      0.922         2.658 +- 0.705
   203 T      0.893         2.593 +- 0.737
   205 T      0.809         2.410 +- 0.834
   206 P      0.598         1.879 +- 1.096
   208 S      0.764         2.310 +- 0.861
   210 V      0.970*        2.761 +- 0.626
   213 V      0.510         1.662 +- 1.122


Model 8 vs 7	17.19681600000058

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      1.000**       2.171
     7 A      1.000**       2.171
     8 S      1.000**       2.171
     9 A      1.000**       2.171
    10 L      1.000**       2.171
    11 S      1.000**       2.171
    12 F      1.000**       2.171
    13 L      1.000**       2.171
    20 Y      1.000**       2.171
    34 A      1.000**       2.171
    35 E      1.000**       2.171
    44 R      1.000**       2.171
    45 S      1.000**       2.171
    55 G      1.000**       2.171
    57 P      1.000**       2.171
    58 G      1.000**       2.171
    59 V      1.000**       2.171
    63 K      1.000**       2.171
    66 G      1.000**       2.171
    68 A      1.000**       2.171
    71 D      1.000**       2.171
    73 P      1.000**       2.171
    76 R      1.000**       2.171
    81 L      1.000**       2.171
    83 A      1.000**       2.171
    84 D      1.000**       2.171
    95 T      1.000**       2.171
    96 N      1.000**       2.171
   100 K      1.000**       2.171
   104 E      1.000**       2.171
   105 F      1.000**       2.171
   106 D      1.000**       2.171
   107 G      1.000**       2.171
   108 V      1.000**       2.171
   109 S      1.000**       2.171
   110 K      1.000**       2.171
   111 E      1.000**       2.171
   113 E      1.000**       2.171
   119 V      1.000**       2.171
   139 S      1.000**       2.171
   144 K      1.000**       2.171
   146 E      1.000**       2.171
   148 T      1.000**       2.171
   152 A      1.000**       2.171
   159 A      1.000**       2.171
   163 F      1.000**       2.171
   164 I      1.000**       2.171
   165 L      1.000**       2.171
   167 P      1.000**       2.171
   168 N      1.000**       2.171
   169 G      1.000**       2.171
   178 D      1.000**       2.171
   183 D      1.000**       2.171
   187 E      1.000**       2.171
   191 I      1.000**       2.171
   193 R      1.000**       2.171
   197 N      1.000**       2.171
   198 V      1.000**       2.171
   199 Y      1.000**       2.171
   200 G      1.000**       2.171
   201 G      1.000**       2.171
   203 T      1.000**       2.171
   205 T      1.000**       2.171
   206 P      1.000**       2.171
   208 S      1.000**       2.171
   210 V      1.000**       2.171
   213 V      1.000**       2.171
   217 G      1.000**       2.171

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Bsg-PI)

            Pr(w>1)     post mean +- SE for w

     6 L      0.667         1.858 +- 1.109
     7 A      0.906         2.447 +- 0.691
     8 S      0.980*        2.615 +- 0.469
     9 A      0.903         2.439 +- 0.698
    10 L      0.638         1.789 +- 1.128
    11 S      0.969*        2.592 +- 0.516
    12 F      0.524         1.510 +- 1.165
    13 L      0.908         2.450 +- 0.687
    20 Y      0.648         1.812 +- 1.122
    34 A      0.878         2.381 +- 0.751
    35 E      0.865         2.350 +- 0.775
    44 R      0.622         1.749 +- 1.136
    45 S      0.993**       2.643 +- 0.419
    55 G      0.902         2.437 +- 0.702
    57 P      0.686         1.906 +- 1.094
    58 G      0.509         1.473 +- 1.166
    59 V      0.564         1.607 +- 1.160
    63 K      0.534         1.534 +- 1.164
    66 G      0.877         2.379 +- 0.750
    68 A      0.906         2.446 +- 0.692
    71 D      0.881         2.389 +- 0.745
    73 P      0.674         1.876 +- 1.104
    76 R      0.920         2.479 +- 0.661
    81 L      0.797         2.178 +- 0.965
    83 A      0.985*        2.626 +- 0.451
    95 T      0.930         2.502 +- 0.635
    96 N      0.985*        2.627 +- 0.448
   100 K      0.996**       2.650 +- 0.404
   104 E      0.889         2.406 +- 0.729
   105 F      0.893         2.415 +- 0.722
   106 D      0.957*        2.563 +- 0.541
   107 G      0.665         1.854 +- 1.110
   108 V      0.866         2.354 +- 0.772
   109 S      0.619         1.742 +- 1.138
   110 K      0.730         2.014 +- 1.040
   111 E      0.981*        2.619 +- 0.463
   113 E      0.907         2.449 +- 0.688
   119 V      0.547         1.566 +- 1.163
   144 K      0.994**       2.646 +- 0.412
   146 E      0.593         1.678 +- 1.149
   148 T      0.937         2.518 +- 0.615
   152 A      0.555         1.584 +- 1.162
   159 A      0.979*        2.613 +- 0.472
   163 F      0.899         2.430 +- 0.706
   165 L      0.583         1.653 +- 1.153
   167 P      0.728         2.009 +- 1.056
   169 G      0.909         2.453 +- 0.685
   183 D      0.967*        2.588 +- 0.510
   187 E      0.556         1.587 +- 1.160
   193 R      0.873         2.363 +- 0.819
   198 V      0.964*        2.581 +- 0.520
   199 Y      0.909         2.453 +- 0.685
   200 G      0.596         1.686 +- 1.148
   201 G      0.977*        2.610 +- 0.477
   203 T      0.967*        2.588 +- 0.509
   205 T      0.909         2.454 +- 0.684
   206 P      0.672         1.870 +- 1.105
   208 S      0.879         2.383 +- 0.747
   210 V      0.994**       2.645 +- 0.415
   213 V      0.574         1.632 +- 1.159