--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 18 11:17:13 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/27/Bsg-PH/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2170.24 -2183.51 2 -2170.33 -2182.76 -------------------------------------- TOTAL -2170.28 -2183.20 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.297134 0.000664 0.246131 0.344963 0.296047 1501.00 1501.00 1.000 r(A<->C){all} 0.120280 0.000678 0.069799 0.169424 0.118734 1123.61 1237.80 1.000 r(A<->G){all} 0.238246 0.001178 0.175442 0.306952 0.236394 1063.47 1072.98 1.000 r(A<->T){all} 0.135752 0.000750 0.080535 0.188275 0.134571 985.48 1048.81 1.000 r(C<->G){all} 0.118711 0.000700 0.070955 0.170881 0.116780 1069.80 1095.18 1.000 r(C<->T){all} 0.310982 0.001596 0.236315 0.390550 0.308904 940.34 1087.23 1.000 r(G<->T){all} 0.076030 0.000442 0.034950 0.115326 0.074267 861.13 1068.32 1.000 pi(A){all} 0.279615 0.000219 0.251428 0.308440 0.279645 1156.13 1208.53 1.000 pi(C){all} 0.232717 0.000184 0.206326 0.259287 0.232425 1462.19 1481.59 1.000 pi(G){all} 0.248135 0.000194 0.221326 0.275670 0.248117 1192.66 1243.97 1.001 pi(T){all} 0.239533 0.000200 0.212595 0.267144 0.239139 1116.14 1194.10 1.000 alpha{1,2} 0.615680 0.101155 0.193902 1.264095 0.541247 1378.74 1381.58 1.000 alpha{3} 1.192556 0.339636 0.327455 2.366348 1.074654 1354.67 1396.36 1.000 pinvar{all} 0.137139 0.009702 0.000087 0.324822 0.119344 1243.89 1279.06 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2058.257957 Model 2: PositiveSelection -2049.661589 Model 0: one-ratio -2091.170808 Model 3: discrete -2049.661589 Model 7: beta -2058.259997 Model 8: beta&w>1 -2049.661589 Model 0 vs 1 65.82570200000009 Model 2 vs 1 17.192735999999968 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Bsg-PH) Pr(w>1) post mean +- SE for w 6 L 1.000** 2.171 7 A 1.000** 2.171 8 S 1.000** 2.171 9 A 1.000** 2.171 10 L 1.000** 2.171 11 S 1.000** 2.171 12 F 1.000** 2.171 13 L 1.000** 2.171 20 Y 1.000** 2.171 34 A 1.000** 2.171 35 E 1.000** 2.171 44 R 1.000** 2.171 45 S 1.000** 2.171 55 G 1.000** 2.171 57 P 1.000** 2.171 58 G 1.000** 2.171 59 V 1.000** 2.171 63 K 1.000** 2.171 66 G 1.000** 2.171 68 A 1.000** 2.171 71 D 1.000** 2.171 73 P 1.000** 2.171 76 R 1.000** 2.171 81 L 1.000** 2.171 83 A 1.000** 2.171 84 D 1.000** 2.171 95 T 1.000** 2.171 96 N 1.000** 2.171 100 K 1.000** 2.171 104 E 1.000** 2.171 105 F 1.000** 2.171 106 D 1.000** 2.171 107 G 1.000** 2.171 108 V 1.000** 2.171 109 S 1.000** 2.171 110 K 1.000** 2.171 111 E 1.000** 2.171 113 E 1.000** 2.171 119 V 1.000** 2.171 139 S 1.000** 2.171 144 K 1.000** 2.171 146 E 1.000** 2.171 148 T 1.000** 2.171 152 A 1.000** 2.171 159 A 1.000** 2.171 163 F 1.000** 2.171 164 I 1.000** 2.171 165 L 1.000** 2.171 167 P 1.000** 2.171 168 N 1.000** 2.171 169 G 1.000** 2.171 178 D 1.000** 2.171 183 D 1.000** 2.171 187 E 1.000** 2.171 191 I 1.000** 2.171 193 R 1.000** 2.171 197 N 1.000** 2.171 198 V 1.000** 2.171 199 Y 1.000** 2.171 200 G 1.000** 2.171 201 G 1.000** 2.171 203 T 1.000** 2.171 205 T 1.000** 2.171 206 P 1.000** 2.171 208 S 1.000** 2.171 210 V 1.000** 2.171 213 V 1.000** 2.171 217 G 1.000** 2.171 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Bsg-PH) Pr(w>1) post mean +- SE for w 6 L 0.593 1.868 +- 1.097 7 A 0.805 2.401 +- 0.837 8 S 0.927 2.669 +- 0.696 9 A 0.799 2.388 +- 0.840 10 L 0.566 1.802 +- 1.105 11 S 0.920 2.657 +- 0.721 13 L 0.806 2.403 +- 0.835 20 Y 0.575 1.824 +- 1.103 34 A 0.766 2.315 +- 0.865 35 E 0.748 2.275 +- 0.874 44 R 0.551 1.764 +- 1.108 45 S 0.971* 2.763 +- 0.627 55 G 0.801 2.393 +- 0.843 57 P 0.612 1.915 +- 1.091 66 G 0.761 2.304 +- 0.863 68 A 0.804 2.398 +- 0.837 71 D 0.770 2.325 +- 0.862 73 P 0.600 1.885 +- 1.095 76 R 0.828 2.454 +- 0.822 81 L 0.722 2.186 +- 1.018 83 A 0.944 2.707 +- 0.674 95 T 0.844 2.490 +- 0.807 96 N 0.943 2.703 +- 0.672 100 K 0.981* 2.783 +- 0.603 104 E 0.779 2.344 +- 0.855 105 F 0.786 2.360 +- 0.852 106 D 0.867 2.534 +- 0.764 107 G 0.591 1.864 +- 1.098 108 V 0.749 2.278 +- 0.872 109 S 0.548 1.758 +- 1.109 110 K 0.644 1.999 +- 1.048 111 E 0.933 2.683 +- 0.689 113 E 0.806 2.402 +- 0.836 144 K 0.972* 2.765 +- 0.622 146 E 0.524 1.699 +- 1.113 148 T 0.856 2.514 +- 0.795 159 A 0.926 2.666 +- 0.700 163 F 0.793 2.374 +- 0.844 165 L 0.515 1.676 +- 1.114 167 P 0.654 2.017 +- 1.072 169 G 0.808 2.409 +- 0.834 183 D 0.895 2.597 +- 0.738 193 R 0.802 2.380 +- 0.925 198 V 0.887 2.580 +- 0.747 199 Y 0.808 2.407 +- 0.834 200 G 0.527 1.706 +- 1.112 201 G 0.922 2.658 +- 0.705 203 T 0.893 2.593 +- 0.737 205 T 0.809 2.410 +- 0.834 206 P 0.598 1.879 +- 1.096 208 S 0.764 2.310 +- 0.861 210 V 0.970* 2.761 +- 0.626 213 V 0.510 1.662 +- 1.122 Model 8 vs 7 17.19681600000058 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Bsg-PH) Pr(w>1) post mean +- SE for w 6 L 1.000** 2.171 7 A 1.000** 2.171 8 S 1.000** 2.171 9 A 1.000** 2.171 10 L 1.000** 2.171 11 S 1.000** 2.171 12 F 1.000** 2.171 13 L 1.000** 2.171 20 Y 1.000** 2.171 34 A 1.000** 2.171 35 E 1.000** 2.171 44 R 1.000** 2.171 45 S 1.000** 2.171 55 G 1.000** 2.171 57 P 1.000** 2.171 58 G 1.000** 2.171 59 V 1.000** 2.171 63 K 1.000** 2.171 66 G 1.000** 2.171 68 A 1.000** 2.171 71 D 1.000** 2.171 73 P 1.000** 2.171 76 R 1.000** 2.171 81 L 1.000** 2.171 83 A 1.000** 2.171 84 D 1.000** 2.171 95 T 1.000** 2.171 96 N 1.000** 2.171 100 K 1.000** 2.171 104 E 1.000** 2.171 105 F 1.000** 2.171 106 D 1.000** 2.171 107 G 1.000** 2.171 108 V 1.000** 2.171 109 S 1.000** 2.171 110 K 1.000** 2.171 111 E 1.000** 2.171 113 E 1.000** 2.171 119 V 1.000** 2.171 139 S 1.000** 2.171 144 K 1.000** 2.171 146 E 1.000** 2.171 148 T 1.000** 2.171 152 A 1.000** 2.171 159 A 1.000** 2.171 163 F 1.000** 2.171 164 I 1.000** 2.171 165 L 1.000** 2.171 167 P 1.000** 2.171 168 N 1.000** 2.171 169 G 1.000** 2.171 178 D 1.000** 2.171 183 D 1.000** 2.171 187 E 1.000** 2.171 191 I 1.000** 2.171 193 R 1.000** 2.171 197 N 1.000** 2.171 198 V 1.000** 2.171 199 Y 1.000** 2.171 200 G 1.000** 2.171 201 G 1.000** 2.171 203 T 1.000** 2.171 205 T 1.000** 2.171 206 P 1.000** 2.171 208 S 1.000** 2.171 210 V 1.000** 2.171 213 V 1.000** 2.171 217 G 1.000** 2.171 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Bsg-PH) Pr(w>1) post mean +- SE for w 6 L 0.667 1.858 +- 1.109 7 A 0.906 2.447 +- 0.691 8 S 0.980* 2.615 +- 0.469 9 A 0.903 2.439 +- 0.698 10 L 0.638 1.789 +- 1.128 11 S 0.969* 2.592 +- 0.516 12 F 0.524 1.510 +- 1.165 13 L 0.908 2.450 +- 0.687 20 Y 0.648 1.812 +- 1.122 34 A 0.878 2.381 +- 0.751 35 E 0.865 2.350 +- 0.775 44 R 0.622 1.749 +- 1.136 45 S 0.993** 2.643 +- 0.419 55 G 0.902 2.437 +- 0.702 57 P 0.686 1.906 +- 1.094 58 G 0.509 1.473 +- 1.166 59 V 0.564 1.607 +- 1.160 63 K 0.534 1.534 +- 1.164 66 G 0.877 2.379 +- 0.750 68 A 0.906 2.446 +- 0.692 71 D 0.881 2.389 +- 0.745 73 P 0.674 1.876 +- 1.104 76 R 0.920 2.479 +- 0.661 81 L 0.797 2.178 +- 0.965 83 A 0.985* 2.626 +- 0.451 95 T 0.930 2.502 +- 0.635 96 N 0.985* 2.627 +- 0.448 100 K 0.996** 2.650 +- 0.404 104 E 0.889 2.406 +- 0.729 105 F 0.893 2.415 +- 0.722 106 D 0.957* 2.563 +- 0.541 107 G 0.665 1.854 +- 1.110 108 V 0.866 2.354 +- 0.772 109 S 0.619 1.742 +- 1.138 110 K 0.730 2.014 +- 1.040 111 E 0.981* 2.619 +- 0.463 113 E 0.907 2.449 +- 0.688 119 V 0.547 1.566 +- 1.163 144 K 0.994** 2.646 +- 0.412 146 E 0.593 1.678 +- 1.149 148 T 0.937 2.518 +- 0.615 152 A 0.555 1.584 +- 1.162 159 A 0.979* 2.613 +- 0.472 163 F 0.899 2.430 +- 0.706 165 L 0.583 1.653 +- 1.153 167 P 0.728 2.009 +- 1.056 169 G 0.909 2.453 +- 0.685 183 D 0.967* 2.588 +- 0.510 187 E 0.556 1.587 +- 1.160 193 R 0.873 2.363 +- 0.819 198 V 0.964* 2.581 +- 0.520 199 Y 0.909 2.453 +- 0.685 200 G 0.596 1.686 +- 1.148 201 G 0.977* 2.610 +- 0.477 203 T 0.967* 2.588 +- 0.509 205 T 0.909 2.454 +- 0.684 206 P 0.672 1.870 +- 1.105 208 S 0.879 2.383 +- 0.747 210 V 0.994** 2.645 +- 0.415 213 V 0.574 1.632 +- 1.159
>C1 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA NVYGGNTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR NKSELEESDTDPQEQ >C2 MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVHGGNTTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR NKSELEESDTDPQEQ >C3 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVYGGNTTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR NKSELEESDTDPQEQ >C4 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFGNVTLTNDTDRVIVKPDNGVPNAILTLDNVTLDDRGEYKCTGKNAAN EYAKNTTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEKRRN KSELEESDTDPQEQo >C5 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA DAFGGNNTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR NKSELEESDTDPQEQ >C6 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS CNVKDTPGVLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDDGL YSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLSWT FGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAAND YGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR NKSELEESDTDPQEQ >C7 MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS CNVKEDTSSVLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDDG DYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLIW TFGNVTLTNSTDRFVLKPENNVPNAILTLDNVTLQDRGEYKCIGRNAAND YGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRR NKSELEESDTDPQEQ CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=268 C1 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS C2 MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS C3 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS C4 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS C5 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS C6 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS C7 MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS ***** . : ****** ************* ********: ***** C1 CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD C2 CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD C3 CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD C4 CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD C5 CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD C6 CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD C7 CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD **** .*.. :***:**.* **:*.** ****:* **********..** C1 GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT C2 GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT C3 GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT C4 GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT C5 GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT C6 GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS C7 GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI * ***. . :: * *****:*******************:**** *:* C1 WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA C2 WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA C3 WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA C4 WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA C5 WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA C6 WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA C7 WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA ***.****** *** ::*. :.********:****:***:*** *:*** C1 NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK C2 NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK C3 NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK C4 NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK C5 DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK C6 NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK C7 NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK : .. * .*: * * **:***.*************************** C1 RRNKSELEESDTDPQEQ- C2 RRNKSELEESDTDPQEQ- C3 RRNKSELEESDTDPQEQ- C4 RRNKSELEESDTDPQEQo C5 RRNKSELEESDTDPQEQ- C6 RRNKSELEESDTDPQEQ- C7 RRNKSELEESDTDPQEQ- ***************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 7 SEQUENCES [PROTEIN] Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 265 type PROTEIN Struct Unchecked Input File /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 265 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11760] Library Relaxation: Multi_proc [72] Relaxation Summary: [11760]--->[11602] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/27/Bsg-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.400 Mb, Max= 30.799 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C2 MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C3 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C4 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQo >C5 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C6 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C7 MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- FORMAT of file /tmp/tmp6418182139339182766aln Not Supported[FATAL:T-COFFEE] >C1 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA NVYGGN--TTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C2 MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVHGGN--TTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C3 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVYGGN--TTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C4 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFGNVTLTNDTDRVIVKPD-NGVPNAILTLDNVTLDDRGEYKCTGKNAA NEYAKN--TTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQo >C5 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA DAFGGN--NTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C6 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS CNVK-DTPG-VLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- >C7 MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS CNVKEDTSS-VLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI WTFGNVTLTNSTDRFVLKP-ENNVPNAILTLDNVTLQDRGEYKCIGRNAA NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:268 S:99 BS:268 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # PW_SEQ_DISTANCES BOT 0 1 93.21 C1 C2 93.21 TOP 1 0 93.21 C2 C1 93.21 BOT 0 2 97.36 C1 C3 97.36 TOP 2 0 97.36 C3 C1 97.36 BOT 0 3 88.64 C1 C4 88.64 TOP 3 0 88.64 C4 C1 88.64 BOT 0 4 96.60 C1 C5 96.60 TOP 4 0 96.60 C5 C1 96.60 BOT 0 5 85.93 C1 C6 85.93 TOP 5 0 85.93 C6 C1 85.93 BOT 0 6 86.69 C1 C7 86.69 TOP 6 0 86.69 C7 C1 86.69 BOT 1 2 94.72 C2 C3 94.72 TOP 2 1 94.72 C3 C2 94.72 BOT 1 3 84.47 C2 C4 84.47 TOP 3 1 84.47 C4 C2 84.47 BOT 1 4 91.70 C2 C5 91.70 TOP 4 1 91.70 C5 C2 91.70 BOT 1 5 81.75 C2 C6 81.75 TOP 5 1 81.75 C6 C2 81.75 BOT 1 6 84.03 C2 C7 84.03 TOP 6 1 84.03 C7 C2 84.03 BOT 2 3 87.50 C3 C4 87.50 TOP 3 2 87.50 C4 C3 87.50 BOT 2 4 94.72 C3 C5 94.72 TOP 4 2 94.72 C5 C3 94.72 BOT 2 5 85.55 C3 C6 85.55 TOP 5 2 85.55 C6 C3 85.55 BOT 2 6 87.07 C3 C7 87.07 TOP 6 2 87.07 C7 C3 87.07 BOT 3 4 88.64 C4 C5 88.64 TOP 4 3 88.64 C5 C4 88.64 BOT 3 5 82.82 C4 C6 82.82 TOP 5 3 82.82 C6 C4 82.82 BOT 3 6 82.44 C4 C7 82.44 TOP 6 3 82.44 C7 C4 82.44 BOT 4 5 85.55 C5 C6 85.55 TOP 5 4 85.55 C6 C5 85.55 BOT 4 6 87.07 C5 C7 87.07 TOP 6 4 87.07 C7 C5 87.07 BOT 5 6 87.88 C6 C7 87.88 TOP 6 5 87.88 C7 C6 87.88 AVG 0 C1 * 91.40 AVG 1 C2 * 88.31 AVG 2 C3 * 91.15 AVG 3 C4 * 85.75 AVG 4 C5 * 90.71 AVG 5 C6 * 84.91 AVG 6 C7 * 85.86 TOT TOT * 88.30 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT C2 ATGGAGGCAAAATTCTGGCTAGCGCTCTTTCATTCCTCCTCGATATTTTT C3 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT C4 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT C5 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT C6 ATGGAGGCGAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT C7 ATGGAGGCAAAATTCTTGGCTGGCGCTCTTTCATTCCTCTCGATATTTTT ********.******* * :. ** .:* * ************ C1 AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG C2 AGCAATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG C3 AGCGATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG C4 AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG C5 AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG C6 AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA C7 AGCGATTAATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA ***.***:******************** ********************. C1 CCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC C2 CCATGCATCAAATGAAATTTTACGACATCAGATCGCCACTCGTTCTCAGC C3 CCAAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC C4 TCGAACATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC C5 TCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC C6 TCGAGCATCAAATGAAATTTTACGACATCAGACACCCGCTGGTTCTCAGC C7 TCGAGCATCAAATGAAATTTTACGACATCAAAACGCCGCTGGTTCTCAGC *.:.*************************.* . **.** ********* C1 TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA C2 TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA C3 TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA C4 TGCAACGTGAAAGACAGTACGCCGGGCGGCCTGCTCATATGGAGAAAGAA C5 TGCAACGTGAAAGACGGTACGCCAGGCGGCGTGCTCATATGGAAAAAGAA C6 TGCAACGTGAAA---GACACGCCGGGC---GTGCTTATATGGAAAAAGAA C7 TGCAACGTGAAAGAAGATACGTCGAGC---GTTCTTATATGGAAAAAGAA ************ .. *** *..** * ** *******.****** C1 CGGCACCGCTGTGACGGATGTACCTTCTCTCAGAGGTCGCTTTAAGTTAA C2 CGGCACCGCTGTGACGGAGGTACCTTCTCTAATAGGTCGCTTTAAGTTAA C3 CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA C4 CGGCACCGTTGTGACGGAAGTAGCTTCTCTAAGAGGTCGCTTTAAGTTAA C5 CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA C6 CAACACCGATGTGACGCAGGTGCCTTCGCTGAAAGGTCGCTTTAAGCTAA C7 CGGCACCGCTGTGACGGAGGTGCCTTCGCTAAAGGGTCGCTTTAAGATAA *..***** ******* * **. **** ** * .************ *** C1 TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT C2 TCCCAGACGAGAATAAGTTCATCATCGATAAGACGGATACGAACGACGAT C3 TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT C4 TCCCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGACCGACGAT C5 TCGCAGACGAGAACAAGTTTATCATCGATAAGACGGATACGAACGACGAT C6 TCGAAGCCGAGAACAAGTTCATCATCGACAAGACGGACGCATCCGACGAT C7 TCGCAGCCGAGAATAAGTTCATCATCGACAAGACGGATGTAAGCGATGAT ** .**.****** ***** ******** ******** . .: *** *** C1 GGCAAATACAGTTGCGAGTTTGACGGCGTGTCCAAGGAAATCGAAGTAAT C2 GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT C3 GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT C4 GGCGAATACAGTTGCGAGTACAGTGGAGAGACCAAGAAAATCGAAGTAAT C5 GGCAAATACAGTTGCGAGTTCGACGGAGTGTCCAAGGAAATCGAAGTGAT C6 GGTCTTTACAGTTGCTCGATCAACGAAGAGTCCCGGAATATCACAGTGAT C7 GGCGATTACAGTTGCGAGATCGACGGAGAGTCCAAGATAATCAAAGTGAT ** ::********* .*:: .. *..*:*:**..*.::***..***.** C1 TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG C2 TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG C3 TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG C4 TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG C5 TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG C6 TGCCCGCGTTATTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG C7 TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGAG **********.*****.*******************************:* C1 AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAAACCAGAGTTGACA C2 AAAAGATGTCGGTGACCTGCAGTGTTGTGGGTACCAAACCAGAGTTGACA C3 AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAATCCAGAGTTGACA C4 AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCACAGTTGACA C5 AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCTCAGTTGACA C6 AGAAGATGTCGGTGACCTGCAGCGTTGTTGGTACCGATCCCCAGTTGTCA C7 AGAAGATGTCGGTGACTTGCACCGTTGTGGGTACCGCACCACAGTTGATA *.************** **** ***** **:***..:** *****: * C1 TGGACCTTTGCCAATGTAACGCTGACAAATGCCACAGATCGCTTCATTCT C2 TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT C3 TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT C4 TGGACCTTTGGCAATGTAACGCTGACAAACGACACAGATCGCGTCATCGT C5 TGGACCTTTGCCAATGTAACGCTGACAAACGGCACAGATCGCTTCATCCT C6 TGGACCTTTGGCAATGTAACGCTGACAAACTCCACAGATCGTTACATCCT C7 TGGACTTTTGGCAATGTAACGCTGACAAACTCAACGGATCGCTTCGTCCT ***** **** ****************** .**.***** :*.* * C1 CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGATAATG C2 CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG C3 CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG C4 CAAACCAGAT---AATGGTGTTCCTAACGCCATTCTGACACTGGACAATG C5 CAAACCAGACGATAATGGTGTTCCCAACGCCATTCTGACACTGGATAATG C6 CAAGGCGGACGAGGACAATGTCCCCAACGCCATTCTGACATTGGACAATG C7 CAAACCA---GAAAACAATGTCCCCAACGCCATTCTGACACTGGACAATG ***. *. .* ..*** ** *************** **** **** C1 TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC C2 TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC C3 TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC C4 TGACATTGGACGACAGAGGCGAATACAAATGCACTGGAAAAAATGCGGCC C5 TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC C6 TGACATTGGACGACAGAGGCGACTACAAATGCATTGGACGCAATGCGGCC C7 TGACATTGCAAGACAGAGGCGAGTACAAATGCATTGGACGCAATGCGGCC ******** *.*********** ********** ****...********* C1 AATGTCTACGGTGGGAAC------ACCACCACTCCTGCCAGCGACGTCAC C2 AATGTCCACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACTTCAC C3 AATGTCTACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACGTCAC C4 AATGAATACGCTAAGAAC------ACCACTACTCTTGCCACCGACGCCAC C5 GATGCCTTCGGTGGGAAC------AACACCACTCCTGCCAGCGACTTCAC C6 AATGACTACGGTGTGAATGGCACCAACACCGCCCCTGCCATCGACGTCAC C7 AATGACTATGGTGTGAACGGCACCAGCACTGCTCCTGCCAGCGACTTCAC .*** . : * *. *** * *** .* * ***** **** *** C1 AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA C2 AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA C3 AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA C4 AACTCTTCGTGTTAAGAGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA C5 AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA C6 AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA C7 AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA **** * *********.********************************* C1 TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG C2 TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG C3 TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG C4 TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG C5 TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG C6 TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTACGAGAAG C7 TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTATGAGAAG **************************************** ** ****** C1 CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA C2 CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA C3 CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA C4 CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA C5 CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA C6 CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA C7 CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCTCAAGAACA ***************************************** ******** C1 G--- C2 G--- C3 G--- C4 G--- C5 G--- C6 G--- C7 G--- * >C1 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG CCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA CGGCACCGCTGTGACGGATGTACCTTCTCTCAGAGGTCGCTTTAAGTTAA TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT GGCAAATACAGTTGCGAGTTTGACGGCGTGTCCAAGGAAATCGAAGTAAT TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAAACCAGAGTTGACA TGGACCTTTGCCAATGTAACGCTGACAAATGCCACAGATCGCTTCATTCT CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGATAATG TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC AATGTCTACGGTGGGAAC------ACCACCACTCCTGCCAGCGACGTCAC AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA G--- >C2 ATGGAGGCAAAATTCTGGCTAGCGCTCTTTCATTCCTCCTCGATATTTTT AGCAATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG CCATGCATCAAATGAAATTTTACGACATCAGATCGCCACTCGTTCTCAGC TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA CGGCACCGCTGTGACGGAGGTACCTTCTCTAATAGGTCGCTTTAAGTTAA TCCCAGACGAGAATAAGTTCATCATCGATAAGACGGATACGAACGACGAT GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG AAAAGATGTCGGTGACCTGCAGTGTTGTGGGTACCAAACCAGAGTTGACA TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC AATGTCCACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACTTCAC AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA G--- >C3 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT AGCGATTTATGCTCAATCACTTGATAAGTTGGTGCCAAACTATGATAATG CCAAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC TGCAACGTGAAAGACGGTACGCCGGGCGGCGTGCTCATATGGAAAAAGAA CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA TCGCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGAACGACGAT GGCAAATACAGTTGCGAGTTCGACGGAGAGTCCAAGGAAATCGAAGTGAT TGCCCGCGTTGTTGTACGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG AAAAGATGTCGGTGACCTGCAGCGTTGTGGGTACCAATCCAGAGTTGACA TGGACCTTTGCCAATGTAACGCTGACAAACGCCACAGATCGCTTCATCCT CAAACCAGACGATAATGGTGTTCCTAACGCCATTCTGACACTGGAAAATG TGACATTGGAAGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC AATGTCTACGGTGGGAAC------ACCACCGCTCCTGCCAGCGACGTCAC AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA G--- >C4 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG TCGAACATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC TGCAACGTGAAAGACAGTACGCCGGGCGGCCTGCTCATATGGAGAAAGAA CGGCACCGTTGTGACGGAAGTAGCTTCTCTAAGAGGTCGCTTTAAGTTAA TCCCAGACGAGAACAAGTTCATCATCGATAAGACGGATACGACCGACGAT GGCGAATACAGTTGCGAGTACAGTGGAGAGACCAAGAAAATCGAAGTAAT TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCACAGTTGACA TGGACCTTTGGCAATGTAACGCTGACAAACGACACAGATCGCGTCATCGT CAAACCAGAT---AATGGTGTTCCTAACGCCATTCTGACACTGGACAATG TGACATTGGACGACAGAGGCGAATACAAATGCACTGGAAAAAATGCGGCC AATGAATACGCTAAGAAC------ACCACTACTCTTGCCACCGACGCCAC AACTCTTCGTGTTAAGAGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA G--- >C5 ATGGAGGCAAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATG TCGAGCATCAAATGAAATTTTACGACATCAGATCGCCGCTCGTTCTCAGC TGCAACGTGAAAGACGGTACGCCAGGCGGCGTGCTCATATGGAAAAAGAA CGGCACCGCTGTGACGGAGGTACCTTCTCTAAGAGGTCGCTTTAAGTTAA TCGCAGACGAGAACAAGTTTATCATCGATAAGACGGATACGAACGACGAT GGCAAATACAGTTGCGAGTTCGACGGAGTGTCCAAGGAAATCGAAGTGAT TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG AGAAGATGTCGGTGACCTGCAGCGTTGTGGGAACCAAACCTCAGTTGACA TGGACCTTTGCCAATGTAACGCTGACAAACGGCACAGATCGCTTCATCCT CAAACCAGACGATAATGGTGTTCCCAACGCCATTCTGACACTGGATAATG TGACATTGGACGACAGAGGCGAATACAAATGCATTGGACGAAATGCGGCC GATGCCTTCGGTGGGAAC------AACACCACTCCTGCCAGCGACTTCAC AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATTTATGAGAAG CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA G--- >C6 ATGGAGGCGAAATTCTTGGCTAGCGCTCTTTCATTCCTCTCGATATTTTT AGCGATTTATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA TCGAGCATCAAATGAAATTTTACGACATCAGACACCCGCTGGTTCTCAGC TGCAACGTGAAA---GACACGCCGGGC---GTGCTTATATGGAAAAAGAA CAACACCGATGTGACGCAGGTGCCTTCGCTGAAAGGTCGCTTTAAGCTAA TCGAAGCCGAGAACAAGTTCATCATCGACAAGACGGACGCATCCGACGAT GGTCTTTACAGTTGCTCGATCAACGAAGAGTCCCGGAATATCACAGTGAT TGCCCGCGTTATTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGTG AGAAGATGTCGGTGACCTGCAGCGTTGTTGGTACCGATCCCCAGTTGTCA TGGACCTTTGGCAATGTAACGCTGACAAACTCCACAGATCGTTACATCCT CAAGGCGGACGAGGACAATGTCCCCAACGCCATTCTGACATTGGACAATG TGACATTGGACGACAGAGGCGACTACAAATGCATTGGACGCAATGCGGCC AATGACTACGGTGTGAATGGCACCAACACCGCCCCTGCCATCGACGTCAC AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTACGAGAAG CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCCCAAGAACA G--- >C7 ATGGAGGCAAAATTCTTGGCTGGCGCTCTTTCATTCCTCTCGATATTTTT AGCGATTAATGCTCAATCACTTGATAAGCTGGTGCCAAACTATGATAATA TCGAGCATCAAATGAAATTTTACGACATCAAAACGCCGCTGGTTCTCAGC TGCAACGTGAAAGAAGATACGTCGAGC---GTTCTTATATGGAAAAAGAA CGGCACCGCTGTGACGGAGGTGCCTTCGCTAAAGGGTCGCTTTAAGATAA TCGCAGCCGAGAATAAGTTCATCATCGACAAGACGGATGTAAGCGATGAT GGCGATTACAGTTGCGAGATCGACGGAGAGTCCAAGATAATCAAAGTGAT TGCCCGCGTTGTTGTAAGAGTGCCTTCAAATACAGCCGTTGTGGAGGGAG AGAAGATGTCGGTGACTTGCACCGTTGTGGGTACCGCACCACAGTTGATA TGGACTTTTGGCAATGTAACGCTGACAAACTCAACGGATCGCTTCGTCCT CAAACCA---GAAAACAATGTCCCCAACGCCATTCTGACACTGGACAATG TGACATTGCAAGACAGAGGCGAGTACAAATGCATTGGACGCAATGCGGCC AATGACTATGGTGTGAACGGCACCAGCACTGCTCCTGCCAGCGACTTCAC AACTGTGCGTGTTAAGGGCAAATTTGCCGCCTTGTGGCCTTTCCTGGGCA TCTGTGCTGAGGTGCTGATTCTGTGCATCATCATTCTCATCTATGAGAAG CGACGCAACAAGAGCGAACTGGAGGAGAGTGATACTGATCCTCAAGAACA G--- >C1 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTDVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA NVYGGNooTTTPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ >C2 MEAKFWLALFHSSSIFLAIYAQSLDKLVPNYDNAMHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLIGRFKLIPDENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVHGGNooTTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ >C3 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNAKHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGESKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTNPELT WTFANVTLTNATDRFILKPDDNGVPNAILTLENVTLEDRGEYKCIGRNAA NVYGGNooTTAPASDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ >C4 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDSTPGGLLIWRKNGTVVTEVASLRGRFKLIPDENKFIIDKTDTTDD GEYSCEYSGETKKIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFGNVTLTNDTDRVIVKPDoNGVPNAILTLDNVTLDDRGEYKCTGKNAA NEYAKNooTTTLATDATTLRVKSKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ >C5 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNVEHQMKFYDIRSPLVLS CNVKDGTPGGVLIWKKNGTAVTEVPSLRGRFKLIADENKFIIDKTDTNDD GKYSCEFDGVSKEIEVIARVVVRVPSNTAVVEGEKMSVTCSVVGTKPQLT WTFANVTLTNGTDRFILKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAA DAFGGNooNTTPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ >C6 MEAKFLASALSFLSIFLAIYAQSLDKLVPNYDNIEHQMKFYDIRHPLVLS CNVKoDTPGoVLIWKKNNTDVTQVPSLKGRFKLIEAENKFIIDKTDASDD GLYSCSINEESRNITVIARVIVRVPSNTAVVEGEKMSVTCSVVGTDPQLS WTFGNVTLTNSTDRYILKADEDNVPNAILTLDNVTLDDRGDYKCIGRNAA NDYGVNGTNTAPAIDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ >C7 MEAKFLAGALSFLSIFLAINAQSLDKLVPNYDNIEHQMKFYDIKTPLVLS CNVKEDTSSoVLIWKKNGTAVTEVPSLKGRFKIIAAENKFIIDKTDVSDD GDYSCEIDGESKIIKVIARVVVRVPSNTAVVEGEKMSVTCTVVGTAPQLI WTFGNVTLTNSTDRFVLKPoENNVPNAILTLDNVTLQDRGEYKCIGRNAA NDYGVNGTSTAPASDFTTVRVKGKFAALWPFLGICAEVLILCIIILIYEK RRNKSELEESDTDPQEQ MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 7 taxa and 804 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479467318 Setting output file names to "/opt/ADOPS/27/Bsg-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1198977085 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 8645811969 Seed = 1942543022 Swapseed = 1479467318 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 50 unique site patterns Division 2 has 48 unique site patterns Division 3 has 56 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2721.204680 -- -24.557203 Chain 2 -- -2712.778973 -- -24.557203 Chain 3 -- -2719.642580 -- -24.557203 Chain 4 -- -2712.782896 -- -24.557203 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2702.795657 -- -24.557203 Chain 2 -- -2713.379331 -- -24.557203 Chain 3 -- -2733.849346 -- -24.557203 Chain 4 -- -2715.609833 -- -24.557203 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2721.205] (-2712.779) (-2719.643) (-2712.783) * [-2702.796] (-2713.379) (-2733.849) (-2715.610) 500 -- (-2182.707) [-2190.344] (-2190.262) (-2198.518) * [-2186.091] (-2194.796) (-2188.758) (-2193.867) -- 0:00:00 1000 -- (-2171.926) [-2181.752] (-2176.121) (-2186.107) * [-2184.910] (-2188.475) (-2181.308) (-2185.137) -- 0:00:00 1500 -- [-2173.709] (-2185.987) (-2176.852) (-2178.053) * (-2174.797) [-2180.062] (-2178.376) (-2178.212) -- 0:00:00 2000 -- [-2168.576] (-2181.786) (-2174.233) (-2184.224) * (-2169.900) (-2178.796) [-2179.980] (-2171.696) -- 0:00:00 2500 -- (-2173.843) [-2173.893] (-2173.274) (-2186.801) * [-2178.329] (-2180.014) (-2173.265) (-2170.785) -- 0:00:00 3000 -- (-2177.527) (-2173.037) (-2170.759) [-2178.445] * (-2174.205) (-2181.098) [-2175.228] (-2172.480) -- 0:05:32 3500 -- (-2180.337) [-2167.863] (-2172.599) (-2176.393) * (-2174.104) (-2176.635) [-2183.673] (-2175.591) -- 0:04:44 4000 -- (-2175.136) (-2175.598) [-2172.002] (-2174.813) * [-2175.588] (-2176.906) (-2179.594) (-2171.779) -- 0:04:09 4500 -- [-2178.010] (-2189.788) (-2170.297) (-2176.350) * [-2173.009] (-2178.794) (-2172.588) (-2168.663) -- 0:03:41 5000 -- (-2181.168) (-2170.393) [-2166.871] (-2172.107) * (-2172.635) (-2178.054) [-2174.308] (-2177.842) -- 0:03:19 Average standard deviation of split frequencies: 0.026189 5500 -- (-2181.309) (-2169.000) [-2174.077] (-2174.367) * (-2175.554) [-2175.051] (-2173.968) (-2182.135) -- 0:03:00 6000 -- (-2172.046) (-2176.403) (-2171.210) [-2177.502] * (-2179.283) (-2178.656) (-2171.594) [-2181.076] -- 0:05:31 6500 -- [-2167.836] (-2172.637) (-2176.325) (-2172.192) * (-2172.045) (-2180.278) (-2173.035) [-2176.221] -- 0:05:05 7000 -- (-2170.458) (-2177.956) (-2174.987) [-2169.671] * [-2167.347] (-2172.233) (-2182.309) (-2174.559) -- 0:04:43 7500 -- (-2176.479) [-2175.575] (-2171.818) (-2168.630) * (-2173.888) [-2173.540] (-2179.003) (-2175.601) -- 0:04:24 8000 -- [-2169.163] (-2173.829) (-2170.533) (-2170.950) * (-2180.792) [-2172.144] (-2177.339) (-2177.688) -- 0:04:08 8500 -- (-2168.053) (-2179.289) [-2175.225] (-2174.536) * [-2174.432] (-2169.875) (-2173.738) (-2173.777) -- 0:03:53 9000 -- (-2172.195) (-2170.250) [-2170.880] (-2173.467) * (-2170.597) [-2174.124] (-2171.933) (-2183.065) -- 0:03:40 9500 -- [-2174.627] (-2186.648) (-2176.219) (-2176.779) * (-2172.414) (-2180.837) [-2169.385] (-2177.593) -- 0:05:12 10000 -- (-2174.576) (-2170.889) [-2172.751] (-2169.720) * (-2175.144) (-2176.895) (-2178.227) [-2174.815] -- 0:04:57 Average standard deviation of split frequencies: 0.008839 10500 -- (-2170.911) (-2177.715) (-2180.133) [-2172.929] * (-2174.587) (-2177.684) (-2172.449) [-2176.382] -- 0:04:42 11000 -- (-2168.055) (-2176.139) [-2169.476] (-2171.499) * (-2169.290) [-2175.752] (-2168.979) (-2182.567) -- 0:04:29 11500 -- (-2175.144) [-2179.400] (-2175.504) (-2175.800) * (-2176.367) [-2170.201] (-2180.522) (-2181.096) -- 0:04:17 12000 -- [-2172.042] (-2181.109) (-2172.979) (-2175.124) * (-2174.386) [-2170.693] (-2175.914) (-2175.946) -- 0:04:07 12500 -- [-2176.079] (-2168.363) (-2191.329) (-2174.636) * (-2171.842) (-2170.151) [-2167.383] (-2185.818) -- 0:05:16 13000 -- (-2172.248) (-2177.990) [-2175.953] (-2172.072) * (-2173.807) (-2171.557) [-2171.727] (-2177.938) -- 0:05:03 13500 -- (-2176.636) [-2171.644] (-2171.246) (-2172.563) * (-2173.328) (-2174.908) [-2169.394] (-2169.749) -- 0:04:52 14000 -- (-2171.983) (-2176.874) [-2172.101] (-2172.210) * (-2171.701) [-2178.311] (-2175.495) (-2172.511) -- 0:04:41 14500 -- (-2175.403) [-2176.918] (-2178.296) (-2168.584) * (-2171.408) (-2173.732) (-2175.065) [-2175.789] -- 0:04:31 15000 -- (-2179.330) (-2175.981) (-2172.492) [-2171.721] * (-2172.154) (-2175.811) (-2177.618) [-2174.978] -- 0:04:22 Average standard deviation of split frequencies: 0.011785 15500 -- [-2174.110] (-2174.061) (-2179.975) (-2179.191) * (-2178.099) (-2173.551) [-2168.629] (-2167.356) -- 0:05:17 16000 -- (-2172.801) (-2172.478) [-2177.642] (-2171.847) * [-2172.896] (-2173.199) (-2172.513) (-2177.058) -- 0:05:07 16500 -- (-2170.890) (-2179.915) [-2171.863] (-2177.543) * [-2175.978] (-2174.431) (-2170.369) (-2175.265) -- 0:04:58 17000 -- (-2172.599) (-2172.018) (-2174.007) [-2175.856] * (-2184.062) (-2174.679) (-2183.613) [-2169.988] -- 0:04:49 17500 -- [-2171.956] (-2185.116) (-2171.147) (-2175.327) * [-2179.594] (-2170.794) (-2172.148) (-2176.876) -- 0:04:40 18000 -- (-2176.380) (-2178.041) (-2173.500) [-2165.981] * [-2174.741] (-2175.641) (-2176.263) (-2178.923) -- 0:04:32 18500 -- (-2173.234) (-2167.426) (-2181.544) [-2170.961] * (-2176.989) (-2170.430) [-2170.548] (-2179.767) -- 0:04:25 19000 -- [-2174.793] (-2171.684) (-2184.839) (-2172.418) * (-2180.602) (-2174.231) [-2174.132] (-2176.645) -- 0:05:09 19500 -- (-2179.094) [-2172.960] (-2180.012) (-2172.823) * (-2183.263) (-2175.723) [-2173.847] (-2178.096) -- 0:05:01 20000 -- (-2176.516) [-2168.168] (-2178.129) (-2179.616) * (-2173.343) [-2174.845] (-2174.872) (-2182.671) -- 0:04:54 Average standard deviation of split frequencies: 0.007603 20500 -- (-2173.553) (-2169.742) (-2173.706) [-2177.837] * (-2173.974) (-2173.030) [-2176.466] (-2176.330) -- 0:04:46 21000 -- (-2170.989) (-2171.503) [-2173.912] (-2176.078) * [-2175.059] (-2171.701) (-2176.949) (-2179.575) -- 0:04:39 21500 -- (-2177.983) [-2174.579] (-2172.889) (-2178.609) * (-2171.253) (-2175.033) [-2172.155] (-2174.098) -- 0:04:33 22000 -- [-2177.794] (-2170.041) (-2175.867) (-2177.245) * (-2177.710) [-2185.704] (-2172.537) (-2176.744) -- 0:05:11 22500 -- [-2167.074] (-2172.032) (-2177.383) (-2176.290) * (-2178.547) [-2171.014] (-2180.580) (-2171.210) -- 0:05:04 23000 -- [-2176.129] (-2173.191) (-2173.587) (-2174.895) * (-2172.888) (-2173.246) [-2174.227] (-2173.752) -- 0:04:57 23500 -- (-2174.803) [-2171.939] (-2170.580) (-2173.922) * (-2173.603) (-2170.881) [-2177.267] (-2186.980) -- 0:04:50 24000 -- [-2167.779] (-2178.474) (-2172.367) (-2182.270) * [-2173.942] (-2173.114) (-2182.246) (-2175.625) -- 0:04:44 24500 -- [-2176.083] (-2175.996) (-2176.990) (-2189.329) * (-2175.205) (-2178.090) [-2172.718] (-2178.153) -- 0:04:38 25000 -- (-2173.442) (-2176.178) [-2178.249] (-2175.172) * [-2168.122] (-2179.070) (-2182.967) (-2168.229) -- 0:04:33 Average standard deviation of split frequencies: 0.006044 25500 -- (-2172.238) [-2171.648] (-2177.757) (-2184.172) * (-2171.890) [-2170.691] (-2174.112) (-2175.324) -- 0:05:05 26000 -- (-2171.287) (-2176.911) [-2181.765] (-2178.373) * (-2174.296) (-2170.133) (-2176.087) [-2173.314] -- 0:04:59 26500 -- [-2170.173] (-2172.422) (-2172.542) (-2176.081) * (-2172.953) (-2178.851) [-2172.095] (-2172.847) -- 0:04:53 27000 -- (-2177.450) [-2176.027] (-2182.807) (-2178.919) * (-2172.148) (-2183.117) [-2169.693] (-2170.308) -- 0:04:48 27500 -- (-2174.465) (-2186.555) [-2172.573] (-2181.388) * [-2174.403] (-2172.155) (-2176.643) (-2180.333) -- 0:04:42 28000 -- (-2173.077) (-2185.502) [-2174.832] (-2175.674) * [-2170.802] (-2188.276) (-2174.671) (-2176.415) -- 0:04:37 28500 -- [-2174.213] (-2185.649) (-2176.751) (-2178.205) * (-2170.911) (-2187.629) (-2172.349) [-2172.942] -- 0:05:06 29000 -- [-2177.006] (-2179.934) (-2174.691) (-2179.452) * (-2172.222) (-2183.285) (-2174.645) [-2168.705] -- 0:05:01 29500 -- (-2180.682) (-2181.982) [-2173.942] (-2180.799) * (-2179.424) (-2175.728) (-2175.375) [-2177.922] -- 0:04:56 30000 -- (-2177.355) (-2175.189) (-2173.151) [-2179.345] * (-2173.911) (-2176.773) (-2173.409) [-2171.806] -- 0:04:51 Average standard deviation of split frequencies: 0.003074 30500 -- (-2171.688) [-2175.674] (-2170.384) (-2179.808) * (-2173.628) (-2179.307) (-2177.584) [-2174.812] -- 0:04:46 31000 -- [-2171.023] (-2174.388) (-2174.674) (-2171.738) * [-2173.172] (-2177.245) (-2175.050) (-2172.078) -- 0:04:41 31500 -- (-2179.350) (-2175.419) (-2173.829) [-2172.326] * [-2175.667] (-2176.118) (-2180.901) (-2173.936) -- 0:05:07 32000 -- [-2169.929] (-2187.572) (-2177.098) (-2169.960) * (-2175.328) (-2173.039) (-2174.189) [-2176.802] -- 0:05:02 32500 -- (-2177.399) (-2175.244) (-2176.634) [-2176.369] * (-2177.086) [-2174.625] (-2179.028) (-2176.575) -- 0:04:57 33000 -- (-2180.520) [-2181.868] (-2179.965) (-2170.017) * (-2183.383) (-2185.694) [-2180.969] (-2170.024) -- 0:04:53 33500 -- (-2172.591) (-2176.700) [-2170.361] (-2171.101) * (-2176.261) (-2173.603) (-2180.265) [-2168.558] -- 0:04:48 34000 -- (-2171.109) [-2176.406] (-2176.640) (-2175.612) * (-2176.738) (-2172.866) (-2180.333) [-2178.779] -- 0:04:44 34500 -- (-2178.007) [-2173.057] (-2168.524) (-2170.814) * (-2175.358) [-2181.501] (-2187.183) (-2181.673) -- 0:04:39 35000 -- (-2175.452) (-2179.837) [-2173.821] (-2177.330) * (-2172.619) (-2178.903) [-2181.103] (-2172.216) -- 0:05:03 Average standard deviation of split frequencies: 0.002619