--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Nov 17 19:37:39 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/262/Gr39a-PC/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2518.25 -2528.29 2 -2518.22 -2527.58 -------------------------------------- TOTAL -2518.23 -2528.00 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.218506 0.000593 0.172458 0.265924 0.216958 1455.13 1478.07 1.000 r(A<->C){all} 0.100739 0.000683 0.049751 0.151187 0.099331 913.64 1010.75 1.000 r(A<->G){all} 0.302085 0.001883 0.213195 0.384055 0.300900 874.77 886.74 1.000 r(A<->T){all} 0.062740 0.000362 0.028757 0.100305 0.060704 1063.91 1145.90 1.000 r(C<->G){all} 0.072377 0.000600 0.026632 0.120398 0.069959 905.27 1007.86 1.000 r(C<->T){all} 0.375596 0.002012 0.290225 0.461423 0.374746 939.97 978.77 1.000 r(G<->T){all} 0.086462 0.000510 0.043410 0.130271 0.084398 733.86 953.37 1.000 pi(A){all} 0.257812 0.000160 0.233417 0.282055 0.257504 1117.25 1264.97 1.000 pi(C){all} 0.213849 0.000133 0.191266 0.235865 0.213778 1137.88 1230.65 1.000 pi(G){all} 0.214174 0.000136 0.192680 0.238042 0.214037 1297.37 1307.16 1.000 pi(T){all} 0.314165 0.000174 0.286122 0.338098 0.313842 1262.36 1311.10 1.000 alpha{1,2} 0.117795 0.010068 0.000122 0.296380 0.096622 1198.34 1249.40 1.000 alpha{3} 1.551467 0.476559 0.424633 2.891054 1.439127 1296.66 1383.40 1.000 pinvar{all} 0.196005 0.013584 0.000126 0.397898 0.191459 1184.61 1194.21 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2444.989248 Model 2: PositiveSelection -2441.277885 Model 0: one-ratio -2448.572241 Model 3: discrete -2441.260829 Model 7: beta -2446.250054 Model 8: beta&w>1 -2441.274511 Model 0 vs 1 7.165985999999975 Model 2 vs 1 7.422725999999784 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 1.000** 12.029 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 0.917 2.526 +- 1.482 274 L 0.607 1.939 +- 1.620 Model 8 vs 7 9.951086000000032 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 1.000** 12.063 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 0.915 1.676 +- 0.612 274 L 0.536 1.243 +- 0.774
>C1 MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY LVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C2 MNFQPCELCAYYRLCRYLGIFCIDYSPTKNKFRLRRSVLCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLGWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIIVKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C3 MNFQPCELCAYYRLCRYLGIFCIDYSPTKKKFRLRRSVFCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLILLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIILKLITNVVWLSPTFMTFAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C4 MDFKPSELCAYYRLCRYLGIFCIDYNPAKKRIRLRRSVLCYVIHFALQAY LVGCMSVMVTYWRRCFKKELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIECYRRRHLANVRLLLPKRLLWLIIATNVLYMVNFIKTCVL EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCIVHIVRLVLIWNQSQIN AVIDESADLKKTGANRMRLRACLEVHDRLIMLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVIKLITNVVWLSPTFMTCAASFMSNRLI IQANKTAKILAKVPRTGTGLDRMIEKFLLKNIRQQPILTAYGFFTLDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C5 MDFQPGELCAYYRLCRYLGIFCIDYNSTKKKFRLRRSVLCYVVHFALQAY LVGCMFVMFTYWRRCFKSELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIEFYRRRHLANVRLLLPKRLFWLIIATNLLYMANFIKTCVF EWLTDAPRFFVITSLGFPLRYLVTSFTMGTYFCMVHIIRLVLRWNQLEIN AVIEELADLKKTGPNRLRLRACLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRRQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=381 C1 MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY C2 MNFQPCELCAYYRLCRYLGIFCIDYSPTKNKFRLRRSVLCYVVHFALQAY C3 MNFQPCELCAYYRLCRYLGIFCIDYSPTKKKFRLRRSVFCYVVHFALQAY C4 MDFKPSELCAYYRLCRYLGIFCIDYNPAKKRIRLRRSVLCYVIHFALQAY C5 MDFQPGELCAYYRLCRYLGIFCIDYNSTKKKFRLRRSVLCYVVHFALQAY *:*:* *******************..:*:::******:**::******* C1 LVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ C2 LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ C3 LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ C4 LVGCMSVMVTYWRRCFKKELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ C5 LVGCMFVMFTYWRRCFKSELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ *** : **. *******.***************:**************** C1 APHLRIVRQIEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIF C2 APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF C3 APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF C4 APHLRIVRQIECYRRRHLANVRLLLPKRLLWLIIATNVLYMVNFIKTCVL C5 APHLRIVRQIEFYRRRHLANVRLLLPKRLFWLIIATNLLYMANFIKTCVF *********** ***.:***.********:*:*****::**.******:: C1 EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN C2 EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLGWNQSQIN C3 EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN C4 EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCIVHIVRLVLIWNQSQIN C5 EWLTDAPRFFVITSLGFPLRYLVTSFTMGTYFCMVHIIRLVLRWNQLEIN ******.*:************************:***:**** *** :** C1 AIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM C2 AIIDKSADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM C3 AIIDKSADLKMTSPNRLRLRVCLEMHDRLILLCNDEISLVYGFIAWLSWM C4 AVIDESADLKKTGANRMRLRACLEVHDRLIMLCNDEISLVYGFIAWLSWM C5 AVIEELADLKKTGPNRLRLRACLEMHDRLMLLCNDEISLVYGFIAWLSWM *:*:: **** *..**:***.***:****::******************* C1 FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT C2 FASLDVTGVIYLTMVIQTNKSIIVKLITNVVWLSPTFMTCAASFMSNRVT C3 FASLDVTGVIYLTMVIQTNKSIILKLITNVVWLSPTFMTFAASFMSNRVT C4 FASLDVTGVIYLTMVIQTNKSIVIKLITNVVWLSPTFMTCAASFMSNRLI C5 FASLDVTGVIYLTMVIQTNKSIVLKLITNVVWLSPTFMTCAASFMSNRVT ******************:***::*************** ********: C1 IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKST C2 IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST C3 IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST C4 IQANKTAKILAKVPRTGTGLDRMIEKFLLKNIRQQPILTAYGFFTLDKST C5 IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRRQPILTAYGFFALDKST ********:*:********************:*::*********:***** C1 LFKLFTAIFTYMVILVQFKEMENSTKSINKF C2 LFKLFTAIFTYMVILVQFKEMENSTKSINKF C3 LFKLFTAIFTYMVILVQFKEMENSTKSINKF C4 LFKLFTAIFTYMVILVQFKEMENSTKSINKF C5 LFKLFTAIFTYMVILVQFKEMENSTKSINKF ******************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] ugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 5 SEQUENCES [PROTEIN] Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 381 type PROTEIN Struct Unchecked Input File /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 381 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [7620] Library Relaxation: Multi_proc [72] Relaxation Summary: [7620]--->[7620] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/262/Gr39a-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.312 Mb, Max= 30.674 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY LVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C2 MNFQPCELCAYYRLCRYLGIFCIDYSPTKNKFRLRRSVLCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLGWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIIVKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C3 MNFQPCELCAYYRLCRYLGIFCIDYSPTKKKFRLRRSVFCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLILLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIILKLITNVVWLSPTFMTFAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C4 MDFKPSELCAYYRLCRYLGIFCIDYNPAKKRIRLRRSVLCYVIHFALQAY LVGCMSVMVTYWRRCFKKELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIECYRRRHLANVRLLLPKRLLWLIIATNVLYMVNFIKTCVL EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCIVHIVRLVLIWNQSQIN AVIDESADLKKTGANRMRLRACLEVHDRLIMLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVIKLITNVVWLSPTFMTCAASFMSNRLI IQANKTAKILAKVPRTGTGLDRMIEKFLLKNIRQQPILTAYGFFTLDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C5 MDFQPGELCAYYRLCRYLGIFCIDYNSTKKKFRLRRSVLCYVVHFALQAY LVGCMFVMFTYWRRCFKSELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIEFYRRRHLANVRLLLPKRLFWLIIATNLLYMANFIKTCVF EWLTDAPRFFVITSLGFPLRYLVTSFTMGTYFCMVHIIRLVLRWNQLEIN AVIEELADLKKTGPNRLRLRACLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRRQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF FORMAT of file /tmp/tmp1880314098720395615aln Not Supported[FATAL:T-COFFEE] >C1 MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY LVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C2 MNFQPCELCAYYRLCRYLGIFCIDYSPTKNKFRLRRSVLCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLGWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIIVKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C3 MNFQPCELCAYYRLCRYLGIFCIDYSPTKKKFRLRRSVFCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLILLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIILKLITNVVWLSPTFMTFAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C4 MDFKPSELCAYYRLCRYLGIFCIDYNPAKKRIRLRRSVLCYVIHFALQAY LVGCMSVMVTYWRRCFKKELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIECYRRRHLANVRLLLPKRLLWLIIATNVLYMVNFIKTCVL EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCIVHIVRLVLIWNQSQIN AVIDESADLKKTGANRMRLRACLEVHDRLIMLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVIKLITNVVWLSPTFMTCAASFMSNRLI IQANKTAKILAKVPRTGTGLDRMIEKFLLKNIRQQPILTAYGFFTLDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C5 MDFQPGELCAYYRLCRYLGIFCIDYNSTKKKFRLRRSVLCYVVHFALQAY LVGCMFVMFTYWRRCFKSELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIEFYRRRHLANVRLLLPKRLFWLIIATNLLYMANFIKTCVF EWLTDAPRFFVITSLGFPLRYLVTSFTMGTYFCMVHIIRLVLRWNQLEIN AVIEELADLKKTGPNRLRLRACLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRRQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:381 S:100 BS:381 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # PW_SEQ_DISTANCES BOT 0 1 95.01 C1 C2 95.01 TOP 1 0 95.01 C2 C1 95.01 BOT 0 2 95.01 C1 C3 95.01 TOP 2 0 95.01 C3 C1 95.01 BOT 0 3 90.55 C1 C4 90.55 TOP 3 0 90.55 C4 C1 90.55 BOT 0 4 92.91 C1 C5 92.91 TOP 4 0 92.91 C5 C1 92.91 BOT 1 2 98.43 C2 C3 98.43 TOP 2 1 98.43 C3 C2 98.43 BOT 1 3 89.50 C2 C4 89.50 TOP 3 1 89.50 C4 C2 89.50 BOT 1 4 91.34 C2 C5 91.34 TOP 4 1 91.34 C5 C2 91.34 BOT 2 3 89.50 C3 C4 89.50 TOP 3 2 89.50 C4 C3 89.50 BOT 2 4 91.08 C3 C5 91.08 TOP 4 2 91.08 C5 C3 91.08 BOT 3 4 90.55 C4 C5 90.55 TOP 4 3 90.55 C5 C4 90.55 AVG 0 C1 * 93.37 AVG 1 C2 * 93.57 AVG 2 C3 * 93.50 AVG 3 C4 * 90.03 AVG 4 C5 * 91.47 TOT TOT * 92.39 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGACTTCCAACCAGGTGAACTCTGTGCTTACTACCGCCTTTGCCGATA C2 ATGAACTTCCAACCGTGTGAACTCTGTGCTTATTACCGCCTTTGCCGATA C3 ATGAACTTCCAACCGTGTGAACTCTGTGCTTATTACCGCCTTTGCCGATA C4 ATGGACTTCAAACCGAGTGAACTCTGCGCTTACTACCGCCTTTGTCGATA C5 ATGGACTTCCAACCGGGTGAACTCTGTGCTTACTACCGGCTTTGCCGATA ***.*****.****. ********** ***** ***** ***** ***** C1 TCTAGGGATATTCTGTATTGATTATAATCCCACTAAAAAGAAATTCCGAC C2 TCTAGGGATATTCTGCATTGATTATAGTCCCACTAAAAATAAGTTCCGGC C3 TCTAGGGATATTCTGCATTGATTATAGTCCCACTAAAAAGAAGTTCCGGC C4 TCTGGGGATATTCTGCATTGACTATAATCCCGCTAAAAAAAGAATCCGGT C5 TCTGGGGATATTCTGCATTGATTATAATTCCACTAAAAAAAAGTTCCGGT ***.*********** ***** ****.* **.******* *..:****. C1 TGCGGCGCAGTGTTCTCTGTTACATAGTTCATTTTGCCTTGCAAGCCTAC C2 TGCGGCGCAGCGTTCTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC C3 TGCGGCGCAGCGTTTTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC C4 TGCGTCGCAGCGTTCTCTGTTACGTAATTCACTTTGCCTTGCAAGCCTAC C5 TGCGTCGCAGCGTACTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC **** ***** **: ********.**.**** ****************** C1 TTAGTTGGTTGCATCTCCGTCATGGTCACATATTGGCGTAGGTGCTTCAA C2 TTAGTTGGTGGTATGTCCGTCATGGTCATATATTGGCGTAGGTGCTTCAA C3 TTAGTTGGTGGTATGTCCGTCATGGTCATATATTGGCGTAGGTGCTTCAA C4 TTGGTTGGTTGCATGTCCGTCATGGTCACATATTGGCGTAGGTGCTTCAA C5 TTAGTTGGTTGCATGTTCGTCATGTTTACATATTGGCGCAGGTGCTTCAA **.****** * ** * ******* * * ********* *********** C1 AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA C2 AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA C3 AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA C4 AAAAGAGCTTACCACGACTGGAAACCACTTCGACCGACTTGTTATGGTAA C5 AAGCGAGCTTACCACGACTGGAAACCACTTCGATCGGCTTGTTATGGTGA **..***************************** ** *****:*****.* C1 TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTCATCTGGCTGCAA C2 TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA C3 TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA C4 TGGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTCATCTGGCTGCAA C5 TGGCCCTTGGTATACTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA * ***********:*********************** ************ C1 GCCCCACACCTACGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA C2 GCCCCACACCTGCGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA C3 GCCCCACACCTGCGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA C4 GCCCCACATCTGCGAATTGTTAGGCAAATAGAGTGTTACCGACGGAGGCA C5 GCCCCACATCTGCGAATTGTCAGGCAAATAGAGTTTTACCGACGGAGGCA ******** **.******** ************* *** ***.***. ** C1 CTTGGCTAATGTTCGACTGCTCCTCCCCAAACGTCTGCTTTGGCTAATTA C2 ATTGGCAAATTTTCGGCTGCTCCTCCCCAAACGTCTGCTTTGGGTAATTA C3 ATTGGCAAATTTTCGGCTGCTCCTCCCCAAACGTCTGCTTTGGGTAATTA C4 CTTGGCTAATGTTCGTCTGCTCCTCCCCAAACGTCTGCTTTGGCTAATTA C5 CTTGGCTAATGTTCGCCTACTTCTCCCCAAACGTCTGTTTTGGTTAATTA .*****:*** **** **.** *************** ***** ****** C1 TTGCAACCAATGTTGTCTACATGGCTAACTTCATTAAGACGTGCATATTC C2 TTGCAACCAATGTTCTCTACATGGCTAACTTTATTAAGACGTGTATATTC C3 TTGCAACCAATGTTCTCTACATGGCTAACTTCATTAAGACGTGTATATTC C4 TTGCAACCAATGTTCTCTACATGGTGAACTTTATCAAGACGTGTGTACTC C5 TTGCAACCAATCTTCTCTACATGGCTAACTTCATCAAGACGTGTGTATTC *********** ** ********* ***** ** ******** .** ** C1 GAATGGCTGACGGATGCTTCTCGACTTTTTGTCATTACCTCCTTGGGATT C2 GAATGGCTGACGGATGCTTCTCGACTCTTTGTCATTACCTCTTTGGGATT C3 GAATGGCTGACGGATGCTTCTCGACTCTTTGTCATAACCTCCTTGGGATT C4 GAATGGTTGACGGATGCTTCTCGACTTTTTGTCATTACCTCCTTGGGATT C5 GAATGGCTGACGGATGCTCCTCGATTTTTTGTCATTACCTCCTTGGGATT ****** *********** ***** * ********:***** ******** C1 TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA C2 TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA C3 TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA C4 TCCTTTACGATATCTGGTAACTAGTTTTACAATGGGCACATACTTTTGCA C5 TCCTTTACGATATCTGGTTACTAGTTTTACAATGGGCACATACTTTTGCA ******************:***** ***************** ******* C1 TGGTGCATATTGTACGCCTGGTGCTCGACTGGAATCAGTCGCAGATTAAC C2 TGGTGCATATTGTACGCCTGGTGCTTGGCTGGAATCAGTCGCAGATTAAC C3 TGGTGCACATTGTACGCCTGGTGCTTGACTGGAATCAGTCGCAGATTAAC C4 TAGTACATATTGTACGTCTCGTGCTCATCTGGAATCAGTCGCAGATTAAC C5 TGGTGCATATTATACGCCTGGTGCTCAGATGGAATCAGTTGGAGATTAAC *.**.** ***.**** ** ***** . .********** * ******** C1 GCGATAATAGATGAATCGGCAGACCTCAAAATGACTAGCCCCAATCGTCT C2 GCGATAATAGATAAATCGGCAGACCTCAAAATGACTAGCCCTAATCGTCT C3 GCGATAATAGATAAATCGGCAGACCTCAAAATGACTAGCCCTAATCGTCT C4 GCGGTTATAGATGAATCGGCAGACCTCAAAAAAACTGGCGCAAACCGTAT C5 GCAGTTATAGAGGAATTGGCCGACCTCAAAAAGACTGGCCCCAACCGTCT **..*:***** .*** ***.**********:.***.** * ** ***.* C1 GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATGCTGCTCTGCA C2 GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATGCTGCTCTGCA C3 GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATACTGCTCTGCA C4 GCGTTTACGCGCGTGCTTGGAGGTGCACGATCGCCTGATAATGCTTTGCA C5 GCGTTTACGCGCGTGCTTGGAGATGCATGATCGCCTGATGCTGCTCTGCA ********* * .*** *****.**** ***********..**** **** C1 ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG C2 ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG C3 ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG C4 ATGATGAGATCAGTCTTGTCTACGGGTTCATCGCTTGGCTGTCGTGGATG C5 ATGATGAGATCAGTCTTGTCTACGGGTTCATCGCTTGGCTGTCGTGGATG **************************** **.** ******** ****** C1 TTTGCCTCGCTTGATGTAACTGGCGTAATTTATCTGACTATGGTTATTCA C2 TTTGCCTCGCTTGATGTAACTGGAGTAATTTATTTGACTATGGTTATTCA C3 TTTGCCTCGCTTGATGTAACTGGAGTAATTTATTTGACTATGGTTATTCA C4 TTTGCCTCGCTTGATGTAACTGGAGTTATTTATCTGACTATGGTTATTCA C5 TTTGCCTCGCTTGATGTAACTGGAGTAATTTATCTGACTATGGTTATTCA ***********************.**:****** **************** C1 AACTAAAAAATCAATCGTTCTAAAATTGATAACAAACGTAGTGTGGCTTT C2 GACTAACAAATCAATCATTGTAAAATTGATAACAAACGTAGTGTGGCTTT C3 GACTAACAAATCAATCATTCTAAAATTGATAACAAACGTAGTGTGGCTTT C4 GACTAACAAATCAATCGTTATAAAATTGATAACCAACGTTGTATGGCTTT C5 GACTAACAAATCAATCGTTTTAAAATTGATAACAAACGTTGTGTGGCTTT .*****.*********.** *************.*****:**.******* C1 CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACT C2 CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACA C3 CGCCAACTTTTATGACGTTCGCCGCTAGCTTCATGAGTAACCGTGTTACA C4 CGCCAACTTTTATGACCTGCGCCGCTAGCTTCATGAGTAATCGTCTTATT C5 CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACC **************** * ********************* *** *** C1 ATTCAGGCAAATAAAACAGCAAAGATGCTGACAAAAGTACCCCGAACCGG C2 ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTCGAACCGG C3 ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTCGAACCGG C4 ATTCAAGCAAATAAAACAGCAAAGATTTTGGCAAAAGTACCTAGAACCGG C5 ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTAGAACCGG *****.******************** **.********** .******* C1 GACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC C2 AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC C3 AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC C4 AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTTAAGAACATTCGAC C5 AACTGGTTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC .***** ***************************** ******.****** C1 AGAAGCCCATTTTAACCGCTTATGGATTTTTCGCTCTGGATAAAAGTACT C2 AGCAGCCCATTTTAACCGCTTATGGATTTTTCGCGTTGGATAAAAGCACT C3 AGCAGCCCATTTTAACCGCTTATGGATTTTTCGCGTTGGATAAAAGCACT C4 AGCAGCCCATTTTAACCGCTTATGGATTTTTCACTCTGGATAAAAGTACA C5 GGCAGCCCATTCTAACCGCTTATGGATTTTTCGCTCTGGATAAAAGCACT .*.******** ********************.* ********** **: C1 TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTCTGGTCCA C2 TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTTTGGTCCA C3 TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTTTGGTCCA C4 TTGTTTAAGCTATTTACGGCCATTTTTACGTATATGGTTATTTTGGTCCA C5 TTGTTTAAGCTATTTACGGCAATCTTCACGTATATGGTTATTTTGGTCCA ***************** **.** ** *************** ******* C1 ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT C2 ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT C3 ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT C4 ATTTAAAGAGATGGAGAATTCTACAAAGTCTATTAATAAATTT C5 ATTTAAGGAGATGGAGAATTCTACAAAGTCTATTAATAAATTT *** **.********.***** ********************* >C1 ATGGACTTCCAACCAGGTGAACTCTGTGCTTACTACCGCCTTTGCCGATA TCTAGGGATATTCTGTATTGATTATAATCCCACTAAAAAGAAATTCCGAC TGCGGCGCAGTGTTCTCTGTTACATAGTTCATTTTGCCTTGCAAGCCTAC TTAGTTGGTTGCATCTCCGTCATGGTCACATATTGGCGTAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTCATCTGGCTGCAA GCCCCACACCTACGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA CTTGGCTAATGTTCGACTGCTCCTCCCCAAACGTCTGCTTTGGCTAATTA TTGCAACCAATGTTGTCTACATGGCTAACTTCATTAAGACGTGCATATTC GAATGGCTGACGGATGCTTCTCGACTTTTTGTCATTACCTCCTTGGGATT TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA TGGTGCATATTGTACGCCTGGTGCTCGACTGGAATCAGTCGCAGATTAAC GCGATAATAGATGAATCGGCAGACCTCAAAATGACTAGCCCCAATCGTCT GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATGCTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG TTTGCCTCGCTTGATGTAACTGGCGTAATTTATCTGACTATGGTTATTCA AACTAAAAAATCAATCGTTCTAAAATTGATAACAAACGTAGTGTGGCTTT CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACT ATTCAGGCAAATAAAACAGCAAAGATGCTGACAAAAGTACCCCGAACCGG GACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC AGAAGCCCATTTTAACCGCTTATGGATTTTTCGCTCTGGATAAAAGTACT TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTCTGGTCCA ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT >C2 ATGAACTTCCAACCGTGTGAACTCTGTGCTTATTACCGCCTTTGCCGATA TCTAGGGATATTCTGCATTGATTATAGTCCCACTAAAAATAAGTTCCGGC TGCGGCGCAGCGTTCTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC TTAGTTGGTGGTATGTCCGTCATGGTCATATATTGGCGTAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA GCCCCACACCTGCGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA ATTGGCAAATTTTCGGCTGCTCCTCCCCAAACGTCTGCTTTGGGTAATTA TTGCAACCAATGTTCTCTACATGGCTAACTTTATTAAGACGTGTATATTC GAATGGCTGACGGATGCTTCTCGACTCTTTGTCATTACCTCTTTGGGATT TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA TGGTGCATATTGTACGCCTGGTGCTTGGCTGGAATCAGTCGCAGATTAAC GCGATAATAGATAAATCGGCAGACCTCAAAATGACTAGCCCTAATCGTCT GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATGCTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG TTTGCCTCGCTTGATGTAACTGGAGTAATTTATTTGACTATGGTTATTCA GACTAACAAATCAATCATTGTAAAATTGATAACAAACGTAGTGTGGCTTT CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACA ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTCGAACCGG AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC AGCAGCCCATTTTAACCGCTTATGGATTTTTCGCGTTGGATAAAAGCACT TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTTTGGTCCA ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT >C3 ATGAACTTCCAACCGTGTGAACTCTGTGCTTATTACCGCCTTTGCCGATA TCTAGGGATATTCTGCATTGATTATAGTCCCACTAAAAAGAAGTTCCGGC TGCGGCGCAGCGTTTTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC TTAGTTGGTGGTATGTCCGTCATGGTCATATATTGGCGTAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA GCCCCACACCTGCGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA ATTGGCAAATTTTCGGCTGCTCCTCCCCAAACGTCTGCTTTGGGTAATTA TTGCAACCAATGTTCTCTACATGGCTAACTTCATTAAGACGTGTATATTC GAATGGCTGACGGATGCTTCTCGACTCTTTGTCATAACCTCCTTGGGATT TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA TGGTGCACATTGTACGCCTGGTGCTTGACTGGAATCAGTCGCAGATTAAC GCGATAATAGATAAATCGGCAGACCTCAAAATGACTAGCCCTAATCGTCT GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATACTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG TTTGCCTCGCTTGATGTAACTGGAGTAATTTATTTGACTATGGTTATTCA GACTAACAAATCAATCATTCTAAAATTGATAACAAACGTAGTGTGGCTTT CGCCAACTTTTATGACGTTCGCCGCTAGCTTCATGAGTAACCGTGTTACA ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTCGAACCGG AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC AGCAGCCCATTTTAACCGCTTATGGATTTTTCGCGTTGGATAAAAGCACT TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTTTGGTCCA ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT >C4 ATGGACTTCAAACCGAGTGAACTCTGCGCTTACTACCGCCTTTGTCGATA TCTGGGGATATTCTGCATTGACTATAATCCCGCTAAAAAAAGAATCCGGT TGCGTCGCAGCGTTCTCTGTTACGTAATTCACTTTGCCTTGCAAGCCTAC TTGGTTGGTTGCATGTCCGTCATGGTCACATATTGGCGTAGGTGCTTCAA AAAAGAGCTTACCACGACTGGAAACCACTTCGACCGACTTGTTATGGTAA TGGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTCATCTGGCTGCAA GCCCCACATCTGCGAATTGTTAGGCAAATAGAGTGTTACCGACGGAGGCA CTTGGCTAATGTTCGTCTGCTCCTCCCCAAACGTCTGCTTTGGCTAATTA TTGCAACCAATGTTCTCTACATGGTGAACTTTATCAAGACGTGTGTACTC GAATGGTTGACGGATGCTTCTCGACTTTTTGTCATTACCTCCTTGGGATT TCCTTTACGATATCTGGTAACTAGTTTTACAATGGGCACATACTTTTGCA TAGTACATATTGTACGTCTCGTGCTCATCTGGAATCAGTCGCAGATTAAC GCGGTTATAGATGAATCGGCAGACCTCAAAAAAACTGGCGCAAACCGTAT GCGTTTACGCGCGTGCTTGGAGGTGCACGATCGCCTGATAATGCTTTGCA ATGATGAGATCAGTCTTGTCTACGGGTTCATCGCTTGGCTGTCGTGGATG TTTGCCTCGCTTGATGTAACTGGAGTTATTTATCTGACTATGGTTATTCA GACTAACAAATCAATCGTTATAAAATTGATAACCAACGTTGTATGGCTTT CGCCAACTTTTATGACCTGCGCCGCTAGCTTCATGAGTAATCGTCTTATT ATTCAAGCAAATAAAACAGCAAAGATTTTGGCAAAAGTACCTAGAACCGG AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTTAAGAACATTCGAC AGCAGCCCATTTTAACCGCTTATGGATTTTTCACTCTGGATAAAAGTACA TTGTTTAAGCTATTTACGGCCATTTTTACGTATATGGTTATTTTGGTCCA ATTTAAAGAGATGGAGAATTCTACAAAGTCTATTAATAAATTT >C5 ATGGACTTCCAACCGGGTGAACTCTGTGCTTACTACCGGCTTTGCCGATA TCTGGGGATATTCTGCATTGATTATAATTCCACTAAAAAAAAGTTCCGGT TGCGTCGCAGCGTACTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC TTAGTTGGTTGCATGTTCGTCATGTTTACATATTGGCGCAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGATCGGCTTGTTATGGTGA TGGCCCTTGGTATACTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA GCCCCACATCTGCGAATTGTCAGGCAAATAGAGTTTTACCGACGGAGGCA CTTGGCTAATGTTCGCCTACTTCTCCCCAAACGTCTGTTTTGGTTAATTA TTGCAACCAATCTTCTCTACATGGCTAACTTCATCAAGACGTGTGTATTC GAATGGCTGACGGATGCTCCTCGATTTTTTGTCATTACCTCCTTGGGATT TCCTTTACGATATCTGGTTACTAGTTTTACAATGGGCACATACTTTTGCA TGGTGCATATTATACGCCTGGTGCTCAGATGGAATCAGTTGGAGATTAAC GCAGTTATAGAGGAATTGGCCGACCTCAAAAAGACTGGCCCCAACCGTCT GCGTTTACGCGCGTGCTTGGAGATGCATGATCGCCTGATGCTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTCATCGCTTGGCTGTCGTGGATG TTTGCCTCGCTTGATGTAACTGGAGTAATTTATCTGACTATGGTTATTCA GACTAACAAATCAATCGTTTTAAAATTGATAACAAACGTTGTGTGGCTTT CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACC ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTAGAACCGG AACTGGTTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC GGCAGCCCATTCTAACCGCTTATGGATTTTTCGCTCTGGATAAAAGCACT TTGTTTAAGCTATTTACGGCAATCTTCACGTATATGGTTATTTTGGTCCA ATTTAAGGAGATGGAGAATTCTACAAAGTCTATTAATAAATTT >C1 MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY LVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C2 MNFQPCELCAYYRLCRYLGIFCIDYSPTKNKFRLRRSVLCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLGWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIIVKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C3 MNFQPCELCAYYRLCRYLGIFCIDYSPTKKKFRLRRSVFCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLILLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIILKLITNVVWLSPTFMTFAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C4 MDFKPSELCAYYRLCRYLGIFCIDYNPAKKRIRLRRSVLCYVIHFALQAY LVGCMSVMVTYWRRCFKKELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIECYRRRHLANVRLLLPKRLLWLIIATNVLYMVNFIKTCVL EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCIVHIVRLVLIWNQSQIN AVIDESADLKKTGANRMRLRACLEVHDRLIMLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVIKLITNVVWLSPTFMTCAASFMSNRLI IQANKTAKILAKVPRTGTGLDRMIEKFLLKNIRQQPILTAYGFFTLDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >C5 MDFQPGELCAYYRLCRYLGIFCIDYNSTKKKFRLRRSVLCYVVHFALQAY LVGCMFVMFTYWRRCFKSELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIEFYRRRHLANVRLLLPKRLFWLIIATNLLYMANFIKTCVF EWLTDAPRFFVITSLGFPLRYLVTSFTMGTYFCMVHIIRLVLRWNQLEIN AVIEELADLKKTGPNRLRLRACLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRRQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 5 taxa and 1143 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479411147 Setting output file names to "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1262923551 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4037796492 Seed = 892191345 Swapseed = 1479411147 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 35 unique site patterns Division 2 has 17 unique site patterns Division 3 has 57 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3092.164093 -- -25.624409 Chain 2 -- -2994.166597 -- -25.624409 Chain 3 -- -3097.295049 -- -25.624409 Chain 4 -- -3115.309747 -- -25.624409 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2994.166597 -- -25.624409 Chain 2 -- -3097.801586 -- -25.624409 Chain 3 -- -2941.523993 -- -25.624409 Chain 4 -- -2990.379607 -- -25.624409 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3092.164] (-2994.167) (-3097.295) (-3115.310) * [-2994.167] (-3097.802) (-2941.524) (-2990.380) 500 -- [-2558.869] (-2561.878) (-2552.657) (-2557.925) * (-2570.784) (-2557.406) (-2561.541) [-2553.902] -- 0:00:00 1000 -- (-2555.935) (-2562.139) [-2535.069] (-2547.484) * (-2555.392) [-2545.883] (-2554.182) (-2533.654) -- 0:00:00 1500 -- (-2551.590) (-2533.496) (-2535.364) [-2536.406] * [-2536.909] (-2537.362) (-2545.279) (-2535.543) -- 0:00:00 2000 -- (-2545.279) [-2525.988] (-2523.943) (-2528.993) * (-2526.025) (-2526.091) (-2539.995) [-2534.737] -- 0:00:00 2500 -- (-2536.794) (-2526.326) [-2527.624] (-2531.312) * (-2530.199) (-2524.474) [-2532.090] (-2529.687) -- 0:00:00 3000 -- (-2527.790) [-2527.956] (-2521.876) (-2526.793) * [-2523.560] (-2522.120) (-2522.941) (-2528.128) -- 0:00:00 3500 -- (-2525.667) (-2521.341) [-2524.118] (-2525.178) * [-2524.233] (-2524.772) (-2519.671) (-2529.574) -- 0:00:00 4000 -- (-2525.656) (-2519.015) [-2517.263] (-2520.672) * (-2518.665) (-2528.863) (-2524.694) [-2523.817] -- 0:00:00 4500 -- (-2518.579) [-2517.556] (-2518.542) (-2520.966) * [-2517.015] (-2523.531) (-2519.269) (-2521.857) -- 0:03:41 5000 -- (-2520.482) (-2523.236) (-2517.092) [-2519.955] * [-2520.112] (-2528.455) (-2521.191) (-2524.840) -- 0:03:19 Average standard deviation of split frequencies: 0.000000 5500 -- (-2519.738) [-2518.777] (-2521.106) (-2524.927) * (-2520.217) (-2528.914) [-2519.721] (-2523.839) -- 0:03:00 6000 -- (-2519.279) (-2519.264) (-2516.820) [-2519.471] * [-2514.629] (-2521.458) (-2517.824) (-2519.722) -- 0:02:45 6500 -- (-2519.282) (-2521.672) (-2527.654) [-2515.870] * (-2518.598) [-2526.043] (-2518.039) (-2520.511) -- 0:02:32 7000 -- (-2519.517) (-2525.603) [-2521.388] (-2521.243) * (-2524.312) [-2527.518] (-2517.600) (-2525.050) -- 0:02:21 7500 -- (-2522.390) (-2525.662) (-2522.119) [-2520.053] * (-2528.825) (-2516.236) (-2523.790) [-2523.593] -- 0:02:12 8000 -- (-2523.188) (-2524.362) [-2516.095] (-2521.028) * (-2519.850) (-2519.646) [-2517.398] (-2528.902) -- 0:02:04 8500 -- (-2520.634) (-2527.099) (-2523.260) [-2525.833] * (-2521.489) [-2519.322] (-2521.599) (-2522.877) -- 0:01:56 9000 -- (-2519.588) (-2522.894) (-2523.386) [-2522.469] * (-2518.169) (-2519.308) [-2517.917] (-2527.793) -- 0:01:50 9500 -- (-2521.168) [-2522.520] (-2519.080) (-2521.313) * (-2522.396) (-2518.607) (-2520.362) [-2523.386] -- 0:03:28 10000 -- (-2524.901) (-2524.839) (-2521.556) [-2517.010] * [-2521.156] (-2519.912) (-2525.603) (-2522.185) -- 0:03:18 Average standard deviation of split frequencies: 0.000000 10500 -- (-2518.281) (-2526.697) [-2518.008] (-2519.557) * (-2530.568) (-2523.455) (-2519.300) [-2518.064] -- 0:03:08 11000 -- [-2521.793] (-2521.615) (-2518.481) (-2521.076) * [-2524.270] (-2522.436) (-2521.053) (-2520.447) -- 0:02:59 11500 -- [-2517.178] (-2528.742) (-2521.302) (-2523.373) * [-2526.220] (-2524.043) (-2518.974) (-2523.914) -- 0:02:51 12000 -- (-2521.917) (-2521.258) [-2526.394] (-2522.824) * (-2526.931) [-2522.609] (-2524.979) (-2517.581) -- 0:02:44 12500 -- (-2523.448) (-2526.282) (-2523.232) [-2519.392] * (-2522.839) [-2520.943] (-2530.782) (-2517.595) -- 0:02:38 13000 -- (-2524.437) (-2522.585) (-2519.766) [-2522.325] * [-2522.176] (-2523.069) (-2518.639) (-2527.958) -- 0:02:31 13500 -- (-2519.426) (-2529.447) [-2516.586] (-2524.010) * [-2526.381] (-2524.235) (-2523.235) (-2522.715) -- 0:02:26 14000 -- (-2525.033) (-2525.108) [-2517.585] (-2528.824) * (-2519.716) [-2521.372] (-2517.624) (-2530.315) -- 0:03:31 14500 -- [-2523.917] (-2523.701) (-2518.568) (-2522.864) * (-2521.240) (-2524.347) [-2517.586] (-2523.718) -- 0:03:23 15000 -- (-2519.243) [-2521.152] (-2519.360) (-2518.813) * [-2524.147] (-2520.533) (-2515.242) (-2523.990) -- 0:03:17 Average standard deviation of split frequencies: 0.000000 15500 -- (-2520.084) (-2518.944) [-2515.943] (-2515.255) * (-2528.852) [-2518.265] (-2517.496) (-2530.750) -- 0:03:10 16000 -- (-2522.723) (-2519.158) [-2517.402] (-2520.628) * (-2522.186) [-2523.252] (-2523.146) (-2528.527) -- 0:03:04 16500 -- (-2525.157) (-2519.607) [-2519.533] (-2524.336) * (-2519.707) (-2524.472) [-2521.481] (-2529.519) -- 0:02:58 17000 -- [-2519.856] (-2531.296) (-2521.565) (-2515.530) * [-2517.567] (-2518.791) (-2520.852) (-2521.252) -- 0:02:53 17500 -- [-2517.967] (-2525.375) (-2520.516) (-2520.101) * (-2518.717) (-2523.756) (-2520.340) [-2523.808] -- 0:02:48 18000 -- [-2519.205] (-2521.409) (-2518.037) (-2526.837) * (-2523.823) (-2525.954) [-2520.056] (-2520.053) -- 0:02:43 18500 -- [-2521.337] (-2521.065) (-2522.651) (-2522.759) * (-2529.101) (-2526.162) [-2519.270] (-2529.325) -- 0:03:32 19000 -- (-2520.931) (-2522.465) [-2524.176] (-2523.971) * (-2524.811) [-2522.800] (-2516.934) (-2528.033) -- 0:03:26 19500 -- (-2516.774) [-2517.510] (-2519.898) (-2524.149) * (-2523.745) (-2522.494) (-2519.277) [-2521.601] -- 0:03:21 20000 -- (-2520.637) (-2519.600) (-2519.833) [-2524.176] * [-2517.444] (-2525.613) (-2521.819) (-2524.987) -- 0:03:16 Average standard deviation of split frequencies: 0.000000 20500 -- (-2527.267) (-2522.759) [-2520.394] (-2521.974) * (-2518.267) (-2517.407) (-2528.215) [-2518.683] -- 0:03:11 21000 -- (-2528.220) (-2521.836) (-2519.323) [-2516.738] * (-2521.466) [-2516.343] (-2521.219) (-2522.325) -- 0:03:06 21500 -- (-2524.490) [-2524.895] (-2516.821) (-2522.285) * (-2520.748) (-2519.910) [-2520.545] (-2529.244) -- 0:03:02 22000 -- (-2525.976) (-2529.111) [-2519.101] (-2520.968) * [-2518.416] (-2519.841) (-2519.574) (-2521.961) -- 0:02:57 22500 -- (-2521.526) [-2528.682] (-2518.285) (-2520.730) * (-2520.273) (-2519.042) (-2525.234) [-2525.712] -- 0:02:53 23000 -- [-2521.485] (-2519.962) (-2522.387) (-2525.090) * (-2516.163) (-2525.170) [-2518.387] (-2523.579) -- 0:03:32 23500 -- (-2518.885) [-2518.812] (-2518.630) (-2524.347) * [-2516.214] (-2526.512) (-2518.395) (-2526.751) -- 0:03:27 24000 -- (-2522.951) (-2520.736) [-2523.319] (-2522.879) * (-2523.337) (-2519.151) [-2520.606] (-2521.570) -- 0:03:23 24500 -- (-2515.925) (-2518.688) [-2520.227] (-2530.744) * [-2521.617] (-2520.313) (-2525.082) (-2519.318) -- 0:03:19 25000 -- [-2519.146] (-2524.950) (-2522.239) (-2522.568) * (-2519.465) [-2519.819] (-2521.061) (-2518.962) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 25500 -- (-2519.728) [-2522.531] (-2522.718) (-2520.188) * [-2520.422] (-2522.009) (-2522.310) (-2518.666) -- 0:03:11 26000 -- (-2525.866) (-2516.960) (-2522.281) [-2521.392] * (-2520.877) [-2520.379] (-2526.558) (-2520.933) -- 0:03:07 26500 -- (-2519.594) (-2531.763) (-2524.677) [-2518.775] * [-2519.105] (-2521.871) (-2518.505) (-2526.590) -- 0:03:03 27000 -- (-2519.605) (-2524.049) (-2526.612) [-2518.530] * (-2519.801) (-2523.768) (-2518.744) [-2519.102] -- 0:03:00 27500 -- [-2517.847] (-2524.403) (-2523.999) (-2523.768) * [-2522.216] (-2517.234) (-2530.673) (-2515.876) -- 0:02:56 28000 -- (-2522.147) [-2520.921] (-2519.153) (-2525.553) * (-2522.617) (-2518.724) (-2523.600) [-2517.560] -- 0:03:28 28500 -- (-2524.000) (-2517.772) (-2531.833) [-2522.175] * (-2526.077) (-2520.908) (-2521.871) [-2520.014] -- 0:03:24 29000 -- (-2527.129) [-2519.591] (-2522.792) (-2524.047) * [-2523.508] (-2519.146) (-2523.296) (-2521.791) -- 0:03:20 29500 -- (-2522.840) [-2515.459] (-2520.622) (-2526.056) * (-2525.396) [-2521.706] (-2524.321) (-2524.043) -- 0:03:17 30000 -- (-2518.046) [-2520.346] (-2523.518) (-2519.775) * (-2525.523) (-2519.620) (-2522.744) [-2522.523] -- 0:03:14 Average standard deviation of split frequencies: 0.000000 30500 -- (-2521.437) [-2524.593] (-2518.102) (-2520.907) * (-2521.114) (-2518.498) [-2518.382] (-2525.932) -- 0:03:10 31000 -- [-2520.997] (-2528.669) (-2519.535) (-2523.291) * (-2519.577) (-2522.082) [-2523.197] (-2519.586) -- 0:03:07 31500 -- [-2523.922] (-2520.377) (-2517.024) (-2526.676) * (-2519.463) [-2520.568] (-2523.832) (-2516.525) -- 0:03:04 32000 -- (-2535.478) (-2518.739) [-2524.063] (-2519.781) * (-2520.795) (-2517.602) (-2522.489) [-2517.084] -- 0:03:01 32500 -- (-2518.707) (-2520.945) [-2521.259] (-2525.453) * (-2515.999) (-2519.100) [-2521.900] (-2522.764) -- 0:03:28 33000 -- (-2526.551) (-2521.086) [-2521.855] (-2517.558) * (-2521.557) (-2520.255) [-2518.246] (-2526.054) -- 0:03:25 33500 -- (-2522.859) (-2523.733) [-2519.771] (-2519.499) * (-2528.092) [-2522.491] (-2518.764) (-2527.717) -- 0:03:21 34000 -- (-2516.518) [-2522.124] (-2517.384) (-2523.818) * (-2519.401) (-2524.680) [-2517.058] (-2520.881) -- 0:03:18 34500 -- (-2518.047) (-2520.136) [-2517.651] (-2522.661) * (-2520.988) (-2531.748) [-2517.222] (-2519.403) -- 0:03:15 35000 -- (-2519.414) [-2517.015] (-2520.206) (-2521.707) * (-2517.923) [-2522.791] (-2524.112) (-2524.899) -- 0:03:13 Average standard deviation of split frequencies: 0.000000 35500 -- (-2521.680) [-2524.544] (-2521.467) (-2516.566) * (-2524.445) (-2521.769) (-2524.709) [-2517.434] -- 0:03:10 36000 -- (-2530.488) (-2520.980) [-2518.644] (-2523.079) * (-2524.137) (-2532.691) (-2520.016) [-2517.746] -- 0:03:07 36500 -- (-2523.852) (-2521.451) [-2520.230] (-2520.682) * [-2515.282] (-2521.490) (-2520.895) (-2522.858) -- 0:03:04 37000 -- (-2519.913) (-2522.063) [-2516.075] (-2521.018) * (-2520.322) (-2519.560) (-2519.377) [-2521.076] -- 0:03:28 37500 -- [-2519.312] (-2525.265) (-2521.107) (-2520.652) * (-2516.493) (-2524.184) (-2526.501) [-2515.703] -- 0:03:25 38000 -- [-2519.959] (-2521.719) (-2521.756) (-2524.147) * (-2524.911) (-2526.271) (-2522.667) [-2518.814] -- 0:03:22 38500 -- (-2521.318) (-2518.513) [-2522.117] (-2531.583) * [-2520.361] (-2520.089) (-2522.406) (-2517.176) -- 0:03:19 39000 -- (-2523.297) (-2520.174) [-2521.624] (-2522.374) * (-2521.393) (-2524.688) (-2533.244) [-2518.389] -- 0:03:17 39500 -- [-2525.002] (-2520.499) (-2521.276) (-2523.558) * (-2520.163) (-2521.963) (-2528.185) [-2520.547] -- 0:03:14 40000 -- (-2520.799) [-2522.633] (-2520.586) (-2518.996) * (-2522.194) [-2520.606] (-2521.472) (-2516.551) -- 0:03:12 Average standard deviation of split frequencies: 0.000000 40500 -- (-2523.024) [-2527.065] (-2527.695) (-2522.334) * (-2524.464) [-2521.765] (-2519.363) (-2519.133) -- 0:03:09 41000 -- (-2521.085) (-2530.002) (-2527.770) [-2522.460] * [-2521.925] (-2515.490) (-2523.310) (-2524.341) -- 0:03:07 41500 -- [-2521.065] (-2526.828) (-2518.669) (-2522.841) * (-2518.774) [-2521.461] (-2522.080) (-2521.869) -- 0:03:04 42000 -- (-2520.640) [-2520.940] (-2528.195) (-2521.054) * [-2518.315] (-2525.050) (-2515.955) (-2524.305) -- 0:03:25 42500 -- (-2522.128) [-2518.924] (-2523.901) (-2530.063) * (-2521.100) (-2517.817) (-2521.380) [-2520.248] -- 0:03:22 43000 -- [-2521.778] (-2521.586) (-2523.232) (-2523.491) * (-2521.299) [-2517.972] (-2516.895) (-2516.913) -- 0:03:20 43500 -- (-2518.865) [-2523.140] (-2530.520) (-2518.922) * (-2519.595) (-2520.608) (-2525.708) [-2522.101] -- 0:03:17 44000 -- (-2521.785) (-2520.136) [-2523.444] (-2518.806) * (-2520.867) [-2521.907] (-2529.354) (-2520.128) -- 0:03:15 44500 -- (-2521.745) (-2524.998) (-2520.903) [-2521.932] * (-2524.125) [-2523.552] (-2524.336) (-2521.672) -- 0:03:13 45000 -- [-2525.111] (-2522.425) (-2523.754) (-2519.424) * [-2518.872] (-2521.098) (-2526.030) (-2523.932) -- 0:03:11 Average standard deviation of split frequencies: 0.000000 45500 -- (-2524.341) [-2519.558] (-2521.719) (-2521.819) * (-2516.942) (-2521.014) (-2524.268) [-2520.149] -- 0:03:08 46000 -- [-2521.295] (-2524.101) (-2517.669) (-2518.403) * (-2523.146) (-2520.520) [-2521.816] (-2518.210) -- 0:03:06 46500 -- (-2527.784) (-2523.456) (-2524.010) [-2519.886] * [-2522.451] (-2523.019) (-2518.043) (-2532.372) -- 0:03:25 47000 -- [-2519.792] (-2521.355) (-2518.586) (-2518.194) * [-2519.743] (-2519.707) (-2521.316) (-2524.210) -- 0:03:22 47500 -- (-2520.497) (-2520.955) [-2518.242] (-2517.862) * (-2520.506) (-2517.852) [-2520.321] (-2522.749) -- 0:03:20 48000 -- (-2524.292) (-2524.458) [-2516.920] (-2522.682) * (-2517.264) [-2520.785] (-2521.482) (-2518.423) -- 0:03:18 48500 -- [-2518.764] (-2521.344) (-2517.972) (-2519.950) * (-2517.861) [-2525.671] (-2525.907) (-2521.086) -- 0:03:16 49000 -- (-2521.170) (-2521.889) [-2519.541] (-2517.521) * (-2519.068) (-2527.177) [-2520.000] (-2517.104) -- 0:03:14 49500 -- (-2519.247) (-2526.216) (-2522.013) [-2520.911] * (-2520.005) [-2522.384] (-2523.999) (-2518.344) -- 0:03:12 50000 -- (-2521.892) (-2525.453) (-2524.092) [-2520.548] * [-2519.219] (-2523.159) (-2521.467) (-2526.688) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 50500 -- [-2521.043] (-2519.761) (-2518.603) (-2523.000) * (-2519.223) [-2521.930] (-2518.588) (-2524.117) -- 0:03:08 51000 -- (-2528.329) (-2522.087) (-2522.904) [-2521.094] * (-2524.564) [-2521.649] (-2528.815) (-2526.711) -- 0:03:24 51500 -- (-2518.250) (-2532.206) [-2520.427] (-2526.556) * [-2519.500] (-2520.464) (-2523.049) (-2526.407) -- 0:03:22 52000 -- (-2523.058) [-2523.231] (-2518.271) (-2517.140) * [-2517.576] (-2523.015) (-2520.768) (-2521.039) -- 0:03:20 52500 -- [-2518.953] (-2520.065) (-2525.296) (-2519.405) * (-2530.174) (-2520.888) (-2527.222) [-2517.450] -- 0:03:18 53000 -- (-2525.690) (-2521.850) (-2519.205) [-2524.287] * (-2522.634) [-2518.025] (-2525.795) (-2520.105) -- 0:03:16 53500 -- (-2522.561) (-2522.305) (-2522.124) [-2520.908] * [-2524.701] (-2520.424) (-2524.172) (-2522.119) -- 0:03:14 54000 -- [-2518.910] (-2524.291) (-2521.310) (-2522.177) * [-2520.588] (-2524.939) (-2519.884) (-2525.070) -- 0:03:12 54500 -- [-2519.348] (-2522.622) (-2524.298) (-2524.016) * (-2521.141) [-2521.477] (-2521.844) (-2517.125) -- 0:03:10 55000 -- (-2527.717) (-2518.584) (-2527.508) [-2518.092] * (-2525.449) (-2520.627) [-2521.875] (-2520.353) -- 0:03:09 Average standard deviation of split frequencies: 0.000000 55500 -- (-2527.289) (-2520.629) (-2524.551) [-2520.036] * (-2524.221) (-2520.367) (-2521.952) [-2522.853] -- 0:03:24 56000 -- (-2522.425) (-2528.155) (-2520.273) [-2519.244] * (-2524.481) [-2521.225] (-2527.715) (-2523.468) -- 0:03:22 56500 -- (-2526.034) (-2530.671) (-2523.218) [-2525.133] * (-2521.110) (-2523.599) (-2520.196) [-2519.446] -- 0:03:20 57000 -- [-2520.622] (-2523.199) (-2528.441) (-2525.610) * (-2524.647) [-2520.758] (-2522.050) (-2525.862) -- 0:03:18 57500 -- (-2520.633) (-2525.572) (-2523.425) [-2522.139] * (-2526.359) (-2519.375) [-2519.664] (-2517.821) -- 0:03:16 58000 -- (-2522.581) [-2518.778] (-2518.503) (-2517.717) * [-2521.034] (-2520.409) (-2520.203) (-2518.357) -- 0:03:14 58500 -- (-2518.706) (-2522.864) (-2521.786) [-2517.373] * (-2521.794) (-2520.932) (-2522.780) [-2520.626] -- 0:03:13 59000 -- (-2518.674) [-2523.267] (-2521.570) (-2516.507) * (-2523.393) (-2527.391) [-2520.498] (-2515.482) -- 0:03:11 59500 -- (-2519.643) (-2521.713) [-2518.955] (-2524.565) * [-2517.938] (-2522.622) (-2521.314) (-2520.115) -- 0:03:09 60000 -- [-2518.690] (-2519.548) (-2524.069) (-2523.814) * (-2517.435) (-2524.303) [-2521.588] (-2522.106) -- 0:03:23 Average standard deviation of split frequencies: 0.000000 60500 -- (-2519.767) [-2521.526] (-2523.568) (-2527.420) * (-2521.395) (-2519.520) [-2523.360] (-2529.361) -- 0:03:21 61000 -- [-2521.952] (-2516.889) (-2517.817) (-2529.863) * (-2525.501) (-2518.651) [-2519.613] (-2532.788) -- 0:03:20 61500 -- (-2526.150) (-2521.314) (-2516.783) [-2520.090] * (-2519.337) [-2528.347] (-2518.829) (-2521.754) -- 0:03:18 62000 -- [-2519.953] (-2522.159) (-2523.889) (-2523.218) * (-2520.028) [-2527.968] (-2521.986) (-2522.836) -- 0:03:16 62500 -- (-2523.135) (-2517.264) (-2526.121) [-2519.667] * (-2523.031) (-2521.900) (-2521.871) [-2523.635] -- 0:03:15 63000 -- (-2517.944) [-2521.885] (-2522.976) (-2522.909) * (-2529.296) [-2523.581] (-2524.706) (-2522.768) -- 0:03:13 63500 -- (-2529.291) (-2523.918) [-2522.435] (-2521.160) * (-2521.208) (-2523.477) (-2516.641) [-2521.940] -- 0:03:11 64000 -- (-2519.254) (-2520.709) (-2527.998) [-2526.157] * (-2523.976) [-2518.768] (-2523.578) (-2518.705) -- 0:03:10 64500 -- (-2516.869) (-2526.748) [-2519.213] (-2516.379) * (-2520.340) [-2516.759] (-2523.126) (-2520.508) -- 0:03:08 65000 -- (-2526.491) [-2519.844] (-2522.814) (-2519.315) * (-2531.011) (-2523.283) [-2520.446] (-2523.764) -- 0:03:21 Average standard deviation of split frequencies: 0.000000 65500 -- (-2524.974) [-2520.162] (-2524.997) (-2518.523) * (-2527.613) (-2521.212) [-2519.392] (-2518.716) -- 0:03:19 66000 -- (-2520.266) (-2524.629) (-2523.491) [-2519.553] * [-2528.055] (-2518.522) (-2523.326) (-2525.686) -- 0:03:18 66500 -- [-2521.388] (-2525.745) (-2527.371) (-2519.549) * (-2518.152) (-2524.027) (-2522.051) [-2521.714] -- 0:03:16 67000 -- [-2531.180] (-2527.723) (-2525.359) (-2521.579) * [-2518.220] (-2516.927) (-2526.065) (-2528.365) -- 0:03:14 67500 -- (-2529.156) (-2527.053) (-2525.721) [-2521.615] * [-2519.201] (-2518.229) (-2529.273) (-2530.389) -- 0:03:13 68000 -- (-2530.220) (-2528.151) [-2521.722] (-2519.880) * [-2520.548] (-2524.687) (-2529.381) (-2520.105) -- 0:03:11 68500 -- [-2527.013] (-2521.292) (-2522.883) (-2524.537) * (-2519.265) (-2520.966) (-2525.319) [-2523.673] -- 0:03:10 69000 -- [-2523.885] (-2522.476) (-2524.507) (-2522.629) * (-2518.401) (-2515.625) (-2521.184) [-2520.434] -- 0:03:08 69500 -- (-2524.123) (-2524.322) (-2520.431) [-2529.486] * (-2520.712) (-2521.698) (-2521.428) [-2519.035] -- 0:03:20 70000 -- [-2525.091] (-2527.339) (-2520.912) (-2519.249) * (-2519.884) (-2526.271) (-2527.523) [-2519.860] -- 0:03:19 Average standard deviation of split frequencies: 0.000000 70500 -- (-2521.983) [-2522.117] (-2518.194) (-2518.650) * (-2522.837) [-2515.329] (-2527.677) (-2516.396) -- 0:03:17 71000 -- (-2523.470) [-2526.945] (-2524.935) (-2520.396) * (-2521.226) [-2517.451] (-2523.817) (-2523.020) -- 0:03:16 71500 -- [-2520.585] (-2525.752) (-2518.298) (-2519.897) * (-2519.732) (-2522.100) (-2521.668) [-2521.024] -- 0:03:14 72000 -- (-2520.529) [-2521.002] (-2524.592) (-2523.197) * (-2531.409) (-2518.931) (-2519.672) [-2519.440] -- 0:03:13 72500 -- (-2519.688) (-2525.127) [-2527.067] (-2528.724) * (-2529.130) (-2519.610) (-2521.251) [-2516.519] -- 0:03:11 73000 -- (-2523.066) (-2522.440) [-2523.126] (-2529.311) * (-2517.338) [-2521.708] (-2526.276) (-2523.665) -- 0:03:10 73500 -- (-2521.928) [-2519.362] (-2526.096) (-2527.338) * (-2515.770) [-2520.138] (-2525.121) (-2523.924) -- 0:03:09 74000 -- (-2519.017) (-2522.751) (-2527.009) [-2518.803] * (-2518.018) [-2522.891] (-2522.522) (-2526.494) -- 0:03:07 74500 -- (-2525.755) (-2526.200) (-2523.872) [-2518.289] * (-2518.753) (-2524.165) (-2527.900) [-2522.172] -- 0:03:18 75000 -- (-2518.869) (-2518.349) [-2516.200] (-2523.024) * (-2524.368) [-2518.879] (-2524.786) (-2520.519) -- 0:03:17 Average standard deviation of split frequencies: 0.000000 75500 -- [-2519.837] (-2524.738) (-2523.418) (-2516.479) * (-2525.843) (-2523.092) [-2518.622] (-2519.888) -- 0:03:15 76000 -- (-2521.607) [-2518.553] (-2518.971) (-2521.722) * [-2522.320] (-2518.382) (-2522.336) (-2520.895) -- 0:03:14 76500 -- (-2521.981) [-2518.153] (-2518.777) (-2518.649) * [-2521.501] (-2517.581) (-2517.555) (-2521.528) -- 0:03:13 77000 -- (-2518.277) (-2536.064) (-2521.822) [-2520.390] * (-2520.936) (-2516.488) (-2521.822) [-2519.670] -- 0:03:11 77500 -- (-2519.175) [-2524.810] (-2525.022) (-2522.244) * (-2520.081) (-2522.623) (-2523.040) [-2517.444] -- 0:03:10 78000 -- (-2520.925) [-2521.843] (-2525.344) (-2522.777) * (-2519.302) (-2522.307) [-2521.166] (-2523.975) -- 0:03:09 78500 -- (-2521.152) (-2519.373) (-2523.134) [-2522.724] * [-2523.526] (-2522.636) (-2519.366) (-2522.385) -- 0:03:07 79000 -- [-2520.509] (-2521.712) (-2527.264) (-2523.980) * [-2518.852] (-2523.480) (-2518.717) (-2518.023) -- 0:03:18 79500 -- [-2521.772] (-2517.550) (-2521.956) (-2526.570) * (-2519.416) (-2519.834) [-2519.439] (-2519.964) -- 0:03:16 80000 -- (-2516.159) (-2519.674) (-2518.177) [-2527.593] * (-2522.808) [-2518.960] (-2522.264) (-2519.803) -- 0:03:15 Average standard deviation of split frequencies: 0.000000 80500 -- (-2521.457) [-2517.353] (-2521.070) (-2534.287) * (-2516.652) (-2518.074) [-2523.952] (-2523.688) -- 0:03:14 81000 -- [-2519.161] (-2524.710) (-2522.137) (-2525.586) * (-2521.627) [-2521.909] (-2523.015) (-2519.639) -- 0:03:12 81500 -- (-2522.487) (-2526.136) (-2521.086) [-2520.963] * (-2522.747) [-2516.720] (-2530.332) (-2521.510) -- 0:03:11 82000 -- (-2521.948) [-2517.382] (-2516.794) (-2518.915) * (-2523.188) [-2518.301] (-2526.761) (-2519.981) -- 0:03:10 82500 -- [-2519.887] (-2519.933) (-2529.917) (-2522.020) * (-2520.485) (-2526.949) [-2521.029] (-2517.293) -- 0:03:09 83000 -- (-2522.086) [-2521.934] (-2524.070) (-2516.370) * (-2526.599) (-2524.477) [-2518.169] (-2529.522) -- 0:03:07 83500 -- (-2524.486) (-2519.008) [-2518.864] (-2518.368) * (-2520.729) (-2521.101) [-2521.634] (-2523.761) -- 0:03:17 84000 -- (-2520.637) (-2518.883) (-2529.083) [-2517.374] * (-2519.861) (-2520.245) (-2522.667) [-2521.732] -- 0:03:16 84500 -- (-2523.945) (-2518.072) (-2523.657) [-2520.544] * (-2520.671) [-2519.867] (-2518.232) (-2525.338) -- 0:03:15 85000 -- (-2525.485) (-2519.313) [-2521.411] (-2517.106) * (-2518.259) (-2522.818) (-2519.684) [-2524.689] -- 0:03:13 Average standard deviation of split frequencies: 0.000000 85500 -- (-2520.560) [-2521.765] (-2524.367) (-2517.975) * [-2517.075] (-2519.503) (-2517.952) (-2522.365) -- 0:03:12 86000 -- [-2514.843] (-2522.214) (-2522.383) (-2527.635) * (-2520.429) [-2524.245] (-2519.920) (-2520.343) -- 0:03:11 86500 -- (-2526.098) (-2517.623) [-2518.012] (-2520.231) * [-2521.185] (-2520.248) (-2521.659) (-2520.854) -- 0:03:10 87000 -- (-2520.905) [-2516.256] (-2517.831) (-2530.461) * [-2517.317] (-2518.846) (-2518.180) (-2521.597) -- 0:03:08 87500 -- (-2529.207) (-2520.508) [-2520.937] (-2530.795) * (-2519.120) (-2520.320) [-2519.831] (-2519.024) -- 0:03:07 88000 -- (-2528.656) (-2519.003) [-2521.206] (-2525.339) * (-2520.262) (-2518.919) (-2517.113) [-2520.269] -- 0:03:06 88500 -- (-2522.719) (-2516.969) (-2524.266) [-2522.242] * (-2523.817) (-2528.370) [-2517.833] (-2523.026) -- 0:03:15 89000 -- (-2524.393) (-2521.948) [-2519.501] (-2518.643) * (-2527.202) (-2525.344) [-2522.906] (-2522.607) -- 0:03:14 89500 -- (-2526.972) [-2516.963] (-2520.994) (-2525.388) * (-2525.834) (-2526.888) (-2517.554) [-2529.140] -- 0:03:13 90000 -- (-2529.300) [-2528.895] (-2520.126) (-2524.193) * (-2521.742) (-2522.319) (-2521.595) [-2522.370] -- 0:03:12 Average standard deviation of split frequencies: 0.000000 90500 -- [-2522.720] (-2519.439) (-2518.287) (-2526.947) * [-2523.730] (-2518.382) (-2527.431) (-2525.809) -- 0:03:10 91000 -- (-2519.069) [-2517.968] (-2520.776) (-2525.222) * [-2526.727] (-2519.395) (-2519.659) (-2527.591) -- 0:03:09 91500 -- (-2520.264) [-2522.006] (-2523.050) (-2525.582) * (-2520.188) [-2518.577] (-2520.893) (-2516.610) -- 0:03:08 92000 -- (-2523.675) [-2518.791] (-2522.305) (-2522.230) * (-2522.047) (-2523.596) (-2522.122) [-2517.958] -- 0:03:07 92500 -- (-2521.809) [-2517.232] (-2523.431) (-2516.209) * (-2525.464) (-2520.383) [-2521.936] (-2520.014) -- 0:03:06 93000 -- (-2527.707) (-2524.881) [-2522.988] (-2518.732) * (-2528.559) (-2520.754) (-2523.947) [-2520.303] -- 0:03:15 93500 -- (-2520.868) (-2522.904) [-2519.904] (-2519.124) * (-2520.679) (-2520.525) (-2526.140) [-2523.238] -- 0:03:13 94000 -- [-2521.198] (-2522.366) (-2521.836) (-2522.716) * (-2523.468) (-2522.187) [-2527.904] (-2528.904) -- 0:03:12 94500 -- (-2521.539) (-2521.433) (-2524.866) [-2520.957] * (-2521.916) (-2517.869) [-2520.497] (-2525.852) -- 0:03:11 95000 -- (-2518.301) (-2527.202) (-2521.963) [-2521.422] * (-2519.697) [-2515.226] (-2521.585) (-2527.674) -- 0:03:10 Average standard deviation of split frequencies: 0.000000 95500 -- [-2517.901] (-2528.066) (-2526.531) (-2523.421) * [-2523.604] (-2521.652) (-2519.237) (-2523.772) -- 0:03:09 96000 -- [-2521.075] (-2527.275) (-2519.727) (-2530.985) * (-2524.414) [-2521.979] (-2520.190) (-2524.784) -- 0:03:08 96500 -- (-2522.942) (-2521.133) [-2518.199] (-2521.081) * (-2523.736) [-2519.694] (-2528.701) (-2518.275) -- 0:03:07 97000 -- (-2520.602) [-2529.198] (-2523.380) (-2519.003) * (-2521.361) (-2525.858) [-2519.841] (-2522.535) -- 0:03:06 97500 -- (-2526.190) [-2520.385] (-2521.260) (-2524.965) * (-2521.994) (-2520.601) [-2518.193] (-2523.240) -- 0:03:14 98000 -- (-2519.373) (-2523.428) (-2527.030) [-2522.041] * (-2517.847) (-2522.158) [-2518.315] (-2522.400) -- 0:03:13 98500 -- (-2517.449) [-2524.600] (-2522.150) (-2525.241) * (-2516.906) (-2520.228) [-2528.784] (-2529.802) -- 0:03:12 99000 -- [-2517.199] (-2521.648) (-2527.780) (-2519.128) * [-2521.140] (-2521.537) (-2523.458) (-2521.623) -- 0:03:11 99500 -- (-2524.733) [-2522.035] (-2522.286) (-2520.285) * (-2519.118) [-2515.139] (-2533.595) (-2523.653) -- 0:03:10 100000 -- (-2515.986) (-2525.036) (-2519.771) [-2520.057] * (-2520.501) (-2518.796) [-2522.776] (-2530.089) -- 0:03:09 Average standard deviation of split frequencies: 0.000000 100500 -- (-2519.962) (-2525.116) (-2521.377) [-2519.540] * [-2521.634] (-2523.293) (-2521.752) (-2526.646) -- 0:03:07 101000 -- (-2520.902) (-2517.065) [-2524.856] (-2523.608) * [-2518.950] (-2521.904) (-2519.157) (-2519.297) -- 0:03:06 101500 -- [-2519.039] (-2516.497) (-2520.632) (-2519.330) * (-2530.133) (-2523.856) [-2518.415] (-2522.193) -- 0:03:05 102000 -- (-2521.919) [-2518.481] (-2522.048) (-2525.302) * [-2520.609] (-2519.428) (-2525.389) (-2523.087) -- 0:03:13 102500 -- (-2520.968) [-2522.284] (-2523.094) (-2523.644) * [-2524.064] (-2517.009) (-2521.292) (-2527.064) -- 0:03:12 103000 -- (-2531.463) [-2516.684] (-2521.304) (-2524.215) * [-2521.703] (-2523.470) (-2521.943) (-2522.567) -- 0:03:11 103500 -- (-2515.965) [-2519.853] (-2523.713) (-2529.248) * (-2531.511) (-2526.707) (-2517.702) [-2522.437] -- 0:03:10 104000 -- (-2528.312) (-2525.129) (-2525.767) [-2521.879] * (-2523.554) (-2521.009) [-2523.457] (-2525.018) -- 0:03:09 104500 -- (-2524.474) (-2514.613) (-2521.897) [-2524.248] * (-2519.676) [-2524.714] (-2520.356) (-2516.725) -- 0:03:08 105000 -- [-2517.534] (-2519.027) (-2527.021) (-2518.080) * (-2520.242) [-2519.158] (-2520.364) (-2520.516) -- 0:03:07 Average standard deviation of split frequencies: 0.000000 105500 -- (-2525.404) [-2515.716] (-2522.413) (-2520.032) * (-2523.109) [-2518.903] (-2523.642) (-2526.000) -- 0:03:06 106000 -- [-2523.898] (-2521.304) (-2526.565) (-2523.687) * (-2517.432) (-2520.066) (-2523.629) [-2518.529] -- 0:03:05 106500 -- [-2522.081] (-2521.109) (-2520.169) (-2521.992) * [-2520.681] (-2524.820) (-2520.819) (-2518.076) -- 0:03:12 107000 -- (-2517.145) (-2520.515) (-2521.316) [-2521.422] * (-2522.014) (-2521.941) [-2519.289] (-2519.095) -- 0:03:11 107500 -- [-2524.778] (-2520.285) (-2518.952) (-2527.161) * (-2518.385) (-2518.745) [-2518.937] (-2519.285) -- 0:03:10 108000 -- [-2518.518] (-2522.310) (-2521.776) (-2518.875) * (-2528.514) [-2522.651] (-2520.922) (-2519.667) -- 0:03:09 108500 -- [-2516.179] (-2517.569) (-2524.776) (-2526.430) * [-2522.185] (-2518.138) (-2518.190) (-2516.332) -- 0:03:08 109000 -- [-2520.973] (-2522.916) (-2522.363) (-2532.474) * [-2518.363] (-2519.553) (-2519.140) (-2529.482) -- 0:03:08 109500 -- (-2521.244) (-2526.978) [-2521.437] (-2531.240) * (-2519.787) (-2522.745) [-2518.953] (-2526.027) -- 0:03:07 110000 -- (-2522.694) (-2524.253) (-2519.866) [-2517.568] * (-2521.912) (-2519.270) (-2520.140) [-2521.911] -- 0:03:06 Average standard deviation of split frequencies: 0.000000 110500 -- (-2521.367) [-2517.162] (-2522.872) (-2522.006) * [-2517.055] (-2521.846) (-2518.612) (-2518.534) -- 0:03:05 111000 -- (-2523.231) (-2517.005) [-2520.179] (-2522.850) * (-2522.748) (-2517.389) (-2516.748) [-2517.649] -- 0:03:12 111500 -- (-2520.863) (-2522.068) (-2523.701) [-2517.858] * (-2518.772) (-2521.373) [-2515.376] (-2518.215) -- 0:03:11 112000 -- (-2518.655) [-2525.827] (-2521.422) (-2521.150) * (-2521.729) [-2522.967] (-2521.038) (-2518.263) -- 0:03:10 112500 -- (-2520.568) (-2516.962) (-2520.247) [-2517.538] * (-2516.587) (-2520.299) [-2520.967] (-2519.554) -- 0:03:09 113000 -- (-2519.116) (-2518.465) (-2520.544) [-2516.140] * [-2518.698] (-2520.168) (-2524.937) (-2527.685) -- 0:03:08 113500 -- (-2523.049) (-2518.430) (-2521.096) [-2518.022] * [-2523.853] (-2520.498) (-2525.894) (-2524.947) -- 0:03:07 114000 -- (-2522.102) (-2523.284) [-2521.259] (-2522.608) * [-2516.475] (-2525.629) (-2520.907) (-2520.745) -- 0:03:06 114500 -- (-2523.323) (-2525.256) [-2519.148] (-2526.824) * (-2524.086) (-2519.930) [-2521.788] (-2525.682) -- 0:03:05 115000 -- [-2518.921] (-2522.699) (-2522.548) (-2527.872) * (-2525.778) (-2517.785) (-2521.749) [-2520.921] -- 0:03:04 Average standard deviation of split frequencies: 0.000000 115500 -- (-2518.259) [-2520.712] (-2522.905) (-2531.214) * (-2521.518) [-2519.018] (-2521.100) (-2519.625) -- 0:03:03 116000 -- [-2523.730] (-2520.002) (-2519.988) (-2524.179) * [-2528.662] (-2525.635) (-2520.500) (-2519.541) -- 0:03:10 116500 -- (-2528.639) (-2524.369) [-2521.879] (-2527.110) * (-2524.737) (-2520.874) (-2525.007) [-2524.043] -- 0:03:09 117000 -- (-2526.902) [-2521.245] (-2522.265) (-2521.077) * (-2525.787) (-2526.803) [-2520.235] (-2520.961) -- 0:03:08 117500 -- (-2525.779) (-2522.304) [-2522.983] (-2524.009) * (-2526.918) [-2519.458] (-2518.408) (-2519.539) -- 0:03:07 118000 -- (-2520.946) (-2524.478) (-2524.445) [-2518.925] * (-2525.117) [-2520.941] (-2517.147) (-2530.946) -- 0:03:06 118500 -- (-2520.111) (-2520.315) [-2520.610] (-2522.631) * [-2519.232] (-2524.106) (-2524.420) (-2524.430) -- 0:03:05 119000 -- [-2520.361] (-2523.807) (-2517.360) (-2517.395) * (-2523.421) (-2516.018) [-2525.319] (-2531.627) -- 0:03:05 119500 -- (-2524.732) [-2518.929] (-2521.856) (-2522.649) * (-2517.381) [-2518.251] (-2527.450) (-2528.140) -- 0:03:04 120000 -- [-2521.586] (-2520.353) (-2519.813) (-2523.030) * (-2520.350) (-2521.848) (-2516.915) [-2522.571] -- 0:03:03 Average standard deviation of split frequencies: 0.000000 120500 -- [-2517.465] (-2521.540) (-2524.442) (-2521.856) * (-2517.132) [-2529.103] (-2517.447) (-2520.685) -- 0:03:09 121000 -- (-2519.715) [-2520.367] (-2530.434) (-2521.552) * (-2519.440) (-2520.696) [-2521.007] (-2526.790) -- 0:03:08 121500 -- (-2528.425) (-2520.956) [-2517.677] (-2531.072) * (-2518.448) [-2521.146] (-2519.042) (-2518.768) -- 0:03:07 122000 -- (-2531.983) (-2523.960) [-2522.856] (-2527.222) * (-2514.817) [-2523.213] (-2523.948) (-2522.913) -- 0:03:07 122500 -- (-2520.707) [-2522.649] (-2518.694) (-2521.251) * (-2522.614) (-2517.629) (-2519.591) [-2519.647] -- 0:03:06 123000 -- (-2521.771) [-2523.047] (-2521.589) (-2520.577) * (-2522.105) (-2523.299) [-2527.790] (-2526.703) -- 0:03:05 123500 -- [-2519.037] (-2526.399) (-2518.160) (-2520.974) * (-2519.211) (-2518.089) (-2519.437) [-2519.462] -- 0:03:04 124000 -- (-2524.250) (-2525.253) [-2527.996] (-2518.487) * (-2519.844) (-2526.238) [-2521.555] (-2520.995) -- 0:03:03 124500 -- (-2530.492) (-2529.626) [-2523.232] (-2517.889) * (-2523.576) (-2529.588) (-2517.682) [-2521.009] -- 0:03:02 125000 -- (-2522.341) (-2525.841) [-2524.105] (-2519.297) * (-2521.884) (-2516.390) [-2528.606] (-2518.817) -- 0:03:09 Average standard deviation of split frequencies: 0.000000 125500 -- (-2529.957) [-2524.512] (-2526.062) (-2519.718) * (-2518.566) (-2520.616) [-2520.183] (-2516.872) -- 0:03:08 126000 -- (-2525.489) (-2531.318) (-2529.643) [-2522.294] * (-2524.361) (-2524.853) (-2524.765) [-2518.516] -- 0:03:07 126500 -- (-2521.516) (-2523.010) [-2521.647] (-2519.234) * [-2518.188] (-2524.225) (-2520.273) (-2524.311) -- 0:03:06 127000 -- (-2518.931) (-2521.264) (-2518.154) [-2517.205] * (-2520.982) (-2522.477) [-2519.437] (-2519.456) -- 0:03:05 127500 -- (-2519.510) (-2524.522) (-2517.899) [-2520.836] * (-2523.809) (-2521.967) [-2521.438] (-2528.193) -- 0:03:04 128000 -- (-2517.659) (-2524.027) [-2520.798] (-2517.340) * (-2520.448) (-2517.963) (-2520.846) [-2520.885] -- 0:03:03 128500 -- [-2517.364] (-2519.830) (-2524.059) (-2521.793) * (-2520.932) (-2515.838) (-2519.904) [-2521.527] -- 0:03:03 129000 -- [-2517.255] (-2522.881) (-2528.946) (-2519.873) * (-2523.876) [-2520.219] (-2523.455) (-2521.355) -- 0:03:02 129500 -- [-2518.215] (-2525.345) (-2526.718) (-2518.875) * [-2521.333] (-2526.589) (-2520.491) (-2525.447) -- 0:03:08 130000 -- (-2519.003) (-2535.826) (-2523.799) [-2517.703] * (-2524.802) (-2524.323) [-2522.442] (-2528.138) -- 0:03:07 Average standard deviation of split frequencies: 0.000000 130500 -- (-2522.210) [-2526.489] (-2525.004) (-2526.310) * (-2525.265) (-2522.056) [-2518.106] (-2531.087) -- 0:03:06 131000 -- [-2517.603] (-2524.747) (-2523.087) (-2520.714) * (-2529.427) (-2518.245) [-2515.730] (-2525.766) -- 0:03:05 131500 -- (-2517.393) (-2518.414) (-2522.684) [-2518.779] * (-2532.129) [-2522.811] (-2522.152) (-2522.153) -- 0:03:04 132000 -- (-2521.457) (-2523.741) (-2522.302) [-2516.578] * (-2534.024) (-2526.981) (-2526.689) [-2517.446] -- 0:03:04 132500 -- (-2526.520) (-2520.359) (-2521.045) [-2516.855] * [-2522.895] (-2523.042) (-2518.826) (-2524.576) -- 0:03:03 133000 -- [-2521.074] (-2518.448) (-2518.454) (-2527.512) * (-2530.891) (-2522.125) (-2524.673) [-2524.225] -- 0:03:02 133500 -- [-2520.336] (-2521.963) (-2519.102) (-2516.749) * (-2523.413) [-2520.417] (-2520.466) (-2522.468) -- 0:03:01 134000 -- [-2524.543] (-2527.581) (-2517.130) (-2524.167) * (-2522.325) [-2519.755] (-2522.876) (-2518.386) -- 0:03:00 134500 -- (-2518.358) (-2526.556) (-2520.898) [-2523.627] * (-2520.229) (-2521.923) [-2523.319] (-2522.666) -- 0:03:06 135000 -- (-2519.944) (-2522.569) (-2519.232) [-2520.228] * (-2517.133) [-2520.240] (-2525.964) (-2523.465) -- 0:03:05 Average standard deviation of split frequencies: 0.000000 135500 -- (-2527.009) (-2522.886) (-2519.960) [-2526.344] * (-2518.754) [-2520.473] (-2521.751) (-2517.445) -- 0:03:05 136000 -- (-2520.006) (-2517.907) (-2526.610) [-2522.387] * (-2521.486) (-2524.813) (-2516.892) [-2516.512] -- 0:03:04 136500 -- (-2521.966) (-2519.090) [-2523.618] (-2525.072) * [-2520.483] (-2518.235) (-2517.121) (-2521.647) -- 0:03:03 137000 -- (-2520.206) (-2516.062) [-2524.836] (-2527.328) * (-2519.180) (-2517.052) [-2519.508] (-2523.402) -- 0:03:02 137500 -- (-2522.458) [-2519.710] (-2522.246) (-2526.529) * [-2523.138] (-2519.943) (-2521.283) (-2526.497) -- 0:03:01 138000 -- (-2525.210) [-2520.047] (-2516.907) (-2526.290) * [-2524.468] (-2522.056) (-2524.902) (-2522.513) -- 0:03:01 138500 -- (-2519.556) (-2520.876) [-2520.843] (-2522.144) * [-2519.585] (-2526.552) (-2520.327) (-2522.842) -- 0:03:00 139000 -- (-2522.966) (-2524.235) [-2520.775] (-2523.452) * (-2520.327) (-2521.544) [-2522.419] (-2521.134) -- 0:03:05 139500 -- (-2520.429) (-2525.251) [-2520.529] (-2521.558) * (-2519.822) (-2519.872) [-2519.478] (-2523.034) -- 0:03:05 140000 -- (-2520.984) [-2522.393] (-2522.371) (-2523.709) * (-2516.038) [-2521.807] (-2520.957) (-2519.306) -- 0:03:04 Average standard deviation of split frequencies: 0.000000 140500 -- (-2525.394) [-2519.765] (-2528.348) (-2526.028) * (-2514.503) (-2524.568) (-2516.937) [-2520.269] -- 0:03:03 141000 -- (-2525.969) (-2521.408) (-2521.432) [-2521.006] * [-2518.626] (-2521.078) (-2517.026) (-2526.195) -- 0:03:02 141500 -- (-2526.064) (-2524.997) (-2524.270) [-2521.939] * [-2519.707] (-2519.528) (-2522.010) (-2520.835) -- 0:03:02 142000 -- (-2526.449) (-2522.790) (-2519.099) [-2519.605] * (-2522.958) [-2519.661] (-2525.152) (-2521.763) -- 0:03:01 142500 -- (-2524.386) [-2530.028] (-2518.656) (-2517.972) * (-2523.113) (-2519.615) [-2519.672] (-2516.518) -- 0:03:00 143000 -- (-2530.651) (-2525.513) (-2521.343) [-2521.850] * (-2520.641) (-2521.008) (-2518.239) [-2517.193] -- 0:02:59 143500 -- (-2531.740) (-2523.925) (-2518.621) [-2522.419] * (-2518.446) [-2523.415] (-2521.000) (-2527.939) -- 0:03:05 144000 -- (-2520.466) (-2522.644) (-2522.350) [-2519.416] * (-2521.123) (-2526.442) [-2521.112] (-2521.467) -- 0:03:04 144500 -- [-2520.931] (-2525.391) (-2525.391) (-2529.764) * [-2517.249] (-2521.597) (-2515.179) (-2523.245) -- 0:03:03 145000 -- [-2522.003] (-2523.386) (-2524.458) (-2518.824) * (-2522.334) (-2518.778) [-2519.012] (-2520.772) -- 0:03:02 Average standard deviation of split frequencies: 0.000000 145500 -- (-2522.815) (-2523.692) [-2519.214] (-2524.505) * (-2521.891) [-2517.028] (-2517.922) (-2525.736) -- 0:03:02 146000 -- (-2519.199) (-2526.065) (-2523.505) [-2522.430] * (-2523.491) [-2519.915] (-2521.427) (-2528.258) -- 0:03:01 146500 -- [-2523.744] (-2521.717) (-2521.083) (-2523.636) * [-2518.801] (-2521.207) (-2519.567) (-2523.929) -- 0:03:00 147000 -- (-2523.474) [-2519.727] (-2523.633) (-2522.179) * (-2520.472) (-2522.628) [-2517.345] (-2523.057) -- 0:02:59 147500 -- (-2518.410) [-2515.659] (-2527.328) (-2521.394) * (-2525.963) [-2525.565] (-2518.652) (-2527.979) -- 0:02:59 148000 -- (-2522.813) (-2526.063) (-2519.275) [-2520.879] * (-2519.323) (-2516.097) (-2520.799) [-2528.194] -- 0:03:04 148500 -- (-2524.891) [-2522.947] (-2521.170) (-2521.156) * (-2520.859) [-2518.277] (-2516.631) (-2530.758) -- 0:03:03 149000 -- [-2523.939] (-2528.731) (-2517.886) (-2520.038) * (-2517.522) [-2518.659] (-2529.167) (-2520.849) -- 0:03:02 149500 -- (-2522.387) (-2518.778) [-2521.129] (-2530.164) * (-2522.839) (-2521.880) [-2523.500] (-2520.559) -- 0:03:02 150000 -- (-2523.090) (-2527.662) (-2522.020) [-2520.942] * [-2521.284] (-2528.969) (-2519.105) (-2522.080) -- 0:03:01 Average standard deviation of split frequencies: 0.000000 150500 -- (-2517.791) [-2522.506] (-2516.486) (-2524.327) * (-2519.596) (-2520.330) (-2521.852) [-2519.950] -- 0:03:00 151000 -- (-2521.156) (-2521.641) [-2516.720] (-2523.375) * (-2525.074) (-2524.847) [-2525.013] (-2520.156) -- 0:02:59 151500 -- [-2522.411] (-2519.524) (-2517.571) (-2519.376) * (-2525.431) (-2525.666) (-2520.274) [-2518.378] -- 0:02:59 152000 -- (-2522.245) [-2516.855] (-2519.720) (-2518.704) * (-2519.279) (-2522.569) [-2520.507] (-2517.659) -- 0:02:58 152500 -- (-2522.496) (-2518.200) [-2523.050] (-2516.358) * [-2521.930] (-2523.255) (-2521.578) (-2517.167) -- 0:02:57 153000 -- [-2518.359] (-2521.776) (-2521.922) (-2519.686) * (-2519.038) (-2526.821) (-2520.128) [-2516.495] -- 0:03:02 153500 -- (-2521.802) (-2522.839) (-2517.921) [-2522.770] * (-2519.907) (-2526.121) [-2523.263] (-2517.927) -- 0:03:01 154000 -- (-2518.090) (-2525.104) (-2521.159) [-2519.837] * [-2519.020] (-2527.288) (-2526.692) (-2520.210) -- 0:03:01 154500 -- (-2522.815) (-2525.434) [-2520.092] (-2522.137) * (-2522.307) (-2518.850) [-2523.137] (-2522.204) -- 0:03:00 155000 -- (-2522.420) (-2517.191) [-2524.117] (-2518.531) * [-2523.769] (-2526.720) (-2524.688) (-2523.319) -- 0:02:59 Average standard deviation of split frequencies: 0.000000 155500 -- (-2519.766) [-2523.529] (-2533.115) (-2518.594) * (-2519.600) [-2522.840] (-2523.391) (-2523.056) -- 0:02:59 156000 -- (-2523.259) [-2523.880] (-2521.874) (-2522.365) * (-2525.329) (-2521.883) [-2521.911] (-2522.957) -- 0:02:58 156500 -- (-2528.055) [-2520.300] (-2519.819) (-2521.989) * [-2516.636] (-2518.849) (-2516.687) (-2521.097) -- 0:02:57 157000 -- (-2523.802) (-2530.347) (-2516.879) [-2515.421] * (-2524.417) (-2519.594) (-2523.450) [-2518.967] -- 0:02:57 157500 -- (-2519.423) [-2514.898] (-2516.701) (-2521.543) * (-2521.382) [-2524.465] (-2522.890) (-2517.635) -- 0:03:01 158000 -- (-2530.596) [-2515.851] (-2519.716) (-2520.499) * (-2524.263) (-2524.299) (-2516.074) [-2517.697] -- 0:03:01 158500 -- (-2525.080) (-2523.934) (-2522.053) [-2518.871] * (-2525.967) (-2524.921) [-2516.232] (-2521.936) -- 0:03:00 159000 -- (-2521.446) (-2519.347) (-2524.986) [-2515.904] * [-2526.430] (-2525.833) (-2521.481) (-2525.042) -- 0:02:59 159500 -- (-2520.653) (-2520.229) (-2525.408) [-2525.292] * (-2522.859) (-2526.425) [-2520.615] (-2524.519) -- 0:02:59 160000 -- (-2523.576) (-2522.320) [-2523.519] (-2529.377) * (-2526.172) [-2523.860] (-2525.856) (-2528.866) -- 0:02:58 Average standard deviation of split frequencies: 0.000000 160500 -- [-2526.107] (-2521.301) (-2521.463) (-2524.250) * (-2526.405) (-2520.301) (-2521.392) [-2520.425] -- 0:02:57 161000 -- (-2520.693) (-2517.236) (-2517.661) [-2521.962] * (-2520.785) (-2516.980) [-2519.580] (-2519.683) -- 0:02:57 161500 -- (-2518.742) (-2523.981) [-2517.135] (-2518.331) * (-2526.069) [-2520.437] (-2523.843) (-2517.880) -- 0:02:56 162000 -- (-2522.088) (-2521.805) [-2518.676] (-2519.663) * (-2521.292) (-2521.598) [-2520.827] (-2520.619) -- 0:03:01 162500 -- (-2522.788) (-2528.634) (-2523.228) [-2519.013] * [-2520.152] (-2516.898) (-2520.836) (-2521.910) -- 0:03:00 163000 -- (-2522.161) (-2529.695) (-2523.135) [-2522.040] * (-2516.889) (-2514.495) (-2521.973) [-2527.385] -- 0:02:59 163500 -- (-2520.788) [-2522.548] (-2524.204) (-2531.371) * (-2520.052) (-2519.733) [-2518.477] (-2525.372) -- 0:02:59 164000 -- (-2526.684) [-2515.648] (-2519.363) (-2518.807) * (-2521.062) (-2523.199) [-2518.755] (-2522.466) -- 0:02:58 164500 -- (-2521.924) (-2518.999) (-2520.759) [-2521.666] * (-2518.579) [-2519.330] (-2514.926) (-2524.832) -- 0:02:57 165000 -- (-2521.458) [-2521.138] (-2522.298) (-2532.635) * [-2518.491] (-2522.071) (-2520.804) (-2524.541) -- 0:02:57 Average standard deviation of split frequencies: 0.000000 165500 -- [-2520.348] (-2523.086) (-2534.173) (-2524.955) * (-2519.681) (-2525.078) [-2518.755] (-2524.720) -- 0:02:56 166000 -- (-2519.828) (-2523.069) (-2523.033) [-2522.487] * (-2520.567) [-2528.839] (-2518.217) (-2517.678) -- 0:02:55 166500 -- (-2525.142) [-2518.844] (-2525.330) (-2522.632) * (-2524.019) (-2518.077) [-2522.117] (-2521.204) -- 0:03:00 167000 -- [-2525.310] (-2520.562) (-2528.866) (-2519.986) * (-2519.675) (-2522.199) [-2524.187] (-2520.320) -- 0:02:59 167500 -- (-2519.092) (-2526.908) [-2520.353] (-2518.912) * (-2526.676) (-2524.915) (-2516.815) [-2520.868] -- 0:02:58 168000 -- (-2524.866) [-2518.564] (-2526.382) (-2521.814) * (-2522.096) [-2524.787] (-2520.573) (-2520.812) -- 0:02:58 168500 -- [-2521.320] (-2522.850) (-2520.205) (-2516.956) * [-2519.069] (-2525.914) (-2522.022) (-2524.117) -- 0:02:57 169000 -- [-2516.883] (-2518.069) (-2520.739) (-2516.873) * (-2518.757) (-2525.989) (-2522.602) [-2523.186] -- 0:02:57 169500 -- (-2523.428) [-2519.025] (-2523.067) (-2522.964) * (-2524.613) (-2524.513) (-2522.861) [-2525.631] -- 0:02:56 170000 -- [-2517.689] (-2519.044) (-2521.577) (-2518.487) * [-2522.246] (-2529.134) (-2524.893) (-2524.353) -- 0:02:55 Average standard deviation of split frequencies: 0.000000 170500 -- (-2525.758) (-2529.151) [-2522.854] (-2521.054) * (-2521.755) (-2517.808) [-2519.616] (-2528.310) -- 0:02:55 171000 -- (-2528.747) [-2521.710] (-2518.840) (-2519.793) * (-2523.619) (-2526.459) [-2521.841] (-2522.833) -- 0:02:54 171500 -- (-2523.590) (-2521.760) [-2518.666] (-2520.521) * (-2532.874) (-2525.411) (-2522.873) [-2522.498] -- 0:02:58 172000 -- (-2525.525) [-2521.456] (-2520.092) (-2519.427) * (-2525.303) [-2518.512] (-2526.810) (-2524.412) -- 0:02:58 172500 -- [-2518.026] (-2525.895) (-2520.055) (-2530.600) * [-2521.414] (-2520.002) (-2518.728) (-2519.204) -- 0:02:57 173000 -- (-2523.367) (-2524.107) (-2522.445) [-2520.022] * (-2524.945) (-2520.788) (-2522.370) [-2518.495] -- 0:02:56 173500 -- (-2524.082) (-2523.994) [-2519.474] (-2530.297) * [-2519.626] (-2526.909) (-2516.982) (-2519.276) -- 0:02:56 174000 -- (-2521.391) (-2519.026) [-2524.899] (-2523.622) * (-2524.083) (-2528.141) [-2523.553] (-2519.585) -- 0:02:55 174500 -- (-2523.816) [-2520.633] (-2521.809) (-2529.604) * (-2519.519) (-2523.990) [-2525.220] (-2522.842) -- 0:02:55 175000 -- (-2522.915) [-2517.962] (-2524.985) (-2526.078) * (-2523.203) (-2522.051) (-2526.143) [-2520.811] -- 0:02:54 Average standard deviation of split frequencies: 0.000000 175500 -- (-2524.579) (-2523.652) [-2519.710] (-2515.735) * (-2519.085) [-2521.195] (-2521.329) (-2519.363) -- 0:02:53 176000 -- [-2526.421] (-2521.562) (-2524.614) (-2520.913) * (-2527.153) (-2522.113) [-2522.047] (-2520.862) -- 0:02:57 176500 -- (-2525.378) [-2523.665] (-2524.764) (-2523.395) * (-2519.982) [-2522.024] (-2516.533) (-2525.220) -- 0:02:57 177000 -- (-2526.719) (-2524.690) [-2526.181] (-2526.983) * (-2521.431) (-2523.070) [-2517.126] (-2521.714) -- 0:02:56 177500 -- [-2523.329] (-2523.543) (-2526.612) (-2520.369) * (-2526.321) [-2526.031] (-2521.442) (-2525.035) -- 0:02:56 178000 -- (-2520.893) (-2526.024) (-2527.578) [-2525.406] * (-2528.005) (-2524.307) (-2517.164) [-2518.766] -- 0:02:55 178500 -- [-2518.300] (-2527.095) (-2524.268) (-2524.999) * (-2518.253) [-2521.459] (-2516.843) (-2524.967) -- 0:02:54 179000 -- [-2518.607] (-2524.992) (-2524.475) (-2527.472) * (-2524.685) [-2521.396] (-2520.914) (-2521.881) -- 0:02:54 179500 -- (-2524.149) (-2524.230) [-2526.776] (-2519.235) * [-2520.220] (-2518.454) (-2518.924) (-2526.996) -- 0:02:53 180000 -- [-2517.623] (-2519.469) (-2522.521) (-2520.134) * [-2522.446] (-2528.003) (-2525.945) (-2521.449) -- 0:02:53 Average standard deviation of split frequencies: 0.000000 180500 -- (-2521.784) (-2520.283) (-2528.514) [-2530.433] * (-2519.742) (-2526.774) (-2531.179) [-2522.786] -- 0:02:57 181000 -- [-2521.675] (-2517.786) (-2518.232) (-2517.907) * (-2516.251) (-2531.157) (-2518.004) [-2517.978] -- 0:02:56 181500 -- (-2524.333) [-2519.610] (-2524.187) (-2518.165) * (-2523.236) [-2523.290] (-2520.114) (-2518.486) -- 0:02:55 182000 -- (-2522.674) (-2519.522) (-2522.442) [-2515.395] * (-2523.041) (-2517.996) (-2520.473) [-2521.046] -- 0:02:55 182500 -- (-2518.693) (-2528.306) [-2522.159] (-2523.958) * (-2519.505) (-2522.641) (-2519.863) [-2522.392] -- 0:02:54 183000 -- (-2517.355) (-2519.154) [-2522.112] (-2524.909) * (-2522.069) (-2518.751) [-2527.469] (-2521.299) -- 0:02:54 183500 -- (-2516.575) [-2522.186] (-2522.263) (-2522.077) * (-2520.510) (-2521.265) (-2520.841) [-2518.560] -- 0:02:53 184000 -- [-2516.816] (-2520.590) (-2526.612) (-2523.471) * [-2523.054] (-2522.428) (-2524.147) (-2519.344) -- 0:02:52 184500 -- (-2520.859) (-2519.972) (-2526.286) [-2522.833] * [-2518.189] (-2521.364) (-2522.712) (-2520.142) -- 0:02:52 185000 -- (-2519.888) (-2524.119) (-2522.843) [-2518.305] * [-2518.975] (-2519.953) (-2517.679) (-2522.231) -- 0:02:56 Average standard deviation of split frequencies: 0.000000 185500 -- [-2524.229] (-2520.821) (-2521.353) (-2525.866) * [-2519.791] (-2522.836) (-2522.200) (-2518.086) -- 0:02:55 186000 -- (-2527.810) (-2517.443) [-2518.902] (-2525.098) * [-2521.050] (-2519.697) (-2530.129) (-2520.336) -- 0:02:55 186500 -- (-2516.993) [-2519.004] (-2523.022) (-2521.735) * [-2524.297] (-2519.044) (-2519.660) (-2521.632) -- 0:02:54 187000 -- (-2518.598) (-2520.183) (-2523.034) [-2518.741] * (-2520.065) (-2520.879) (-2519.469) [-2518.052] -- 0:02:53 187500 -- (-2522.296) (-2522.234) (-2521.883) [-2521.685] * (-2529.258) (-2518.395) (-2516.945) [-2516.482] -- 0:02:53 188000 -- (-2519.358) (-2517.849) [-2526.493] (-2527.249) * [-2516.909] (-2528.348) (-2524.779) (-2519.495) -- 0:02:52 188500 -- (-2520.116) [-2517.059] (-2523.491) (-2520.386) * (-2522.839) (-2525.367) (-2519.350) [-2518.703] -- 0:02:52 189000 -- (-2519.543) (-2520.280) [-2517.807] (-2525.240) * (-2530.009) (-2524.711) (-2518.373) [-2523.721] -- 0:02:51 189500 -- (-2522.054) (-2522.996) (-2522.109) [-2520.466] * (-2523.364) (-2521.501) [-2521.212] (-2517.824) -- 0:02:51 190000 -- (-2522.828) (-2520.003) [-2519.748] (-2521.139) * (-2524.026) (-2522.968) (-2520.106) [-2524.787] -- 0:02:54 Average standard deviation of split frequencies: 0.000000 190500 -- (-2519.811) [-2520.687] (-2521.945) (-2519.869) * (-2520.996) (-2525.109) (-2522.864) [-2520.300] -- 0:02:54 191000 -- (-2520.410) [-2525.004] (-2525.865) (-2520.253) * [-2519.739] (-2518.731) (-2518.788) (-2518.476) -- 0:02:53 191500 -- (-2522.223) (-2527.336) (-2524.854) [-2516.820] * (-2518.893) (-2521.666) (-2515.841) [-2517.532] -- 0:02:53 192000 -- (-2523.156) [-2528.143] (-2524.544) (-2517.456) * (-2519.251) (-2523.551) [-2524.845] (-2524.628) -- 0:02:52 192500 -- (-2518.096) (-2527.609) (-2520.218) [-2520.514] * [-2521.554] (-2521.913) (-2523.145) (-2516.580) -- 0:02:51 193000 -- (-2522.641) (-2527.179) (-2523.615) [-2518.753] * [-2518.453] (-2522.905) (-2523.728) (-2521.842) -- 0:02:51 193500 -- (-2522.605) (-2523.749) [-2523.376] (-2520.941) * [-2518.191] (-2520.447) (-2523.870) (-2519.226) -- 0:02:50 194000 -- (-2521.339) [-2528.420] (-2526.005) (-2517.857) * (-2520.102) [-2519.495] (-2525.471) (-2523.792) -- 0:02:50 194500 -- (-2520.000) (-2528.406) [-2522.310] (-2518.106) * (-2518.519) [-2518.245] (-2521.979) (-2521.678) -- 0:02:53 195000 -- (-2521.060) (-2522.734) [-2518.160] (-2521.585) * [-2517.344] (-2520.542) (-2522.312) (-2522.861) -- 0:02:53 Average standard deviation of split frequencies: 0.000000 195500 -- [-2519.579] (-2524.220) (-2523.695) (-2518.466) * (-2517.835) (-2520.674) (-2520.837) [-2522.243] -- 0:02:52 196000 -- (-2529.326) (-2522.830) [-2518.483] (-2519.868) * (-2522.630) (-2521.288) (-2519.984) [-2518.390] -- 0:02:52 196500 -- (-2520.088) (-2527.716) (-2525.254) [-2517.468] * [-2520.828] (-2522.457) (-2523.823) (-2528.340) -- 0:02:51 197000 -- (-2523.607) (-2527.733) (-2521.017) [-2518.012] * (-2519.532) [-2521.260] (-2518.244) (-2523.028) -- 0:02:51 197500 -- (-2517.318) (-2523.073) (-2520.043) [-2522.499] * (-2520.100) (-2522.643) [-2517.923] (-2523.790) -- 0:02:50 198000 -- (-2518.695) (-2521.440) [-2520.125] (-2522.274) * (-2517.044) (-2525.096) (-2520.183) [-2520.141] -- 0:02:50 198500 -- [-2516.527] (-2525.038) (-2531.805) (-2529.289) * (-2520.202) [-2525.885] (-2519.538) (-2529.056) -- 0:02:49 199000 -- (-2520.739) (-2529.379) (-2529.373) [-2523.468] * (-2522.427) [-2517.725] (-2520.991) (-2519.139) -- 0:02:53 199500 -- [-2518.070] (-2526.105) (-2527.939) (-2522.133) * (-2521.610) (-2526.484) (-2522.413) [-2519.030] -- 0:02:52 200000 -- (-2521.751) (-2520.879) [-2524.830] (-2524.142) * [-2517.768] (-2523.346) (-2518.149) (-2521.242) -- 0:02:52 Average standard deviation of split frequencies: 0.000000 200500 -- (-2522.443) (-2517.689) (-2525.551) [-2515.867] * [-2516.738] (-2521.179) (-2517.517) (-2517.417) -- 0:02:51 201000 -- [-2519.388] (-2518.864) (-2523.034) (-2520.904) * (-2521.427) (-2517.406) [-2520.440] (-2520.902) -- 0:02:50 201500 -- [-2519.656] (-2517.325) (-2519.012) (-2524.273) * (-2517.397) (-2524.212) [-2518.465] (-2521.148) -- 0:02:50 202000 -- [-2517.625] (-2517.699) (-2525.233) (-2525.039) * (-2526.366) (-2524.192) (-2525.666) [-2518.542] -- 0:02:49 202500 -- (-2523.843) [-2518.245] (-2522.882) (-2524.469) * (-2528.617) (-2521.338) (-2525.365) [-2518.886] -- 0:02:49 203000 -- (-2524.324) (-2517.864) (-2517.729) [-2526.110] * (-2525.597) (-2529.955) (-2522.401) [-2517.019] -- 0:02:48 203500 -- (-2517.273) [-2518.638] (-2520.676) (-2526.054) * (-2528.036) [-2523.921] (-2519.402) (-2524.360) -- 0:02:52 204000 -- (-2519.411) (-2519.265) (-2520.047) [-2520.817] * (-2521.796) [-2517.197] (-2527.692) (-2523.737) -- 0:02:51 204500 -- (-2520.527) [-2522.579] (-2530.115) (-2524.941) * (-2520.494) (-2521.863) [-2521.213] (-2521.996) -- 0:02:51 205000 -- (-2514.810) [-2522.915] (-2524.223) (-2528.048) * (-2520.515) (-2530.068) (-2526.297) [-2520.342] -- 0:02:50 Average standard deviation of split frequencies: 0.000000 205500 -- (-2521.023) [-2528.105] (-2523.986) (-2528.542) * [-2518.291] (-2531.306) (-2523.099) (-2523.246) -- 0:02:50 206000 -- (-2520.579) (-2522.035) [-2520.474] (-2524.676) * [-2516.381] (-2529.327) (-2517.638) (-2521.892) -- 0:02:49 206500 -- [-2529.097] (-2519.141) (-2529.839) (-2518.842) * [-2517.350] (-2523.860) (-2517.946) (-2527.607) -- 0:02:49 207000 -- (-2525.512) (-2519.172) [-2522.852] (-2522.195) * (-2521.164) (-2528.881) [-2523.085] (-2526.930) -- 0:02:48 207500 -- (-2525.342) (-2521.685) (-2527.774) [-2526.333] * (-2517.562) [-2525.256] (-2521.136) (-2529.389) -- 0:02:48 208000 -- (-2526.585) (-2519.571) (-2527.257) [-2517.864] * (-2522.751) (-2520.676) (-2525.799) [-2520.908] -- 0:02:47 208500 -- (-2526.910) (-2517.254) (-2524.346) [-2520.020] * [-2519.425] (-2522.243) (-2523.908) (-2519.503) -- 0:02:50 209000 -- (-2522.529) [-2519.961] (-2520.970) (-2519.829) * (-2515.371) [-2523.900] (-2517.653) (-2521.978) -- 0:02:50 209500 -- (-2522.021) [-2519.962] (-2524.792) (-2518.483) * (-2517.024) (-2523.820) [-2516.095] (-2519.285) -- 0:02:49 210000 -- (-2520.825) (-2522.629) (-2522.087) [-2521.124] * [-2520.686] (-2525.088) (-2523.691) (-2517.133) -- 0:02:49 Average standard deviation of split frequencies: 0.000000 210500 -- [-2519.537] (-2528.013) (-2520.333) (-2522.903) * (-2524.778) (-2519.405) (-2522.528) [-2517.876] -- 0:02:48 211000 -- [-2518.393] (-2529.155) (-2519.419) (-2517.602) * (-2529.281) [-2517.881] (-2523.925) (-2517.287) -- 0:02:48 211500 -- (-2519.524) (-2520.946) (-2523.413) [-2520.528] * [-2522.665] (-2523.501) (-2528.903) (-2527.248) -- 0:02:47 212000 -- (-2520.979) (-2523.244) [-2520.933] (-2520.376) * [-2521.275] (-2526.406) (-2519.579) (-2521.848) -- 0:02:47 212500 -- [-2517.408] (-2526.459) (-2520.483) (-2518.535) * [-2524.881] (-2524.883) (-2524.738) (-2527.032) -- 0:02:46 213000 -- (-2518.951) (-2524.351) (-2520.537) [-2519.549] * (-2529.311) [-2516.811] (-2518.307) (-2522.200) -- 0:02:49 213500 -- [-2521.414] (-2527.188) (-2524.275) (-2524.063) * (-2527.783) (-2521.418) [-2519.251] (-2524.555) -- 0:02:49 214000 -- (-2525.384) (-2531.766) [-2517.555] (-2530.170) * (-2524.168) (-2518.348) [-2517.936] (-2521.551) -- 0:02:48 214500 -- [-2520.395] (-2527.793) (-2521.524) (-2523.334) * (-2521.116) [-2520.180] (-2519.422) (-2524.941) -- 0:02:48 215000 -- (-2517.773) (-2523.468) (-2523.456) [-2518.544] * (-2520.290) [-2517.777] (-2519.299) (-2521.554) -- 0:02:47 Average standard deviation of split frequencies: 0.000000 215500 -- (-2519.879) (-2526.205) [-2518.732] (-2523.510) * (-2520.506) (-2520.537) [-2519.349] (-2526.373) -- 0:02:47 216000 -- [-2517.979] (-2527.777) (-2517.766) (-2529.238) * (-2524.125) (-2519.501) (-2522.750) [-2522.413] -- 0:02:46 216500 -- (-2521.969) (-2527.813) (-2516.355) [-2520.988] * (-2521.106) (-2521.238) [-2518.986] (-2522.700) -- 0:02:46 217000 -- (-2529.096) [-2526.577] (-2522.410) (-2524.154) * (-2527.154) [-2521.882] (-2523.768) (-2522.630) -- 0:02:45 217500 -- (-2522.358) [-2524.360] (-2518.344) (-2523.570) * (-2525.414) (-2521.078) [-2517.098] (-2532.403) -- 0:02:49 218000 -- (-2527.344) [-2519.412] (-2517.260) (-2523.581) * [-2520.763] (-2523.888) (-2520.787) (-2524.934) -- 0:02:48 218500 -- (-2522.284) [-2525.545] (-2520.689) (-2519.641) * (-2527.415) [-2520.186] (-2522.351) (-2530.807) -- 0:02:48 219000 -- (-2525.327) [-2518.689] (-2519.646) (-2521.020) * (-2527.320) [-2520.006] (-2527.599) (-2526.467) -- 0:02:47 219500 -- (-2528.997) (-2517.089) (-2518.738) [-2518.028] * [-2518.719] (-2519.056) (-2525.256) (-2522.035) -- 0:02:47 220000 -- (-2523.745) (-2521.030) (-2521.786) [-2526.264] * [-2519.103] (-2530.291) (-2524.735) (-2527.611) -- 0:02:46 Average standard deviation of split frequencies: 0.000000 220500 -- (-2527.821) (-2520.933) [-2521.512] (-2519.234) * (-2516.581) (-2521.518) (-2522.010) [-2520.114] -- 0:02:46 221000 -- (-2520.877) [-2521.444] (-2520.724) (-2531.331) * [-2517.285] (-2518.041) (-2522.643) (-2521.755) -- 0:02:45 221500 -- [-2520.551] (-2529.228) (-2519.500) (-2527.051) * (-2526.858) (-2521.961) (-2520.036) [-2522.653] -- 0:02:45 222000 -- (-2525.688) (-2518.806) [-2519.799] (-2522.494) * (-2521.460) (-2522.270) [-2518.241] (-2533.379) -- 0:02:48 222500 -- (-2521.932) [-2521.828] (-2517.868) (-2522.440) * [-2519.412] (-2525.756) (-2518.964) (-2521.548) -- 0:02:47 223000 -- (-2525.939) (-2521.632) [-2518.145] (-2519.281) * (-2520.435) (-2525.848) [-2520.086] (-2520.896) -- 0:02:47 223500 -- (-2518.425) (-2527.866) (-2519.222) [-2518.927] * (-2527.852) (-2520.306) (-2526.620) [-2523.057] -- 0:02:46 224000 -- [-2520.140] (-2519.002) (-2525.395) (-2523.407) * (-2523.773) [-2519.987] (-2528.695) (-2518.880) -- 0:02:46 224500 -- [-2521.386] (-2516.940) (-2518.071) (-2519.193) * [-2526.325] (-2522.332) (-2524.892) (-2527.998) -- 0:02:45 225000 -- [-2516.653] (-2516.635) (-2520.153) (-2519.978) * (-2523.005) (-2516.595) (-2520.485) [-2523.456] -- 0:02:45 Average standard deviation of split frequencies: 0.000000 225500 -- [-2520.583] (-2521.491) (-2522.110) (-2521.508) * (-2520.472) (-2523.952) (-2521.699) [-2523.270] -- 0:02:44 226000 -- [-2516.188] (-2518.269) (-2518.005) (-2524.239) * [-2521.259] (-2520.420) (-2522.050) (-2521.614) -- 0:02:44 226500 -- (-2521.636) (-2522.437) [-2526.789] (-2523.625) * (-2526.148) (-2524.479) [-2517.937] (-2523.755) -- 0:02:43 227000 -- (-2515.660) (-2516.469) [-2523.405] (-2521.512) * (-2527.789) [-2521.895] (-2519.843) (-2524.949) -- 0:02:46 227500 -- (-2519.136) (-2522.225) (-2520.006) [-2521.504] * (-2528.480) [-2524.970] (-2519.894) (-2525.412) -- 0:02:46 228000 -- (-2523.481) (-2523.823) (-2522.033) [-2526.244] * [-2530.789] (-2523.580) (-2526.158) (-2519.744) -- 0:02:45 228500 -- [-2517.703] (-2520.365) (-2523.074) (-2524.241) * (-2527.257) [-2519.254] (-2527.027) (-2519.524) -- 0:02:45 229000 -- (-2520.517) (-2522.054) [-2527.511] (-2526.598) * (-2527.340) [-2522.142] (-2518.230) (-2520.638) -- 0:02:44 229500 -- (-2520.349) (-2521.085) (-2520.657) [-2519.809] * (-2532.802) (-2523.826) (-2525.359) [-2524.156] -- 0:02:44 230000 -- (-2526.704) (-2523.422) (-2520.113) [-2522.818] * (-2522.364) (-2516.726) [-2524.803] (-2519.764) -- 0:02:44 Average standard deviation of split frequencies: 0.000000 230500 -- (-2521.716) [-2522.261] (-2518.829) (-2521.499) * (-2526.648) (-2518.105) [-2524.015] (-2519.956) -- 0:02:43 231000 -- (-2522.592) [-2518.084] (-2523.177) (-2520.958) * (-2523.053) (-2526.845) (-2525.525) [-2523.042] -- 0:02:43 231500 -- (-2524.730) (-2524.388) [-2518.841] (-2524.885) * [-2517.696] (-2522.064) (-2518.629) (-2524.622) -- 0:02:45 232000 -- (-2526.055) (-2524.390) (-2518.238) [-2520.492] * (-2521.170) [-2519.404] (-2518.740) (-2522.020) -- 0:02:45 232500 -- (-2523.658) [-2521.348] (-2521.732) (-2526.887) * (-2527.861) (-2528.159) [-2518.287] (-2522.058) -- 0:02:45 233000 -- [-2522.166] (-2524.577) (-2521.188) (-2524.301) * (-2528.502) (-2520.317) [-2518.811] (-2520.647) -- 0:02:44 233500 -- (-2519.958) (-2518.471) (-2525.594) [-2518.797] * (-2531.849) [-2522.678] (-2521.371) (-2528.236) -- 0:02:44 234000 -- (-2523.173) [-2517.985] (-2521.293) (-2519.462) * (-2521.287) (-2521.642) [-2520.882] (-2522.806) -- 0:02:43 234500 -- (-2520.249) [-2523.574] (-2519.898) (-2526.883) * (-2518.383) (-2521.993) [-2524.189] (-2524.488) -- 0:02:43 235000 -- [-2517.149] (-2521.104) (-2517.931) (-2525.086) * (-2519.636) (-2519.263) (-2524.063) [-2524.833] -- 0:02:42 Average standard deviation of split frequencies: 0.000000 235500 -- [-2524.120] (-2520.882) (-2521.051) (-2527.787) * [-2516.692] (-2515.658) (-2523.744) (-2521.932) -- 0:02:42 236000 -- (-2521.216) (-2525.443) (-2524.281) [-2523.339] * (-2518.896) (-2523.697) (-2519.791) [-2518.410] -- 0:02:45 236500 -- (-2522.854) [-2521.377] (-2533.068) (-2518.078) * (-2521.167) (-2523.198) (-2520.756) [-2523.350] -- 0:02:44 237000 -- [-2523.368] (-2524.390) (-2526.927) (-2526.098) * [-2518.802] (-2522.228) (-2521.962) (-2525.122) -- 0:02:44 237500 -- (-2518.011) (-2526.266) [-2523.549] (-2524.791) * (-2522.570) [-2516.696] (-2525.638) (-2516.757) -- 0:02:43 238000 -- (-2520.858) (-2524.137) [-2522.415] (-2517.356) * (-2523.431) (-2527.061) (-2520.962) [-2519.408] -- 0:02:43 238500 -- (-2521.482) [-2520.239] (-2522.744) (-2520.972) * (-2520.814) (-2517.281) (-2514.948) [-2521.608] -- 0:02:42 239000 -- (-2518.109) [-2527.681] (-2520.947) (-2523.685) * (-2526.368) (-2518.257) [-2517.846] (-2519.039) -- 0:02:42 239500 -- (-2522.683) (-2523.735) (-2527.958) [-2523.062] * (-2521.702) (-2522.263) [-2519.323] (-2523.458) -- 0:02:41 240000 -- (-2517.468) [-2520.291] (-2524.351) (-2520.868) * (-2527.883) (-2524.307) (-2521.837) [-2519.692] -- 0:02:41 Average standard deviation of split frequencies: 0.000000 240500 -- (-2526.476) (-2525.251) (-2524.195) [-2521.503] * (-2521.431) (-2520.209) (-2519.472) [-2520.758] -- 0:02:44 241000 -- (-2527.314) [-2521.691] (-2531.005) (-2519.853) * (-2523.624) (-2519.826) (-2519.319) [-2519.494] -- 0:02:43 241500 -- (-2524.787) [-2520.403] (-2523.046) (-2523.445) * [-2517.033] (-2522.903) (-2520.971) (-2521.512) -- 0:02:43 242000 -- (-2523.560) [-2528.353] (-2522.225) (-2522.907) * (-2516.742) (-2521.208) [-2525.335] (-2521.602) -- 0:02:42 242500 -- [-2515.616] (-2522.328) (-2519.089) (-2520.164) * (-2520.195) (-2523.829) [-2522.000] (-2523.996) -- 0:02:42 243000 -- (-2522.951) [-2523.974] (-2523.123) (-2527.975) * (-2519.235) (-2520.699) (-2528.837) [-2518.760] -- 0:02:41 243500 -- [-2521.152] (-2527.193) (-2520.396) (-2518.654) * (-2526.411) (-2520.385) (-2530.618) [-2520.211] -- 0:02:41 244000 -- (-2522.503) [-2521.949] (-2519.607) (-2520.960) * (-2517.049) (-2529.528) [-2521.624] (-2520.785) -- 0:02:41 244500 -- (-2522.271) (-2523.008) [-2520.511] (-2520.354) * (-2519.229) (-2523.826) [-2520.321] (-2524.173) -- 0:02:40 245000 -- (-2522.815) (-2519.154) (-2521.855) [-2524.805] * [-2519.048] (-2527.374) (-2527.149) (-2519.230) -- 0:02:40 Average standard deviation of split frequencies: 0.000000 245500 -- (-2526.787) (-2521.806) (-2518.792) [-2521.809] * [-2518.251] (-2520.471) (-2517.627) (-2517.765) -- 0:02:42 246000 -- [-2527.510] (-2523.919) (-2523.850) (-2518.401) * (-2522.336) (-2517.369) [-2519.475] (-2522.307) -- 0:02:42 246500 -- (-2524.960) (-2516.725) (-2523.174) [-2521.616] * (-2520.701) [-2519.680] (-2525.374) (-2517.900) -- 0:02:42 247000 -- (-2517.227) (-2520.678) [-2518.520] (-2519.053) * [-2519.021] (-2520.052) (-2522.681) (-2519.411) -- 0:02:41 247500 -- [-2520.676] (-2520.823) (-2522.314) (-2524.190) * (-2521.011) [-2518.069] (-2522.031) (-2523.863) -- 0:02:41 248000 -- (-2526.865) (-2525.474) [-2518.133] (-2522.876) * (-2531.159) (-2521.558) [-2519.505] (-2525.692) -- 0:02:40 248500 -- (-2524.243) [-2517.802] (-2516.770) (-2524.578) * (-2525.859) [-2519.646] (-2519.775) (-2522.307) -- 0:02:40 249000 -- (-2527.983) (-2520.518) [-2517.311] (-2520.262) * (-2521.933) (-2518.997) (-2525.508) [-2521.385] -- 0:02:39 249500 -- (-2525.692) (-2520.825) [-2520.669] (-2520.562) * (-2521.928) (-2517.021) [-2520.013] (-2517.705) -- 0:02:39 250000 -- [-2517.022] (-2517.580) (-2524.541) (-2521.144) * (-2523.942) [-2524.507] (-2527.500) (-2524.669) -- 0:02:42 Average standard deviation of split frequencies: 0.000000 250500 -- (-2523.080) [-2518.619] (-2517.399) (-2525.906) * (-2522.974) [-2517.790] (-2521.478) (-2518.114) -- 0:02:41 251000 -- (-2524.505) (-2521.962) [-2519.379] (-2525.120) * (-2518.071) [-2521.820] (-2522.499) (-2521.948) -- 0:02:41 251500 -- (-2518.387) (-2524.948) [-2517.843] (-2518.583) * (-2518.463) (-2524.013) (-2519.061) [-2518.701] -- 0:02:40 252000 -- (-2528.877) [-2516.225] (-2526.679) (-2519.564) * (-2522.859) (-2519.178) [-2522.883] (-2517.356) -- 0:02:40 252500 -- (-2522.246) (-2523.154) (-2527.188) [-2515.855] * [-2522.971] (-2520.989) (-2518.942) (-2528.358) -- 0:02:39 253000 -- [-2529.286] (-2520.829) (-2531.580) (-2523.279) * (-2525.250) [-2523.109] (-2521.222) (-2528.481) -- 0:02:39 253500 -- (-2522.048) (-2516.450) (-2528.818) [-2516.609] * (-2518.588) [-2522.155] (-2520.765) (-2521.777) -- 0:02:39 254000 -- (-2521.884) [-2520.337] (-2525.991) (-2516.933) * (-2522.073) [-2520.267] (-2525.745) (-2527.433) -- 0:02:38 254500 -- (-2523.006) [-2519.774] (-2522.336) (-2522.094) * [-2520.509] (-2522.323) (-2517.030) (-2527.727) -- 0:02:41 255000 -- [-2517.749] (-2526.173) (-2520.596) (-2518.980) * (-2518.515) (-2526.651) [-2518.441] (-2531.142) -- 0:02:40 Average standard deviation of split frequencies: 0.000000 255500 -- [-2524.803] (-2517.927) (-2526.929) (-2525.230) * (-2521.811) (-2527.975) (-2517.838) [-2520.694] -- 0:02:40 256000 -- (-2518.636) [-2520.890] (-2521.806) (-2519.868) * [-2520.665] (-2527.649) (-2518.791) (-2522.239) -- 0:02:39 256500 -- (-2525.313) (-2524.826) (-2520.794) [-2521.203] * (-2521.048) (-2521.834) (-2518.718) [-2517.558] -- 0:02:39 257000 -- [-2517.856] (-2530.305) (-2523.033) (-2524.202) * (-2517.989) [-2524.271] (-2524.356) (-2519.342) -- 0:02:39 257500 -- (-2520.842) (-2521.706) [-2524.602] (-2520.087) * [-2518.551] (-2519.320) (-2527.158) (-2518.707) -- 0:02:38 258000 -- (-2522.016) (-2521.782) [-2521.598] (-2526.230) * (-2519.948) (-2525.443) [-2525.007] (-2523.331) -- 0:02:38 258500 -- (-2520.190) [-2522.656] (-2520.562) (-2525.219) * [-2521.126] (-2521.538) (-2532.813) (-2520.882) -- 0:02:37 259000 -- (-2520.424) [-2532.706] (-2528.050) (-2526.331) * [-2518.940] (-2519.536) (-2521.235) (-2521.296) -- 0:02:37 259500 -- [-2518.318] (-2522.098) (-2526.465) (-2522.328) * (-2518.684) (-2522.150) (-2526.541) [-2521.774] -- 0:02:39 260000 -- (-2517.433) (-2527.258) (-2532.892) [-2524.201] * (-2516.330) (-2524.283) (-2517.986) [-2520.521] -- 0:02:39 Average standard deviation of split frequencies: 0.000000 260500 -- (-2523.587) (-2524.055) [-2527.696] (-2521.541) * (-2518.417) (-2522.140) [-2524.888] (-2517.630) -- 0:02:38 261000 -- (-2520.873) (-2524.509) [-2523.631] (-2515.934) * (-2522.173) (-2518.075) (-2519.334) [-2523.882] -- 0:02:38 261500 -- [-2521.887] (-2524.677) (-2522.291) (-2522.579) * [-2517.005] (-2526.896) (-2517.114) (-2520.241) -- 0:02:38 262000 -- (-2524.926) (-2523.325) (-2518.046) [-2521.558] * [-2517.117] (-2522.129) (-2520.894) (-2518.991) -- 0:02:37 262500 -- (-2526.655) (-2522.323) [-2524.138] (-2524.133) * (-2522.602) (-2525.273) [-2520.067] (-2521.523) -- 0:02:37 263000 -- (-2526.682) (-2523.578) [-2518.980] (-2521.056) * [-2517.913] (-2529.827) (-2521.534) (-2522.567) -- 0:02:36 263500 -- [-2521.714] (-2525.546) (-2521.251) (-2517.384) * [-2516.463] (-2522.658) (-2523.971) (-2517.960) -- 0:02:36 264000 -- [-2516.980] (-2518.305) (-2526.046) (-2526.673) * (-2523.630) [-2522.815] (-2519.030) (-2526.163) -- 0:02:38 264500 -- (-2521.835) [-2519.759] (-2519.264) (-2526.481) * (-2522.337) (-2523.681) (-2517.622) [-2517.603] -- 0:02:38 265000 -- [-2517.731] (-2524.341) (-2522.171) (-2516.437) * (-2526.605) (-2522.622) (-2517.623) [-2520.716] -- 0:02:38 Average standard deviation of split frequencies: 0.000000 265500 -- [-2524.518] (-2520.059) (-2521.894) (-2519.546) * (-2516.212) [-2522.147] (-2520.420) (-2529.420) -- 0:02:37 266000 -- (-2518.873) (-2519.287) (-2525.162) [-2517.114] * (-2518.434) [-2521.528] (-2529.694) (-2529.928) -- 0:02:37 266500 -- [-2520.196] (-2522.165) (-2522.389) (-2525.509) * [-2522.485] (-2523.030) (-2525.427) (-2526.154) -- 0:02:36 267000 -- [-2514.994] (-2524.248) (-2526.973) (-2522.844) * (-2520.578) [-2518.721] (-2518.743) (-2529.939) -- 0:02:36 267500 -- (-2521.681) [-2525.280] (-2520.403) (-2528.293) * [-2522.694] (-2521.164) (-2523.302) (-2521.172) -- 0:02:36 268000 -- [-2524.429] (-2526.288) (-2518.351) (-2520.668) * (-2521.301) (-2519.278) [-2523.857] (-2518.769) -- 0:02:35 268500 -- (-2522.995) [-2521.335] (-2517.701) (-2524.305) * (-2520.459) (-2519.581) [-2517.574] (-2517.857) -- 0:02:38 269000 -- (-2518.695) (-2516.513) (-2522.902) [-2522.836] * (-2517.093) [-2518.359] (-2523.847) (-2523.735) -- 0:02:37 269500 -- (-2522.095) [-2522.754] (-2523.188) (-2516.973) * (-2517.728) (-2517.252) [-2521.199] (-2519.388) -- 0:02:37 270000 -- [-2519.902] (-2518.296) (-2520.782) (-2519.917) * [-2519.689] (-2517.551) (-2518.760) (-2520.979) -- 0:02:36 Average standard deviation of split frequencies: 0.000000 270500 -- (-2520.342) (-2519.847) (-2523.061) [-2519.421] * [-2516.848] (-2523.474) (-2518.191) (-2523.575) -- 0:02:36 271000 -- [-2517.234] (-2516.639) (-2522.705) (-2520.139) * (-2521.406) (-2518.301) [-2517.895] (-2528.042) -- 0:02:36 271500 -- (-2519.921) (-2516.257) (-2531.251) [-2517.499] * (-2529.940) [-2518.702] (-2518.957) (-2518.586) -- 0:02:35 272000 -- (-2520.186) [-2521.879] (-2517.644) (-2518.432) * (-2524.533) (-2531.082) (-2523.585) [-2519.584] -- 0:02:35 272500 -- (-2525.959) [-2523.242] (-2524.507) (-2517.953) * (-2516.750) (-2524.570) (-2525.530) [-2519.654] -- 0:02:34 273000 -- (-2526.331) (-2521.823) [-2516.652] (-2522.248) * [-2516.688] (-2515.813) (-2519.897) (-2520.213) -- 0:02:37 273500 -- (-2520.322) [-2521.033] (-2522.253) (-2519.936) * [-2516.778] (-2523.179) (-2520.042) (-2519.762) -- 0:02:36 274000 -- [-2520.254] (-2530.050) (-2524.731) (-2525.626) * (-2522.034) [-2521.941] (-2521.369) (-2523.154) -- 0:02:36 274500 -- (-2521.158) (-2538.641) [-2519.359] (-2521.785) * (-2521.418) (-2520.159) (-2520.855) [-2518.875] -- 0:02:35 275000 -- (-2522.086) [-2526.320] (-2525.047) (-2524.739) * (-2526.253) (-2518.938) [-2518.213] (-2526.132) -- 0:02:35 Average standard deviation of split frequencies: 0.000000 275500 -- (-2524.663) (-2527.451) [-2518.452] (-2522.272) * (-2535.224) [-2520.944] (-2535.035) (-2522.801) -- 0:02:35 276000 -- [-2517.384] (-2523.823) (-2527.424) (-2523.582) * (-2518.110) (-2525.605) (-2521.064) [-2524.627] -- 0:02:34 276500 -- [-2516.290] (-2527.341) (-2527.249) (-2517.754) * [-2523.518] (-2526.687) (-2520.796) (-2525.953) -- 0:02:34 277000 -- [-2526.798] (-2524.259) (-2520.716) (-2531.500) * [-2523.399] (-2520.727) (-2524.457) (-2519.193) -- 0:02:33 277500 -- (-2518.141) [-2522.524] (-2526.467) (-2528.728) * [-2521.517] (-2520.887) (-2523.788) (-2521.678) -- 0:02:33 278000 -- [-2524.637] (-2519.495) (-2520.627) (-2524.806) * [-2517.291] (-2530.150) (-2522.313) (-2527.954) -- 0:02:35 278500 -- [-2521.020] (-2523.826) (-2518.481) (-2519.851) * [-2515.425] (-2530.190) (-2523.292) (-2520.941) -- 0:02:35 279000 -- (-2518.015) [-2526.470] (-2527.219) (-2528.609) * (-2524.021) (-2522.403) (-2522.362) [-2518.765] -- 0:02:35 279500 -- (-2516.009) (-2529.743) (-2529.218) [-2518.478] * [-2519.947] (-2523.942) (-2522.997) (-2523.574) -- 0:02:34 280000 -- [-2521.675] (-2522.584) (-2526.982) (-2524.036) * (-2528.888) (-2527.165) [-2520.240] (-2527.863) -- 0:02:34 Average standard deviation of split frequencies: 0.000000 280500 -- [-2518.342] (-2528.322) (-2523.670) (-2519.904) * [-2524.497] (-2521.001) (-2520.416) (-2522.630) -- 0:02:33 281000 -- (-2524.693) [-2533.390] (-2526.468) (-2518.036) * (-2524.094) (-2516.410) [-2523.732] (-2525.315) -- 0:02:33 281500 -- (-2525.162) (-2531.775) [-2522.481] (-2520.797) * (-2518.344) (-2515.570) [-2522.254] (-2522.806) -- 0:02:33 282000 -- (-2517.874) (-2524.935) (-2521.018) [-2522.017] * [-2515.538] (-2519.590) (-2524.090) (-2517.400) -- 0:02:32 282500 -- [-2518.998] (-2533.711) (-2522.445) (-2522.481) * [-2520.405] (-2523.389) (-2523.507) (-2525.517) -- 0:02:34 283000 -- (-2519.978) [-2517.586] (-2530.053) (-2521.063) * [-2519.268] (-2518.900) (-2527.762) (-2519.226) -- 0:02:34 283500 -- (-2530.349) (-2521.274) (-2527.408) [-2522.153] * [-2518.585] (-2519.145) (-2523.948) (-2526.337) -- 0:02:34 284000 -- (-2527.001) (-2530.062) (-2524.441) [-2520.698] * (-2521.206) [-2517.841] (-2520.242) (-2521.029) -- 0:02:33 284500 -- (-2519.253) (-2530.090) (-2530.364) [-2517.957] * (-2517.531) [-2520.528] (-2520.721) (-2521.686) -- 0:02:33 285000 -- (-2519.397) (-2530.343) (-2520.627) [-2521.800] * (-2520.518) [-2522.130] (-2520.067) (-2519.368) -- 0:02:33 Average standard deviation of split frequencies: 0.000000 285500 -- [-2517.339] (-2532.397) (-2525.866) (-2518.921) * (-2516.800) (-2519.622) (-2521.299) [-2518.613] -- 0:02:32 286000 -- (-2520.847) (-2527.636) [-2521.337] (-2518.313) * (-2519.655) (-2520.281) [-2525.528] (-2520.667) -- 0:02:32 286500 -- (-2525.089) [-2523.415] (-2526.592) (-2525.110) * (-2527.449) (-2524.245) (-2519.123) [-2516.296] -- 0:02:31 287000 -- [-2520.703] (-2523.268) (-2517.824) (-2528.550) * [-2520.216] (-2524.665) (-2520.860) (-2523.868) -- 0:02:34 287500 -- [-2517.188] (-2521.482) (-2521.134) (-2526.289) * (-2520.464) (-2529.973) [-2520.135] (-2519.294) -- 0:02:33 288000 -- (-2517.466) (-2524.074) (-2528.994) [-2520.760] * [-2520.590] (-2520.083) (-2524.515) (-2527.355) -- 0:02:33 288500 -- (-2519.604) (-2521.757) [-2518.389] (-2521.133) * [-2527.881] (-2524.087) (-2527.049) (-2518.761) -- 0:02:32 289000 -- [-2518.403] (-2523.894) (-2525.461) (-2523.889) * (-2530.947) (-2525.693) [-2526.821] (-2520.061) -- 0:02:32 289500 -- [-2520.860] (-2526.591) (-2521.194) (-2522.470) * (-2519.498) (-2520.634) (-2519.852) [-2522.154] -- 0:02:32 290000 -- [-2522.525] (-2523.599) (-2527.419) (-2520.496) * (-2523.486) (-2517.599) [-2518.215] (-2520.796) -- 0:02:31 Average standard deviation of split frequencies: 0.000000 290500 -- (-2519.947) (-2524.906) [-2521.169] (-2520.860) * (-2526.318) [-2520.831] (-2525.778) (-2520.898) -- 0:02:31 291000 -- [-2517.275] (-2520.965) (-2524.337) (-2530.782) * (-2530.863) (-2525.114) (-2518.215) [-2526.615] -- 0:02:31 291500 -- [-2515.665] (-2527.995) (-2524.398) (-2517.316) * [-2522.552] (-2518.561) (-2518.046) (-2520.675) -- 0:02:33 292000 -- (-2525.565) (-2530.339) (-2519.992) [-2514.666] * (-2520.970) [-2523.218] (-2524.442) (-2519.908) -- 0:02:32 292500 -- (-2520.142) [-2520.353] (-2518.885) (-2524.881) * [-2522.659] (-2524.274) (-2527.270) (-2528.005) -- 0:02:32 293000 -- (-2524.444) (-2521.943) (-2520.440) [-2519.736] * [-2522.823] (-2522.085) (-2524.035) (-2525.341) -- 0:02:32 293500 -- (-2525.292) [-2518.161] (-2525.014) (-2526.532) * (-2526.325) (-2520.340) (-2515.537) [-2523.412] -- 0:02:31 294000 -- (-2524.011) (-2520.295) (-2518.232) [-2516.838] * (-2533.841) [-2518.406] (-2521.546) (-2529.873) -- 0:02:31 294500 -- (-2521.377) (-2519.760) (-2520.490) [-2518.309] * (-2528.596) (-2519.524) [-2517.032] (-2524.730) -- 0:02:30 295000 -- (-2519.707) (-2522.186) [-2523.845] (-2521.280) * (-2526.673) (-2522.293) (-2518.943) [-2523.294] -- 0:02:30 Average standard deviation of split frequencies: 0.000000 295500 -- (-2520.760) (-2522.233) [-2519.000] (-2527.193) * (-2523.963) (-2524.457) (-2530.425) [-2516.867] -- 0:02:30 296000 -- (-2532.444) (-2526.695) [-2517.777] (-2522.542) * [-2515.309] (-2522.889) (-2522.204) (-2523.111) -- 0:02:32 296500 -- (-2524.666) (-2524.471) (-2520.051) [-2522.362] * (-2519.169) (-2518.060) (-2523.934) [-2525.703] -- 0:02:31 297000 -- (-2522.427) [-2519.863] (-2520.858) (-2525.839) * [-2521.267] (-2517.734) (-2521.820) (-2520.303) -- 0:02:31 297500 -- (-2525.380) [-2518.325] (-2518.550) (-2522.351) * (-2529.420) (-2523.629) [-2515.564] (-2517.851) -- 0:02:31 298000 -- [-2521.228] (-2525.913) (-2518.387) (-2521.732) * (-2528.152) [-2518.178] (-2521.096) (-2517.538) -- 0:02:30 298500 -- (-2523.900) (-2521.878) (-2519.791) [-2518.480] * [-2527.057] (-2519.989) (-2520.102) (-2520.588) -- 0:02:30 299000 -- (-2524.131) (-2520.063) [-2521.013] (-2523.421) * (-2519.439) (-2515.014) (-2517.759) [-2519.998] -- 0:02:30 299500 -- (-2519.586) [-2520.416] (-2524.018) (-2522.388) * (-2526.120) (-2515.711) (-2517.025) [-2521.101] -- 0:02:29 300000 -- (-2516.145) [-2524.899] (-2525.739) (-2522.240) * [-2519.498] (-2525.831) (-2524.700) (-2530.326) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 300500 -- (-2521.625) (-2521.951) (-2522.786) [-2517.268] * (-2526.778) [-2518.452] (-2527.541) (-2523.548) -- 0:02:28 301000 -- (-2523.139) (-2522.884) [-2520.845] (-2518.198) * [-2519.907] (-2517.480) (-2522.922) (-2521.182) -- 0:02:30 301500 -- (-2518.874) [-2523.428] (-2520.869) (-2522.403) * [-2522.526] (-2518.656) (-2522.470) (-2515.893) -- 0:02:30 302000 -- (-2520.164) (-2523.302) [-2518.890] (-2520.057) * (-2518.765) (-2523.360) (-2525.390) [-2518.455] -- 0:02:30 302500 -- (-2521.240) (-2522.216) [-2523.822] (-2519.560) * (-2522.015) [-2521.828] (-2527.068) (-2523.986) -- 0:02:29 303000 -- (-2518.364) (-2522.602) [-2519.801] (-2519.437) * [-2519.294] (-2519.798) (-2520.404) (-2523.129) -- 0:02:29 303500 -- [-2519.428] (-2525.295) (-2518.705) (-2521.137) * (-2516.066) [-2521.513] (-2522.120) (-2519.680) -- 0:02:29 304000 -- (-2525.854) (-2526.919) [-2522.039] (-2522.046) * [-2519.368] (-2524.204) (-2521.589) (-2530.513) -- 0:02:28 304500 -- (-2519.844) (-2520.724) (-2524.972) [-2520.615] * (-2522.892) (-2520.979) [-2517.811] (-2522.636) -- 0:02:28 305000 -- [-2521.112] (-2522.672) (-2516.362) (-2523.068) * (-2519.277) [-2520.848] (-2523.360) (-2521.977) -- 0:02:28 Average standard deviation of split frequencies: 0.000000 305500 -- [-2521.735] (-2519.109) (-2521.468) (-2519.647) * (-2524.412) (-2520.919) [-2527.165] (-2521.816) -- 0:02:30 306000 -- (-2523.014) (-2524.397) [-2521.008] (-2527.593) * (-2528.420) (-2518.628) [-2522.129] (-2523.409) -- 0:02:29 306500 -- [-2519.727] (-2524.172) (-2516.974) (-2524.002) * (-2518.761) [-2519.824] (-2526.368) (-2522.875) -- 0:02:29 307000 -- (-2522.576) (-2524.320) [-2519.669] (-2525.152) * (-2522.811) [-2519.381] (-2523.348) (-2533.276) -- 0:02:28 307500 -- (-2521.041) (-2525.154) (-2519.050) [-2519.405] * (-2525.676) [-2521.433] (-2525.520) (-2525.198) -- 0:02:28 308000 -- (-2520.317) [-2517.982] (-2528.821) (-2518.160) * (-2522.389) (-2518.236) (-2521.897) [-2525.085] -- 0:02:28 308500 -- (-2528.948) [-2525.781] (-2521.287) (-2519.387) * (-2523.465) [-2524.215] (-2524.989) (-2530.129) -- 0:02:27 309000 -- (-2532.166) (-2522.789) (-2518.466) [-2519.734] * (-2527.583) (-2525.219) (-2524.226) [-2527.438] -- 0:02:27 309500 -- (-2527.518) (-2520.546) [-2515.733] (-2516.180) * (-2520.003) (-2518.271) [-2524.004] (-2521.572) -- 0:02:27 310000 -- (-2521.320) (-2525.751) (-2518.427) [-2517.837] * [-2525.539] (-2519.904) (-2520.925) (-2526.229) -- 0:02:29 Average standard deviation of split frequencies: 0.000000 310500 -- (-2522.773) (-2520.969) (-2526.219) [-2520.202] * (-2525.156) (-2523.588) [-2520.983] (-2519.903) -- 0:02:28 311000 -- [-2517.749] (-2519.377) (-2522.392) (-2521.019) * (-2521.691) (-2520.255) (-2518.362) [-2517.646] -- 0:02:28 311500 -- [-2518.340] (-2521.701) (-2523.944) (-2520.121) * (-2522.729) (-2520.494) (-2520.055) [-2517.707] -- 0:02:28 312000 -- [-2518.795] (-2524.071) (-2519.920) (-2517.264) * (-2528.131) [-2526.378] (-2520.849) (-2522.708) -- 0:02:27 312500 -- (-2521.300) [-2521.582] (-2517.317) (-2518.442) * (-2530.357) (-2520.629) [-2516.967] (-2517.895) -- 0:02:27 313000 -- [-2517.367] (-2518.515) (-2525.620) (-2522.277) * (-2520.474) (-2522.056) [-2519.952] (-2521.021) -- 0:02:27 313500 -- [-2519.721] (-2519.779) (-2527.246) (-2522.575) * (-2526.580) (-2519.812) [-2520.123] (-2520.131) -- 0:02:26 314000 -- (-2521.693) (-2518.545) [-2520.743] (-2519.587) * (-2522.613) (-2522.456) (-2522.140) [-2520.464] -- 0:02:26 314500 -- (-2518.321) (-2522.348) (-2517.806) [-2521.730] * (-2521.910) (-2519.749) (-2522.478) [-2523.764] -- 0:02:28 315000 -- (-2521.551) [-2519.160] (-2520.639) (-2522.133) * (-2516.966) [-2528.677] (-2524.841) (-2521.887) -- 0:02:27 Average standard deviation of split frequencies: 0.000000 315500 -- [-2519.064] (-2521.219) (-2521.836) (-2527.976) * (-2518.309) (-2524.910) (-2525.154) [-2524.364] -- 0:02:27 316000 -- [-2521.410] (-2526.037) (-2520.408) (-2530.161) * [-2524.658] (-2525.448) (-2520.662) (-2518.907) -- 0:02:27 316500 -- (-2521.983) (-2527.147) (-2524.976) [-2521.544] * [-2519.384] (-2523.606) (-2517.071) (-2521.757) -- 0:02:26 317000 -- (-2522.428) (-2520.614) (-2530.957) [-2524.242] * [-2525.131] (-2525.879) (-2515.999) (-2523.875) -- 0:02:26 317500 -- (-2519.833) (-2522.991) [-2522.674] (-2522.504) * (-2530.177) (-2527.625) [-2517.986] (-2519.478) -- 0:02:26 318000 -- (-2518.635) (-2530.935) (-2517.921) [-2519.488] * [-2521.263] (-2524.325) (-2518.250) (-2523.842) -- 0:02:25 318500 -- (-2528.153) (-2524.836) [-2524.998] (-2523.720) * (-2522.507) (-2521.193) (-2520.600) [-2518.771] -- 0:02:25 319000 -- (-2521.484) [-2520.781] (-2522.733) (-2523.361) * (-2529.943) (-2521.548) (-2518.553) [-2522.450] -- 0:02:27 319500 -- (-2528.024) (-2521.201) (-2524.515) [-2518.104] * (-2526.562) (-2524.351) (-2523.740) [-2521.586] -- 0:02:26 320000 -- (-2518.590) (-2520.048) (-2520.968) [-2524.453] * [-2527.585] (-2526.993) (-2520.375) (-2524.102) -- 0:02:26 Average standard deviation of split frequencies: 0.000000 320500 -- (-2523.002) [-2518.142] (-2514.535) (-2518.196) * [-2525.745] (-2516.694) (-2519.935) (-2519.968) -- 0:02:26 321000 -- (-2523.870) (-2517.472) (-2522.044) [-2518.064] * (-2525.469) [-2519.611] (-2533.778) (-2524.493) -- 0:02:25 321500 -- (-2522.110) (-2518.662) (-2522.962) [-2519.854] * [-2524.355] (-2522.214) (-2519.739) (-2522.392) -- 0:02:25 322000 -- (-2521.210) [-2519.133] (-2522.725) (-2533.875) * (-2519.178) (-2526.039) [-2520.589] (-2534.258) -- 0:02:25 322500 -- (-2530.515) (-2518.194) [-2521.677] (-2521.071) * (-2517.012) (-2524.789) [-2516.818] (-2522.649) -- 0:02:24 323000 -- (-2525.897) (-2520.908) [-2522.445] (-2518.460) * [-2524.397] (-2524.777) (-2516.365) (-2518.054) -- 0:02:24 323500 -- (-2519.538) [-2516.492] (-2521.723) (-2520.270) * [-2519.139] (-2518.741) (-2519.813) (-2526.523) -- 0:02:24 324000 -- [-2521.199] (-2521.598) (-2519.575) (-2525.253) * [-2519.590] (-2519.468) (-2520.889) (-2521.953) -- 0:02:26 324500 -- [-2525.733] (-2522.689) (-2520.519) (-2520.282) * (-2517.511) [-2520.085] (-2520.799) (-2533.421) -- 0:02:25 325000 -- [-2522.258] (-2517.833) (-2521.253) (-2522.086) * (-2519.335) [-2516.545] (-2526.167) (-2528.764) -- 0:02:25 Average standard deviation of split frequencies: 0.000000 325500 -- (-2521.886) [-2518.710] (-2522.142) (-2523.489) * [-2521.453] (-2521.690) (-2518.568) (-2522.058) -- 0:02:25 326000 -- (-2526.546) [-2520.331] (-2531.549) (-2527.080) * (-2520.439) (-2522.102) [-2518.215] (-2521.892) -- 0:02:24 326500 -- (-2524.759) (-2526.484) [-2523.828] (-2528.143) * [-2520.677] (-2524.570) (-2521.547) (-2521.836) -- 0:02:24 327000 -- (-2522.040) (-2522.650) (-2521.221) [-2516.773] * (-2525.430) (-2532.755) [-2520.878] (-2517.557) -- 0:02:24 327500 -- (-2519.380) [-2524.528] (-2519.657) (-2524.537) * (-2527.990) (-2532.101) [-2522.735] (-2522.318) -- 0:02:23 328000 -- [-2526.834] (-2522.595) (-2524.016) (-2528.038) * (-2521.338) (-2525.635) [-2522.875] (-2521.941) -- 0:02:23 328500 -- [-2521.959] (-2515.273) (-2523.827) (-2516.428) * (-2519.528) (-2526.088) [-2519.304] (-2523.325) -- 0:02:25 329000 -- [-2523.221] (-2520.176) (-2521.429) (-2530.335) * (-2520.535) (-2521.294) (-2519.549) [-2519.001] -- 0:02:24 329500 -- (-2517.456) (-2519.473) [-2517.224] (-2520.410) * [-2522.368] (-2525.137) (-2519.274) (-2520.469) -- 0:02:24 330000 -- (-2518.736) [-2522.497] (-2527.428) (-2519.984) * (-2516.597) (-2523.805) [-2520.839] (-2524.783) -- 0:02:24 Average standard deviation of split frequencies: 0.000000 330500 -- (-2523.472) [-2522.479] (-2528.483) (-2524.368) * [-2519.489] (-2522.985) (-2518.812) (-2518.321) -- 0:02:23 331000 -- (-2522.170) (-2518.320) (-2526.187) [-2517.700] * [-2524.852] (-2518.274) (-2521.285) (-2519.383) -- 0:02:23 331500 -- (-2519.964) (-2518.014) (-2527.396) [-2522.061] * (-2518.995) (-2516.720) [-2520.912] (-2519.862) -- 0:02:23 332000 -- [-2515.999] (-2519.185) (-2528.314) (-2524.417) * [-2516.261] (-2515.826) (-2519.549) (-2525.548) -- 0:02:22 332500 -- (-2529.125) [-2517.879] (-2520.009) (-2517.672) * [-2521.156] (-2519.405) (-2519.173) (-2523.058) -- 0:02:22 333000 -- (-2523.182) [-2518.218] (-2521.419) (-2514.384) * [-2517.269] (-2524.076) (-2524.532) (-2531.735) -- 0:02:24 333500 -- (-2520.773) (-2516.490) (-2520.305) [-2520.976] * [-2526.815] (-2521.915) (-2521.383) (-2526.095) -- 0:02:23 334000 -- [-2520.026] (-2520.134) (-2523.849) (-2523.438) * (-2519.849) (-2522.986) (-2517.498) [-2522.468] -- 0:02:23 334500 -- (-2517.976) (-2519.706) [-2526.550] (-2521.556) * (-2524.737) (-2517.872) [-2524.631] (-2526.040) -- 0:02:23 335000 -- (-2522.331) (-2518.394) [-2523.619] (-2522.129) * (-2520.461) (-2513.749) (-2525.664) [-2517.461] -- 0:02:22 Average standard deviation of split frequencies: 0.000000 335500 -- (-2522.825) [-2521.306] (-2528.620) (-2519.762) * (-2524.653) (-2518.337) (-2520.086) [-2514.857] -- 0:02:22 336000 -- (-2528.854) (-2520.065) [-2523.652] (-2522.637) * (-2522.996) (-2522.544) (-2518.511) [-2519.882] -- 0:02:22 336500 -- (-2524.330) (-2521.394) [-2519.266] (-2529.079) * [-2518.285] (-2527.609) (-2524.043) (-2521.090) -- 0:02:21 337000 -- (-2522.658) [-2516.358] (-2518.622) (-2526.253) * (-2523.307) (-2523.334) (-2520.231) [-2518.903] -- 0:02:21 337500 -- (-2520.320) [-2516.871] (-2519.396) (-2521.215) * (-2520.996) (-2526.836) (-2525.712) [-2524.974] -- 0:02:21 338000 -- (-2520.549) (-2523.242) (-2524.610) [-2521.180] * [-2519.765] (-2524.065) (-2520.761) (-2519.689) -- 0:02:22 338500 -- (-2522.758) [-2516.635] (-2525.221) (-2519.351) * (-2519.828) (-2531.921) [-2517.247] (-2519.487) -- 0:02:22 339000 -- (-2521.516) (-2519.615) [-2522.514] (-2518.235) * (-2524.253) (-2526.327) (-2520.172) [-2526.434] -- 0:02:22 339500 -- (-2526.633) (-2525.782) [-2521.268] (-2515.315) * (-2521.583) [-2520.523] (-2518.654) (-2520.327) -- 0:02:22 340000 -- (-2522.944) (-2528.196) [-2521.607] (-2520.236) * (-2521.618) (-2522.401) (-2520.655) [-2519.788] -- 0:02:21 Average standard deviation of split frequencies: 0.000000 340500 -- (-2524.610) (-2528.136) (-2528.978) [-2520.551] * (-2520.989) [-2516.514] (-2525.482) (-2522.784) -- 0:02:21 341000 -- [-2517.804] (-2523.953) (-2525.042) (-2516.723) * (-2521.622) [-2521.829] (-2526.981) (-2523.675) -- 0:02:21 341500 -- (-2521.868) (-2528.440) (-2522.803) [-2521.279] * (-2523.620) [-2520.043] (-2524.623) (-2527.809) -- 0:02:20 342000 -- [-2521.568] (-2522.957) (-2517.917) (-2522.655) * (-2520.834) (-2526.032) (-2529.474) [-2522.506] -- 0:02:20 342500 -- [-2520.437] (-2517.716) (-2528.719) (-2525.790) * (-2522.137) (-2525.088) (-2522.207) [-2522.917] -- 0:02:22 343000 -- (-2525.892) (-2516.461) (-2522.066) [-2517.130] * [-2516.620] (-2527.472) (-2522.870) (-2524.960) -- 0:02:21 343500 -- (-2527.849) [-2517.069] (-2520.157) (-2520.387) * (-2519.282) (-2517.711) (-2524.071) [-2522.884] -- 0:02:21 344000 -- (-2529.607) (-2521.811) [-2517.015] (-2522.120) * (-2517.171) (-2516.376) [-2521.427] (-2524.135) -- 0:02:21 344500 -- (-2520.476) [-2519.636] (-2519.356) (-2516.606) * (-2523.849) (-2519.428) [-2516.363] (-2524.446) -- 0:02:20 345000 -- (-2521.896) [-2519.963] (-2517.050) (-2519.486) * (-2527.235) (-2523.245) [-2518.564] (-2523.596) -- 0:02:20 Average standard deviation of split frequencies: 0.000000 345500 -- (-2521.975) (-2522.297) (-2518.576) [-2520.119] * [-2518.180] (-2519.875) (-2525.429) (-2524.440) -- 0:02:20 346000 -- (-2525.505) (-2516.023) (-2520.281) [-2515.872] * (-2527.403) (-2518.375) [-2522.775] (-2523.577) -- 0:02:19 346500 -- (-2525.493) [-2521.779] (-2524.796) (-2516.032) * (-2528.132) (-2522.554) (-2522.795) [-2524.663] -- 0:02:19 347000 -- (-2521.400) (-2518.130) (-2522.242) [-2517.436] * (-2522.233) (-2525.995) [-2519.995] (-2520.816) -- 0:02:21 347500 -- [-2519.603] (-2521.834) (-2523.048) (-2525.713) * (-2525.599) [-2532.179] (-2520.955) (-2522.293) -- 0:02:20 348000 -- [-2517.406] (-2520.343) (-2518.248) (-2519.639) * [-2517.966] (-2526.569) (-2522.115) (-2528.225) -- 0:02:20 348500 -- (-2521.008) (-2521.627) [-2520.351] (-2522.680) * (-2520.126) [-2522.833] (-2521.818) (-2522.858) -- 0:02:20 349000 -- (-2518.387) (-2527.212) (-2524.464) [-2523.600] * [-2522.384] (-2519.325) (-2521.108) (-2523.114) -- 0:02:19 349500 -- [-2525.769] (-2520.772) (-2521.486) (-2525.648) * (-2520.592) (-2519.692) (-2518.833) [-2516.580] -- 0:02:19 350000 -- (-2518.314) [-2523.948] (-2521.276) (-2524.660) * (-2529.486) (-2519.636) [-2517.912] (-2517.417) -- 0:02:19 Average standard deviation of split frequencies: 0.000000 350500 -- (-2519.863) (-2525.144) [-2519.100] (-2521.832) * (-2532.662) (-2519.646) [-2518.081] (-2518.697) -- 0:02:18 351000 -- (-2516.397) (-2523.066) [-2523.007] (-2524.208) * (-2532.215) [-2518.532] (-2520.766) (-2527.888) -- 0:02:18 351500 -- (-2520.199) (-2525.105) (-2519.860) [-2520.535] * (-2527.846) (-2523.860) [-2520.840] (-2521.888) -- 0:02:20 352000 -- (-2521.063) (-2530.468) [-2521.976] (-2516.370) * (-2522.171) (-2520.340) [-2521.294] (-2522.688) -- 0:02:19 352500 -- (-2522.176) (-2527.383) [-2515.220] (-2522.501) * (-2526.771) (-2524.780) [-2515.052] (-2522.601) -- 0:02:19 353000 -- (-2522.512) [-2525.915] (-2515.702) (-2525.936) * (-2521.912) [-2518.969] (-2521.893) (-2515.849) -- 0:02:19 353500 -- (-2519.200) (-2520.026) (-2517.343) [-2519.888] * (-2525.059) [-2524.706] (-2523.059) (-2520.936) -- 0:02:18 354000 -- (-2521.677) (-2525.691) (-2521.392) [-2518.289] * (-2528.541) (-2520.246) [-2517.636] (-2518.279) -- 0:02:18 354500 -- (-2521.330) (-2527.906) (-2522.377) [-2523.466] * [-2519.628] (-2521.868) (-2524.843) (-2521.767) -- 0:02:18 355000 -- (-2520.119) [-2524.645] (-2521.059) (-2518.776) * (-2520.318) (-2526.562) [-2518.801] (-2521.420) -- 0:02:18 Average standard deviation of split frequencies: 0.000000 355500 -- [-2527.372] (-2518.463) (-2521.918) (-2520.077) * [-2526.445] (-2529.179) (-2523.606) (-2521.932) -- 0:02:17 356000 -- (-2521.511) (-2515.506) (-2520.332) [-2516.979] * (-2520.448) (-2525.769) [-2520.910] (-2521.575) -- 0:02:17 356500 -- (-2521.387) (-2526.237) (-2530.223) [-2522.902] * (-2518.195) [-2519.091] (-2524.672) (-2520.694) -- 0:02:18 357000 -- [-2522.311] (-2524.549) (-2526.393) (-2520.303) * (-2520.549) (-2521.070) (-2520.536) [-2522.210] -- 0:02:18 357500 -- (-2519.526) (-2525.358) [-2524.018] (-2523.611) * (-2520.360) (-2520.776) [-2520.174] (-2519.419) -- 0:02:18 358000 -- [-2523.775] (-2528.226) (-2518.768) (-2518.061) * [-2519.477] (-2515.807) (-2519.430) (-2521.111) -- 0:02:18 358500 -- [-2517.737] (-2520.479) (-2516.302) (-2519.551) * (-2524.435) (-2516.555) (-2518.198) [-2523.544] -- 0:02:17 359000 -- (-2519.893) (-2520.489) [-2523.102] (-2521.238) * (-2528.066) (-2517.312) [-2518.378] (-2523.052) -- 0:02:17 359500 -- (-2520.417) (-2518.115) [-2519.100] (-2528.155) * (-2527.286) (-2519.808) (-2518.796) [-2525.513] -- 0:02:17 360000 -- [-2525.247] (-2527.883) (-2514.703) (-2522.729) * (-2527.448) [-2525.546] (-2517.651) (-2528.478) -- 0:02:16 Average standard deviation of split frequencies: 0.000000 360500 -- [-2521.680] (-2520.051) (-2519.636) (-2525.422) * (-2521.083) (-2525.735) [-2522.876] (-2527.503) -- 0:02:16 361000 -- (-2520.163) [-2516.122] (-2520.116) (-2525.851) * (-2519.282) [-2523.787] (-2524.790) (-2529.926) -- 0:02:18 361500 -- (-2523.544) [-2519.042] (-2527.250) (-2523.390) * (-2520.500) (-2520.300) (-2523.654) [-2525.763] -- 0:02:17 362000 -- (-2526.859) (-2520.866) [-2522.052] (-2519.536) * [-2522.562] (-2519.308) (-2521.319) (-2525.984) -- 0:02:17 362500 -- [-2521.280] (-2515.573) (-2523.754) (-2519.580) * [-2520.766] (-2518.033) (-2522.478) (-2526.853) -- 0:02:17 363000 -- (-2524.054) (-2520.830) [-2519.947] (-2521.522) * [-2518.641] (-2518.289) (-2523.706) (-2522.908) -- 0:02:16 363500 -- (-2520.505) (-2516.875) [-2521.573] (-2522.099) * [-2516.562] (-2523.915) (-2523.263) (-2522.729) -- 0:02:16 364000 -- (-2520.168) (-2519.809) [-2521.979] (-2524.160) * (-2526.163) [-2521.126] (-2518.398) (-2519.506) -- 0:02:16 364500 -- [-2519.157] (-2523.335) (-2519.440) (-2519.597) * (-2521.608) [-2517.560] (-2523.031) (-2526.982) -- 0:02:15 365000 -- (-2520.410) (-2519.050) (-2525.007) [-2516.761] * (-2518.296) [-2520.881] (-2524.633) (-2518.742) -- 0:02:15 Average standard deviation of split frequencies: 0.000000 365500 -- (-2524.695) (-2520.676) [-2524.167] (-2522.880) * (-2521.020) [-2516.571] (-2517.380) (-2526.259) -- 0:02:17 366000 -- (-2524.497) [-2523.041] (-2520.928) (-2527.817) * [-2521.154] (-2516.184) (-2524.673) (-2523.332) -- 0:02:16 366500 -- (-2529.763) [-2523.576] (-2522.638) (-2522.292) * (-2526.199) [-2515.872] (-2523.063) (-2520.757) -- 0:02:16 367000 -- (-2529.409) (-2523.540) (-2517.237) [-2520.419] * (-2522.755) (-2520.061) (-2521.309) [-2520.687] -- 0:02:16 367500 -- (-2519.048) [-2526.717] (-2519.735) (-2522.658) * (-2521.713) (-2522.263) [-2519.604] (-2513.834) -- 0:02:15 368000 -- (-2529.099) (-2519.765) (-2525.184) [-2522.360] * (-2525.384) [-2516.660] (-2514.771) (-2516.296) -- 0:02:15 368500 -- [-2525.193] (-2526.464) (-2518.376) (-2519.427) * (-2520.507) (-2518.514) (-2522.984) [-2520.620] -- 0:02:15 369000 -- (-2524.132) (-2523.380) [-2522.240] (-2522.491) * (-2520.549) (-2526.699) [-2522.088] (-2521.385) -- 0:02:15 369500 -- [-2518.581] (-2519.628) (-2523.407) (-2522.647) * (-2519.955) [-2520.762] (-2522.810) (-2522.864) -- 0:02:14 370000 -- (-2520.382) [-2525.065] (-2522.276) (-2520.119) * [-2526.428] (-2523.121) (-2531.461) (-2528.438) -- 0:02:14 Average standard deviation of split frequencies: 0.000000 370500 -- (-2524.059) [-2523.489] (-2519.943) (-2517.750) * (-2525.266) [-2520.065] (-2526.055) (-2521.362) -- 0:02:15 371000 -- (-2520.522) (-2522.702) [-2522.244] (-2521.975) * (-2518.951) [-2520.106] (-2526.917) (-2518.668) -- 0:02:15 371500 -- (-2517.631) [-2528.146] (-2517.933) (-2518.701) * [-2517.726] (-2520.646) (-2517.949) (-2523.204) -- 0:02:15 372000 -- (-2524.276) (-2527.653) [-2516.150] (-2520.812) * (-2528.163) (-2519.798) [-2516.399] (-2519.186) -- 0:02:15 372500 -- (-2522.408) (-2531.079) (-2520.421) [-2519.252] * (-2526.599) (-2521.884) [-2519.599] (-2517.793) -- 0:02:14 373000 -- (-2524.167) [-2522.161] (-2521.000) (-2523.170) * (-2519.963) (-2525.022) (-2518.164) [-2518.313] -- 0:02:14 373500 -- (-2521.400) [-2520.731] (-2520.319) (-2520.114) * (-2522.938) (-2520.437) (-2517.792) [-2516.071] -- 0:02:14 374000 -- (-2522.289) (-2523.390) [-2521.544] (-2518.989) * [-2516.921] (-2531.534) (-2522.405) (-2518.618) -- 0:02:13 374500 -- (-2521.856) (-2517.771) (-2520.109) [-2524.409] * (-2521.389) (-2517.713) (-2519.753) [-2520.177] -- 0:02:13 375000 -- (-2519.188) [-2514.841] (-2527.365) (-2526.082) * (-2522.076) (-2520.863) (-2524.911) [-2522.320] -- 0:02:15 Average standard deviation of split frequencies: 0.000000 375500 -- [-2519.776] (-2526.806) (-2517.880) (-2524.595) * [-2518.589] (-2521.294) (-2525.045) (-2522.364) -- 0:02:14 376000 -- (-2517.784) (-2519.583) [-2518.249] (-2522.616) * (-2521.005) [-2522.905] (-2519.302) (-2528.933) -- 0:02:14 376500 -- (-2524.587) (-2523.052) [-2517.365] (-2531.209) * (-2522.844) (-2528.298) (-2520.887) [-2522.922] -- 0:02:14 377000 -- (-2523.283) (-2524.355) [-2518.516] (-2522.334) * (-2519.879) (-2530.702) [-2523.528] (-2518.232) -- 0:02:13 377500 -- (-2520.689) (-2520.778) (-2518.687) [-2521.413] * (-2523.616) (-2523.418) [-2518.384] (-2524.277) -- 0:02:13 378000 -- [-2526.863] (-2523.414) (-2524.158) (-2518.796) * (-2519.091) (-2520.936) (-2523.845) [-2528.564] -- 0:02:13 378500 -- (-2527.367) (-2521.308) (-2521.387) [-2519.592] * (-2517.860) (-2521.554) [-2520.170] (-2520.826) -- 0:02:13 379000 -- (-2522.160) (-2520.456) (-2521.258) [-2525.315] * [-2516.731] (-2514.954) (-2518.566) (-2530.517) -- 0:02:12 379500 -- (-2524.148) [-2520.075] (-2522.804) (-2525.808) * (-2521.128) (-2524.503) [-2521.782] (-2520.343) -- 0:02:14 380000 -- (-2528.134) (-2517.599) (-2525.526) [-2521.246] * [-2521.925] (-2521.572) (-2523.729) (-2525.293) -- 0:02:13 Average standard deviation of split frequencies: 0.000000 380500 -- [-2520.863] (-2521.789) (-2517.826) (-2522.972) * (-2526.165) [-2524.018] (-2520.628) (-2530.302) -- 0:02:13 381000 -- (-2523.358) (-2518.151) (-2527.399) [-2524.570] * (-2531.789) [-2527.052] (-2522.289) (-2526.090) -- 0:02:13 381500 -- [-2523.325] (-2520.770) (-2519.390) (-2522.914) * (-2522.576) (-2520.816) (-2527.277) [-2520.889] -- 0:02:12 382000 -- (-2525.387) (-2519.413) [-2518.120] (-2517.357) * (-2522.516) (-2520.616) [-2517.216] (-2522.333) -- 0:02:12 382500 -- (-2526.599) (-2519.091) [-2520.122] (-2524.610) * (-2525.414) (-2525.287) [-2524.508] (-2522.058) -- 0:02:12 383000 -- (-2524.994) (-2518.629) (-2526.222) [-2525.349] * [-2519.698] (-2528.428) (-2523.076) (-2522.665) -- 0:02:12 383500 -- (-2525.523) [-2520.630] (-2518.074) (-2525.150) * [-2518.300] (-2518.515) (-2523.628) (-2526.482) -- 0:02:11 384000 -- [-2520.582] (-2522.903) (-2523.206) (-2531.662) * (-2515.772) [-2523.662] (-2519.170) (-2525.399) -- 0:02:13 384500 -- (-2520.170) (-2524.765) [-2522.529] (-2524.974) * [-2520.396] (-2524.464) (-2518.894) (-2524.861) -- 0:02:12 385000 -- (-2517.091) (-2524.484) [-2520.175] (-2528.447) * (-2528.416) (-2521.493) (-2519.813) [-2525.056] -- 0:02:12 Average standard deviation of split frequencies: 0.000000 385500 -- [-2519.398] (-2522.077) (-2523.591) (-2518.892) * (-2526.502) [-2521.209] (-2526.388) (-2524.832) -- 0:02:12 386000 -- (-2517.252) [-2525.240] (-2522.205) (-2520.116) * (-2529.425) (-2523.834) [-2523.529] (-2520.890) -- 0:02:12 386500 -- (-2521.105) [-2528.454] (-2520.616) (-2520.559) * (-2524.892) (-2522.920) (-2519.918) [-2525.276] -- 0:02:11 387000 -- (-2522.787) (-2528.674) (-2527.867) [-2520.107] * (-2524.275) [-2520.047] (-2521.625) (-2524.864) -- 0:02:11 387500 -- [-2529.644] (-2527.624) (-2526.046) (-2521.287) * [-2522.852] (-2523.922) (-2523.668) (-2525.984) -- 0:02:11 388000 -- (-2531.525) (-2518.502) (-2525.442) [-2521.029] * (-2522.216) (-2522.642) (-2519.418) [-2522.892] -- 0:02:10 388500 -- (-2530.839) (-2522.696) (-2523.527) [-2518.455] * (-2520.255) (-2531.653) (-2523.401) [-2520.122] -- 0:02:12 389000 -- (-2523.498) (-2520.825) (-2525.770) [-2521.577] * (-2521.304) (-2531.357) (-2520.968) [-2519.070] -- 0:02:11 389500 -- (-2522.800) [-2516.830] (-2526.606) (-2518.595) * [-2518.079] (-2521.434) (-2519.270) (-2521.681) -- 0:02:11 390000 -- (-2526.061) (-2528.354) (-2524.387) [-2522.642] * (-2517.241) (-2528.569) [-2514.713] (-2525.531) -- 0:02:11 Average standard deviation of split frequencies: 0.000000 390500 -- (-2527.831) (-2528.028) (-2527.081) [-2517.651] * [-2517.482] (-2527.479) (-2531.744) (-2518.014) -- 0:02:11 391000 -- (-2524.346) (-2526.249) (-2522.790) [-2522.003] * (-2523.767) (-2536.579) (-2523.155) [-2520.761] -- 0:02:10 391500 -- (-2518.135) (-2522.572) (-2524.298) [-2522.135] * (-2521.730) (-2528.128) (-2523.434) [-2517.521] -- 0:02:10 392000 -- [-2518.795] (-2527.615) (-2526.949) (-2521.993) * (-2522.916) (-2519.113) (-2520.527) [-2520.516] -- 0:02:10 392500 -- (-2523.334) [-2521.002] (-2524.588) (-2523.575) * [-2520.915] (-2523.973) (-2518.050) (-2528.941) -- 0:02:10 393000 -- [-2524.423] (-2525.889) (-2529.359) (-2523.055) * (-2527.582) (-2525.999) (-2519.959) [-2526.270] -- 0:02:11 393500 -- [-2523.379] (-2528.750) (-2526.562) (-2531.333) * [-2528.913] (-2521.591) (-2518.893) (-2523.725) -- 0:02:11 394000 -- (-2520.280) (-2522.988) [-2534.879] (-2518.205) * [-2522.247] (-2528.193) (-2521.541) (-2520.035) -- 0:02:10 394500 -- [-2527.734] (-2528.572) (-2524.720) (-2519.467) * [-2521.598] (-2521.352) (-2526.360) (-2518.682) -- 0:02:10 395000 -- [-2520.710] (-2523.497) (-2524.091) (-2520.575) * (-2519.587) [-2520.984] (-2527.348) (-2519.415) -- 0:02:10 Average standard deviation of split frequencies: 0.000000 395500 -- (-2523.970) (-2522.451) [-2522.025] (-2523.516) * (-2519.696) (-2522.045) (-2522.823) [-2516.734] -- 0:02:09 396000 -- (-2522.639) (-2523.518) (-2528.280) [-2516.989] * (-2523.635) (-2524.197) [-2516.342] (-2516.897) -- 0:02:09 396500 -- (-2522.130) (-2518.400) (-2520.789) [-2521.579] * (-2521.594) (-2522.068) (-2520.876) [-2520.612] -- 0:02:09 397000 -- (-2524.641) [-2519.369] (-2521.311) (-2518.394) * (-2519.170) (-2528.653) [-2521.138] (-2518.879) -- 0:02:09 397500 -- (-2522.562) (-2522.770) (-2520.657) [-2520.238] * (-2523.051) (-2523.391) [-2520.622] (-2529.703) -- 0:02:08 398000 -- (-2520.622) (-2526.714) (-2518.413) [-2527.544] * (-2529.775) (-2519.261) (-2520.969) [-2521.114] -- 0:02:10 398500 -- (-2524.047) (-2523.991) [-2519.662] (-2522.202) * (-2521.532) (-2518.387) (-2519.950) [-2523.650] -- 0:02:09 399000 -- (-2521.872) (-2520.168) (-2525.739) [-2522.383] * (-2524.846) (-2522.376) [-2519.944] (-2518.677) -- 0:02:09 399500 -- (-2525.794) (-2527.050) [-2516.498] (-2519.722) * [-2518.147] (-2521.392) (-2528.376) (-2520.675) -- 0:02:09 400000 -- (-2519.545) (-2522.953) [-2519.952] (-2522.327) * [-2520.265] (-2520.672) (-2520.035) (-2533.042) -- 0:02:09 Average standard deviation of split frequencies: 0.000000 400500 -- (-2523.498) (-2525.966) (-2520.312) [-2518.390] * [-2524.642] (-2517.180) (-2519.417) (-2523.057) -- 0:02:08 401000 -- (-2520.215) (-2522.392) [-2522.345] (-2520.648) * (-2517.068) [-2520.555] (-2522.009) (-2526.706) -- 0:02:08 401500 -- [-2516.537] (-2524.779) (-2521.306) (-2523.639) * [-2518.738] (-2527.122) (-2524.678) (-2524.347) -- 0:02:08 402000 -- [-2517.722] (-2523.534) (-2520.841) (-2517.766) * (-2521.191) [-2516.328] (-2520.380) (-2522.930) -- 0:02:07 402500 -- (-2521.472) (-2519.985) (-2520.534) [-2519.240] * (-2525.691) [-2517.379] (-2520.946) (-2531.609) -- 0:02:09 403000 -- (-2528.985) (-2520.053) (-2528.877) [-2519.684] * (-2521.805) [-2518.080] (-2527.362) (-2528.566) -- 0:02:08 403500 -- [-2516.791] (-2519.446) (-2528.780) (-2518.396) * (-2519.162) (-2536.454) (-2524.013) [-2523.641] -- 0:02:08 404000 -- [-2519.441] (-2524.950) (-2526.421) (-2526.446) * (-2517.335) (-2525.209) [-2521.269] (-2524.581) -- 0:02:08 404500 -- [-2520.162] (-2523.372) (-2523.091) (-2530.123) * (-2523.281) [-2519.955] (-2520.318) (-2526.065) -- 0:02:08 405000 -- (-2525.580) [-2517.718] (-2523.145) (-2524.428) * (-2520.100) (-2519.768) [-2521.426] (-2526.968) -- 0:02:07 Average standard deviation of split frequencies: 0.000000 405500 -- (-2526.216) (-2520.242) (-2518.887) [-2516.740] * [-2524.553] (-2518.506) (-2517.619) (-2523.004) -- 0:02:07 406000 -- (-2529.581) (-2521.885) (-2523.115) [-2515.509] * (-2524.805) [-2523.035] (-2524.107) (-2521.962) -- 0:02:07 406500 -- (-2526.556) [-2521.250] (-2524.970) (-2521.697) * (-2521.872) [-2523.116] (-2528.573) (-2526.972) -- 0:02:07 407000 -- (-2527.639) [-2518.169] (-2523.034) (-2523.176) * (-2519.358) (-2523.897) (-2520.209) [-2521.209] -- 0:02:08 407500 -- (-2524.334) (-2515.308) (-2531.584) [-2517.004] * (-2524.621) (-2520.259) [-2514.239] (-2524.996) -- 0:02:07 408000 -- (-2524.709) [-2516.932] (-2518.598) (-2519.299) * (-2518.674) [-2522.758] (-2517.799) (-2520.955) -- 0:02:07 408500 -- (-2522.659) (-2520.164) (-2522.723) [-2523.501] * (-2519.775) (-2518.959) [-2520.609] (-2525.482) -- 0:02:07 409000 -- [-2522.805] (-2531.314) (-2521.789) (-2525.148) * [-2522.398] (-2520.899) (-2525.485) (-2524.148) -- 0:02:07 409500 -- [-2519.649] (-2519.918) (-2522.130) (-2519.905) * (-2529.704) (-2523.511) [-2522.479] (-2528.097) -- 0:02:06 410000 -- (-2521.693) [-2521.358] (-2532.166) (-2532.330) * (-2522.850) (-2515.898) [-2520.229] (-2527.002) -- 0:02:06 Average standard deviation of split frequencies: 0.000000 410500 -- (-2517.886) (-2524.981) (-2527.215) [-2522.557] * (-2517.687) (-2527.290) [-2516.962] (-2528.645) -- 0:02:06 411000 -- [-2517.668] (-2520.145) (-2525.906) (-2525.504) * (-2524.510) [-2533.063] (-2517.446) (-2523.862) -- 0:02:06 411500 -- (-2521.819) [-2524.301] (-2520.977) (-2521.955) * [-2519.651] (-2520.006) (-2519.204) (-2522.274) -- 0:02:07 412000 -- [-2520.235] (-2523.822) (-2520.764) (-2524.653) * [-2517.531] (-2525.191) (-2515.311) (-2528.546) -- 0:02:07 412500 -- [-2518.887] (-2522.520) (-2521.498) (-2520.044) * (-2525.675) (-2526.799) [-2517.043] (-2515.966) -- 0:02:06 413000 -- (-2520.824) [-2522.762] (-2526.531) (-2520.923) * [-2518.596] (-2534.773) (-2522.852) (-2519.419) -- 0:02:06 413500 -- [-2520.679] (-2521.022) (-2520.195) (-2522.851) * (-2519.307) [-2524.274] (-2523.132) (-2529.279) -- 0:02:06 414000 -- [-2522.567] (-2525.137) (-2521.661) (-2528.592) * [-2517.451] (-2523.344) (-2522.754) (-2522.828) -- 0:02:05 414500 -- (-2528.252) (-2521.409) [-2522.268] (-2522.506) * (-2523.209) (-2518.121) [-2522.951] (-2524.293) -- 0:02:05 415000 -- (-2530.184) [-2522.408] (-2521.175) (-2525.113) * [-2519.726] (-2515.112) (-2528.595) (-2518.850) -- 0:02:05 Average standard deviation of split frequencies: 0.000000 415500 -- (-2525.976) (-2519.683) [-2517.891] (-2527.473) * [-2525.279] (-2522.443) (-2518.943) (-2521.211) -- 0:02:05 416000 -- (-2524.332) (-2517.069) (-2521.946) [-2519.674] * [-2522.888] (-2531.050) (-2528.450) (-2522.924) -- 0:02:04 416500 -- [-2524.579] (-2524.262) (-2520.515) (-2525.588) * (-2522.660) (-2524.945) [-2523.750] (-2521.688) -- 0:02:06 417000 -- [-2517.861] (-2523.446) (-2517.170) (-2522.827) * (-2517.654) (-2520.930) (-2520.108) [-2523.731] -- 0:02:05 417500 -- [-2526.112] (-2521.132) (-2521.870) (-2529.296) * (-2526.843) [-2518.417] (-2525.226) (-2519.335) -- 0:02:05 418000 -- [-2517.401] (-2531.682) (-2523.201) (-2524.946) * (-2523.120) (-2525.160) (-2519.125) [-2519.993] -- 0:02:05 418500 -- (-2522.867) (-2521.484) [-2521.826] (-2521.358) * (-2521.803) (-2519.412) (-2521.639) [-2517.668] -- 0:02:05 419000 -- [-2519.195] (-2530.559) (-2523.057) (-2523.984) * [-2523.563] (-2518.522) (-2518.207) (-2521.744) -- 0:02:04 419500 -- (-2518.341) (-2519.472) (-2532.600) [-2517.366] * [-2521.160] (-2525.912) (-2523.568) (-2523.811) -- 0:02:04 420000 -- (-2522.489) (-2527.019) (-2525.012) [-2519.771] * (-2522.756) (-2520.792) (-2523.141) [-2516.830] -- 0:02:04 Average standard deviation of split frequencies: 0.000000 420500 -- (-2523.626) [-2520.063] (-2521.944) (-2527.022) * [-2519.347] (-2526.797) (-2521.581) (-2523.006) -- 0:02:04 421000 -- (-2519.266) (-2525.669) (-2525.160) [-2521.227] * (-2529.561) (-2525.452) [-2519.198] (-2520.794) -- 0:02:05 421500 -- (-2525.274) [-2521.567] (-2531.891) (-2527.155) * (-2524.391) (-2522.891) [-2519.505] (-2523.165) -- 0:02:04 422000 -- (-2524.545) [-2518.886] (-2526.939) (-2521.102) * (-2520.875) [-2517.826] (-2520.490) (-2519.825) -- 0:02:04 422500 -- (-2519.784) (-2520.226) (-2522.331) [-2520.977] * [-2521.846] (-2521.455) (-2520.883) (-2526.120) -- 0:02:04 423000 -- (-2524.951) (-2518.389) (-2521.452) [-2518.131] * (-2530.815) [-2520.687] (-2518.233) (-2521.868) -- 0:02:04 423500 -- [-2520.639] (-2519.353) (-2520.438) (-2520.794) * (-2522.039) [-2525.714] (-2518.209) (-2525.958) -- 0:02:03 424000 -- [-2515.583] (-2518.033) (-2520.703) (-2524.408) * (-2521.027) (-2534.148) [-2520.510] (-2531.707) -- 0:02:03 424500 -- [-2523.323] (-2518.145) (-2525.233) (-2524.121) * (-2519.213) (-2520.923) [-2520.216] (-2519.694) -- 0:02:03 425000 -- (-2524.840) (-2521.653) [-2520.035] (-2527.913) * (-2518.357) (-2521.271) [-2520.923] (-2518.720) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 425500 -- [-2523.193] (-2526.141) (-2523.995) (-2524.096) * (-2521.355) [-2519.336] (-2532.389) (-2525.989) -- 0:02:04 426000 -- (-2527.322) (-2532.073) [-2523.383] (-2528.899) * (-2530.938) [-2518.906] (-2529.511) (-2521.034) -- 0:02:03 426500 -- (-2522.165) (-2528.545) (-2529.119) [-2530.697] * (-2524.735) (-2519.024) (-2521.393) [-2527.044] -- 0:02:03 427000 -- (-2525.175) (-2522.335) (-2521.494) [-2519.679] * [-2521.421] (-2520.573) (-2526.373) (-2520.773) -- 0:02:03 427500 -- (-2525.366) (-2518.771) [-2519.500] (-2526.780) * (-2522.975) (-2522.409) [-2523.333] (-2522.036) -- 0:02:03 428000 -- (-2525.470) (-2530.047) [-2525.389] (-2520.619) * [-2524.317] (-2522.981) (-2526.483) (-2526.879) -- 0:02:02 428500 -- (-2518.484) (-2517.746) (-2518.227) [-2519.594] * (-2519.972) [-2520.929] (-2524.395) (-2520.968) -- 0:02:02 429000 -- (-2524.388) [-2519.157] (-2521.799) (-2520.734) * (-2523.413) [-2519.907] (-2528.882) (-2519.782) -- 0:02:02 429500 -- (-2530.649) (-2518.420) [-2520.542] (-2529.244) * [-2522.134] (-2519.746) (-2527.368) (-2519.164) -- 0:02:02 430000 -- (-2521.685) (-2520.162) (-2516.686) [-2518.348] * (-2520.536) [-2518.347] (-2529.932) (-2526.793) -- 0:02:03 Average standard deviation of split frequencies: 0.000000 430500 -- (-2518.880) (-2520.714) [-2522.002] (-2519.354) * (-2521.780) (-2525.192) (-2526.942) [-2521.855] -- 0:02:03 431000 -- (-2520.554) (-2517.736) (-2520.398) [-2521.325] * (-2523.951) (-2524.969) [-2526.869] (-2527.638) -- 0:02:02 431500 -- (-2524.342) (-2520.379) (-2518.568) [-2520.342] * [-2519.680] (-2528.195) (-2520.347) (-2516.303) -- 0:02:02 432000 -- (-2522.009) (-2522.563) [-2517.191] (-2517.152) * [-2522.289] (-2520.742) (-2518.669) (-2528.392) -- 0:02:02 432500 -- (-2522.644) [-2516.793] (-2518.089) (-2520.414) * (-2524.361) (-2520.379) [-2519.644] (-2521.083) -- 0:02:02 433000 -- (-2523.250) (-2516.001) [-2519.492] (-2520.071) * (-2517.332) (-2520.626) [-2517.877] (-2517.502) -- 0:02:01 433500 -- (-2525.932) (-2524.249) (-2528.592) [-2517.787] * [-2522.037] (-2522.845) (-2519.232) (-2524.224) -- 0:02:01 434000 -- [-2525.973] (-2523.544) (-2519.782) (-2518.208) * (-2521.193) (-2522.643) (-2525.724) [-2521.982] -- 0:02:01 434500 -- (-2528.210) (-2525.279) (-2521.202) [-2521.357] * (-2527.020) (-2521.708) [-2520.146] (-2522.889) -- 0:02:01 435000 -- (-2517.851) (-2524.274) (-2516.593) [-2524.158] * [-2520.618] (-2522.817) (-2522.359) (-2525.589) -- 0:02:02 Average standard deviation of split frequencies: 0.000000 435500 -- (-2515.166) (-2519.440) [-2522.087] (-2525.677) * [-2523.347] (-2520.424) (-2522.812) (-2531.987) -- 0:02:01 436000 -- (-2515.230) (-2516.973) (-2520.887) [-2521.917] * (-2518.892) (-2518.956) [-2515.696] (-2518.210) -- 0:02:01 436500 -- [-2520.858] (-2523.547) (-2522.852) (-2515.670) * [-2523.592] (-2522.063) (-2524.368) (-2520.307) -- 0:02:01 437000 -- (-2517.581) (-2523.743) (-2530.164) [-2520.760] * (-2522.400) [-2524.366] (-2524.490) (-2519.840) -- 0:02:01 437500 -- (-2521.150) [-2523.674] (-2520.617) (-2523.348) * (-2518.559) [-2519.403] (-2526.627) (-2519.317) -- 0:02:00 438000 -- [-2517.593] (-2521.588) (-2520.305) (-2515.307) * (-2523.373) [-2522.677] (-2523.177) (-2518.586) -- 0:02:00 438500 -- (-2519.583) (-2520.011) (-2517.008) [-2522.421] * (-2520.310) (-2520.182) (-2534.740) [-2521.912] -- 0:02:00 439000 -- (-2518.830) (-2524.010) (-2521.692) [-2532.990] * (-2527.083) (-2521.153) [-2525.513] (-2520.463) -- 0:02:00 439500 -- [-2517.912] (-2523.874) (-2521.622) (-2531.130) * (-2526.277) (-2520.313) [-2518.372] (-2518.528) -- 0:02:01 440000 -- (-2524.733) [-2526.118] (-2519.998) (-2520.518) * (-2524.795) [-2522.031] (-2520.232) (-2521.690) -- 0:02:00 Average standard deviation of split frequencies: 0.000000 440500 -- (-2521.635) (-2527.464) (-2524.827) [-2519.859] * [-2525.240] (-2520.842) (-2522.021) (-2526.299) -- 0:02:00 441000 -- (-2524.861) (-2525.649) [-2524.907] (-2521.866) * (-2521.561) (-2521.348) (-2521.050) [-2528.095] -- 0:02:00 441500 -- (-2525.833) (-2523.325) (-2521.034) [-2523.169] * (-2527.967) (-2521.429) (-2527.687) [-2521.105] -- 0:02:00 442000 -- [-2521.574] (-2516.030) (-2517.946) (-2528.987) * (-2522.234) [-2525.424] (-2520.383) (-2528.450) -- 0:01:59 442500 -- (-2520.448) [-2516.369] (-2521.516) (-2521.767) * (-2523.161) (-2523.935) [-2523.178] (-2525.510) -- 0:01:59 443000 -- (-2523.609) [-2517.180] (-2518.238) (-2523.588) * [-2522.693] (-2521.523) (-2523.041) (-2521.755) -- 0:01:59 443500 -- (-2519.490) [-2521.602] (-2518.319) (-2523.321) * (-2522.795) (-2521.067) [-2524.119] (-2525.877) -- 0:01:59 444000 -- (-2530.811) (-2520.728) [-2518.410] (-2522.360) * (-2529.478) (-2524.672) [-2518.780] (-2522.334) -- 0:02:00 444500 -- (-2521.615) [-2518.312] (-2522.244) (-2518.689) * (-2521.568) (-2519.695) [-2524.230] (-2525.260) -- 0:01:59 445000 -- (-2523.500) [-2517.980] (-2529.295) (-2520.536) * (-2518.495) (-2519.420) (-2519.989) [-2528.046] -- 0:01:59 Average standard deviation of split frequencies: 0.000000 445500 -- (-2524.421) [-2518.714] (-2527.702) (-2523.488) * [-2521.216] (-2523.992) (-2519.075) (-2519.723) -- 0:01:59 446000 -- (-2519.675) [-2519.914] (-2528.743) (-2524.388) * (-2522.018) (-2521.806) [-2520.949] (-2519.973) -- 0:01:59 446500 -- (-2519.062) [-2521.058] (-2531.834) (-2526.755) * [-2517.840] (-2519.601) (-2523.636) (-2520.600) -- 0:01:59 447000 -- [-2524.284] (-2522.115) (-2521.256) (-2520.307) * (-2520.199) [-2518.359] (-2521.282) (-2520.089) -- 0:01:58 447500 -- (-2526.397) [-2523.442] (-2518.801) (-2522.745) * (-2519.031) [-2519.069] (-2517.147) (-2520.348) -- 0:01:58 448000 -- (-2522.146) (-2521.240) [-2521.901] (-2520.873) * (-2522.839) [-2522.669] (-2521.163) (-2520.782) -- 0:01:58 448500 -- (-2530.472) (-2522.897) (-2522.644) [-2517.701] * (-2524.251) [-2520.442] (-2518.009) (-2524.163) -- 0:01:59 449000 -- (-2528.054) (-2521.380) (-2520.828) [-2518.959] * (-2520.891) [-2519.559] (-2525.432) (-2520.501) -- 0:01:59 449500 -- (-2522.228) (-2521.044) [-2520.019] (-2520.323) * (-2520.928) (-2520.874) [-2518.498] (-2519.588) -- 0:01:58 450000 -- (-2523.410) (-2519.448) [-2517.934] (-2523.551) * (-2522.232) [-2523.054] (-2520.519) (-2520.822) -- 0:01:58 Average standard deviation of split frequencies: 0.000000 450500 -- [-2517.420] (-2526.927) (-2522.890) (-2526.733) * [-2518.761] (-2521.716) (-2519.894) (-2524.669) -- 0:01:58 451000 -- (-2517.720) (-2522.228) [-2517.449] (-2527.722) * (-2524.656) (-2526.408) (-2520.061) [-2519.815] -- 0:01:58 451500 -- (-2519.497) [-2518.736] (-2521.317) (-2529.565) * (-2519.383) (-2518.072) (-2520.220) [-2518.526] -- 0:01:57 452000 -- (-2517.810) (-2519.357) (-2523.024) [-2525.822] * (-2527.846) [-2522.702] (-2524.807) (-2518.046) -- 0:01:57 452500 -- (-2516.441) (-2519.468) (-2521.143) [-2523.618] * (-2519.585) (-2531.326) [-2519.639] (-2517.754) -- 0:01:58 453000 -- [-2522.729] (-2520.679) (-2524.632) (-2523.757) * (-2518.395) (-2524.720) [-2523.102] (-2519.838) -- 0:01:58 453500 -- (-2522.698) [-2522.549] (-2533.139) (-2525.627) * (-2524.090) (-2517.903) (-2520.988) [-2521.873] -- 0:01:58 454000 -- [-2523.036] (-2521.476) (-2521.050) (-2516.394) * (-2523.712) [-2521.697] (-2527.415) (-2527.495) -- 0:01:57 454500 -- (-2525.196) [-2518.836] (-2529.506) (-2523.394) * (-2528.488) (-2520.582) [-2519.004] (-2521.759) -- 0:01:57 455000 -- (-2518.572) [-2518.026] (-2520.570) (-2525.578) * [-2524.092] (-2531.234) (-2528.593) (-2523.237) -- 0:01:57 Average standard deviation of split frequencies: 0.000000 455500 -- (-2521.154) (-2520.085) (-2517.518) [-2520.913] * (-2526.389) (-2519.203) [-2530.015] (-2523.612) -- 0:01:57 456000 -- [-2520.637] (-2517.910) (-2520.518) (-2524.677) * (-2521.409) [-2521.166] (-2527.302) (-2525.880) -- 0:01:56 456500 -- [-2517.053] (-2523.910) (-2520.305) (-2527.209) * (-2523.688) (-2522.988) (-2524.650) [-2520.103] -- 0:01:56 457000 -- (-2521.440) (-2520.407) (-2520.454) [-2516.400] * (-2525.679) [-2520.715] (-2523.798) (-2524.093) -- 0:01:57 457500 -- [-2520.458] (-2522.908) (-2525.475) (-2521.471) * (-2526.260) (-2529.976) [-2519.715] (-2522.528) -- 0:01:57 458000 -- [-2516.248] (-2527.597) (-2521.863) (-2528.391) * (-2526.902) [-2520.143] (-2525.492) (-2520.080) -- 0:01:57 458500 -- [-2522.061] (-2525.064) (-2526.779) (-2521.298) * (-2532.065) (-2522.198) [-2521.315] (-2524.422) -- 0:01:56 459000 -- (-2523.954) [-2523.804] (-2517.346) (-2522.598) * (-2525.809) (-2524.263) [-2527.424] (-2523.552) -- 0:01:56 459500 -- (-2521.422) [-2522.892] (-2525.671) (-2523.978) * (-2521.149) (-2530.525) (-2520.899) [-2520.500] -- 0:01:56 460000 -- (-2524.101) [-2522.835] (-2534.117) (-2524.221) * (-2522.745) (-2520.945) (-2524.934) [-2521.804] -- 0:01:56 Average standard deviation of split frequencies: 0.000000 460500 -- [-2522.258] (-2520.686) (-2527.263) (-2519.873) * (-2521.261) (-2520.352) [-2529.995] (-2521.667) -- 0:01:55 461000 -- [-2522.007] (-2519.438) (-2521.893) (-2524.861) * [-2518.230] (-2522.360) (-2528.292) (-2524.827) -- 0:01:55 461500 -- [-2521.054] (-2520.633) (-2521.775) (-2524.614) * (-2520.733) [-2519.371] (-2526.769) (-2522.537) -- 0:01:55 462000 -- (-2520.344) [-2528.433] (-2524.665) (-2530.290) * (-2520.653) (-2519.182) (-2532.774) [-2519.388] -- 0:01:56 462500 -- [-2518.636] (-2520.117) (-2525.167) (-2520.776) * [-2520.620] (-2519.380) (-2527.674) (-2518.648) -- 0:01:56 463000 -- (-2522.990) (-2519.777) (-2525.727) [-2518.392] * (-2520.940) [-2524.240] (-2527.413) (-2520.773) -- 0:01:55 463500 -- (-2521.705) [-2528.299] (-2526.197) (-2522.175) * (-2519.486) (-2520.807) [-2520.015] (-2519.388) -- 0:01:55 464000 -- (-2524.121) (-2520.904) [-2519.172] (-2517.664) * [-2525.830] (-2524.957) (-2520.110) (-2518.279) -- 0:01:55 464500 -- (-2518.954) [-2515.677] (-2522.188) (-2524.869) * (-2529.456) (-2526.070) [-2518.699] (-2520.015) -- 0:01:55 465000 -- (-2525.552) [-2525.207] (-2522.337) (-2527.893) * (-2526.474) (-2519.639) (-2516.698) [-2516.358] -- 0:01:55 Average standard deviation of split frequencies: 0.000000 465500 -- (-2521.252) (-2519.402) (-2518.635) [-2523.008] * (-2525.119) (-2531.627) (-2517.025) [-2517.714] -- 0:01:54 466000 -- (-2523.365) (-2523.678) [-2520.765] (-2529.787) * (-2520.642) (-2523.170) (-2523.251) [-2521.051] -- 0:01:54 466500 -- (-2522.397) (-2529.349) (-2522.953) [-2522.676] * (-2524.313) (-2521.750) (-2527.256) [-2516.433] -- 0:01:55 467000 -- (-2527.137) (-2521.723) [-2519.707] (-2525.404) * (-2516.594) (-2522.827) [-2524.774] (-2522.921) -- 0:01:55 467500 -- (-2518.205) (-2521.378) [-2521.820] (-2525.905) * (-2520.215) [-2520.083] (-2531.986) (-2519.551) -- 0:01:55 468000 -- (-2521.279) [-2526.821] (-2522.865) (-2516.928) * (-2518.872) [-2520.543] (-2528.454) (-2519.979) -- 0:01:54 468500 -- (-2520.377) (-2520.802) (-2518.359) [-2520.788] * (-2525.078) (-2516.630) (-2521.262) [-2520.096] -- 0:01:54 469000 -- (-2523.738) (-2519.605) (-2528.096) [-2521.113] * (-2521.978) (-2521.267) (-2519.494) [-2518.650] -- 0:01:54 469500 -- [-2525.280] (-2519.619) (-2523.652) (-2518.687) * (-2523.704) (-2518.824) [-2517.958] (-2519.839) -- 0:01:54 470000 -- (-2520.803) (-2521.712) (-2520.612) [-2523.211] * (-2523.403) (-2517.218) (-2520.214) [-2519.484] -- 0:01:53 Average standard deviation of split frequencies: 0.000000 470500 -- (-2520.372) (-2519.585) (-2522.569) [-2521.043] * [-2517.086] (-2524.651) (-2529.330) (-2524.088) -- 0:01:53 471000 -- (-2523.161) (-2517.753) (-2520.017) [-2519.283] * (-2522.246) [-2528.962] (-2524.111) (-2517.112) -- 0:01:54 471500 -- (-2525.518) (-2527.542) (-2519.332) [-2517.294] * (-2516.359) (-2524.680) [-2521.150] (-2520.271) -- 0:01:54 472000 -- (-2520.509) (-2532.976) [-2521.711] (-2518.639) * (-2520.591) (-2524.068) (-2518.937) [-2522.057] -- 0:01:54 472500 -- (-2522.435) (-2520.841) (-2525.635) [-2521.088] * [-2518.349] (-2521.956) (-2518.327) (-2523.715) -- 0:01:53 473000 -- (-2516.963) (-2524.116) [-2518.037] (-2524.540) * (-2520.883) (-2524.031) [-2519.502] (-2526.629) -- 0:01:53 473500 -- (-2521.102) (-2523.223) [-2522.015] (-2520.340) * (-2530.621) [-2516.134] (-2516.340) (-2528.867) -- 0:01:53 474000 -- (-2522.603) [-2519.801] (-2527.630) (-2522.283) * [-2525.470] (-2522.729) (-2517.490) (-2520.349) -- 0:01:53 474500 -- (-2517.288) (-2524.405) (-2526.296) [-2520.330] * [-2518.269] (-2523.336) (-2517.006) (-2517.963) -- 0:01:52 475000 -- (-2523.478) [-2521.851] (-2515.560) (-2522.491) * (-2517.730) (-2521.559) [-2520.883] (-2526.727) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 475500 -- [-2519.602] (-2523.897) (-2522.958) (-2520.127) * (-2522.887) [-2523.094] (-2517.745) (-2522.556) -- 0:01:53 476000 -- (-2521.966) (-2522.258) (-2521.458) [-2525.418] * [-2516.712] (-2525.307) (-2526.730) (-2523.861) -- 0:01:53 476500 -- [-2520.512] (-2530.251) (-2524.110) (-2527.807) * (-2522.503) (-2519.027) [-2521.802] (-2529.593) -- 0:01:53 477000 -- (-2522.916) (-2519.429) (-2521.313) [-2520.224] * [-2519.974] (-2517.653) (-2519.869) (-2528.346) -- 0:01:52 477500 -- (-2520.155) (-2522.967) [-2519.881] (-2518.690) * [-2519.605] (-2521.310) (-2519.290) (-2531.833) -- 0:01:52 478000 -- [-2518.641] (-2522.003) (-2521.560) (-2515.551) * [-2520.747] (-2519.289) (-2518.203) (-2526.373) -- 0:01:52 478500 -- [-2518.351] (-2519.735) (-2529.873) (-2522.348) * (-2523.686) [-2522.329] (-2525.943) (-2520.275) -- 0:01:52 479000 -- (-2518.896) [-2521.089] (-2516.586) (-2518.803) * (-2525.503) (-2534.867) [-2521.471] (-2517.469) -- 0:01:52 479500 -- (-2529.976) (-2519.438) [-2516.768] (-2518.897) * (-2524.750) (-2517.732) (-2521.388) [-2520.813] -- 0:01:51 480000 -- (-2527.204) [-2521.177] (-2524.088) (-2518.556) * (-2526.004) [-2517.131] (-2517.372) (-2527.301) -- 0:01:52 Average standard deviation of split frequencies: 0.000000 480500 -- (-2523.381) (-2525.922) (-2519.490) [-2517.363] * (-2522.317) [-2524.504] (-2515.205) (-2518.685) -- 0:01:52 481000 -- (-2525.367) (-2521.292) (-2524.698) [-2517.802] * (-2528.689) (-2522.996) [-2521.283] (-2519.153) -- 0:01:52 481500 -- (-2522.221) (-2528.664) (-2525.742) [-2518.593] * [-2522.999] (-2519.732) (-2521.598) (-2522.008) -- 0:01:51 482000 -- (-2522.372) [-2524.067] (-2521.844) (-2526.642) * (-2521.689) [-2525.955] (-2526.696) (-2518.332) -- 0:01:51 482500 -- (-2521.265) (-2531.356) [-2526.480] (-2516.219) * (-2523.322) (-2522.214) [-2519.314] (-2521.443) -- 0:01:51 483000 -- (-2530.090) (-2524.307) (-2529.468) [-2520.180] * [-2521.713] (-2526.417) (-2517.490) (-2522.454) -- 0:01:51 483500 -- (-2523.859) (-2532.614) [-2518.461] (-2522.797) * (-2528.188) (-2520.912) [-2525.049] (-2524.622) -- 0:01:51 484000 -- (-2519.917) (-2522.952) (-2523.048) [-2517.928] * (-2520.811) (-2519.837) (-2525.061) [-2522.998] -- 0:01:50 484500 -- [-2520.331] (-2524.936) (-2520.781) (-2523.048) * [-2518.334] (-2524.405) (-2519.494) (-2518.115) -- 0:01:50 485000 -- [-2519.027] (-2523.403) (-2520.634) (-2523.202) * [-2517.519] (-2522.452) (-2528.399) (-2520.371) -- 0:01:51 Average standard deviation of split frequencies: 0.000000 485500 -- [-2519.951] (-2518.508) (-2525.118) (-2522.646) * [-2520.614] (-2524.460) (-2522.335) (-2519.007) -- 0:01:51 486000 -- [-2521.280] (-2526.556) (-2521.792) (-2519.213) * (-2527.170) (-2523.071) [-2521.034] (-2528.727) -- 0:01:51 486500 -- (-2517.292) (-2523.223) (-2528.266) [-2517.021] * (-2522.476) [-2520.934] (-2523.052) (-2516.756) -- 0:01:50 487000 -- (-2519.986) (-2526.486) (-2521.020) [-2525.629] * (-2518.037) (-2525.781) [-2517.599] (-2526.615) -- 0:01:50 487500 -- (-2523.076) (-2519.837) (-2520.540) [-2516.973] * [-2516.333] (-2523.309) (-2518.428) (-2519.161) -- 0:01:50 488000 -- (-2526.626) (-2520.038) (-2522.725) [-2519.654] * (-2518.220) [-2521.376] (-2518.858) (-2523.067) -- 0:01:50 488500 -- [-2522.701] (-2524.182) (-2518.431) (-2517.600) * (-2521.227) (-2517.628) [-2519.227] (-2525.117) -- 0:01:49 489000 -- (-2518.663) [-2517.583] (-2523.354) (-2521.231) * (-2524.186) [-2521.536] (-2523.911) (-2516.055) -- 0:01:50 489500 -- (-2519.214) [-2529.728] (-2522.044) (-2524.184) * (-2519.179) (-2521.825) (-2527.106) [-2518.688] -- 0:01:50 490000 -- [-2523.418] (-2520.753) (-2521.401) (-2526.956) * (-2528.262) [-2527.661] (-2522.587) (-2518.271) -- 0:01:50 Average standard deviation of split frequencies: 0.000000 490500 -- [-2518.135] (-2526.208) (-2518.425) (-2524.489) * (-2526.870) (-2530.227) (-2523.188) [-2520.203] -- 0:01:50 491000 -- (-2516.586) (-2528.240) (-2519.215) [-2518.000] * (-2521.921) (-2529.025) [-2524.434] (-2523.854) -- 0:01:49 491500 -- (-2517.079) [-2520.555] (-2519.281) (-2519.175) * (-2529.078) (-2522.312) [-2526.710] (-2525.109) -- 0:01:49 492000 -- (-2520.854) (-2519.852) (-2516.729) [-2518.407] * (-2526.857) (-2525.590) (-2515.593) [-2524.510] -- 0:01:49 492500 -- (-2518.165) (-2525.782) (-2523.836) [-2521.824] * (-2525.527) (-2526.821) [-2521.360] (-2520.651) -- 0:01:49 493000 -- (-2518.915) (-2526.578) (-2524.911) [-2518.870] * (-2515.582) [-2523.308] (-2520.440) (-2526.507) -- 0:01:50 493500 -- (-2525.959) (-2517.819) (-2519.445) [-2521.983] * (-2522.845) (-2519.840) (-2525.683) [-2526.487] -- 0:01:49 494000 -- (-2522.698) [-2519.263] (-2523.321) (-2520.662) * (-2519.196) (-2527.176) [-2516.381] (-2518.102) -- 0:01:49 494500 -- (-2530.316) [-2518.857] (-2516.808) (-2531.828) * (-2520.834) [-2522.771] (-2522.558) (-2522.638) -- 0:01:49 495000 -- (-2530.287) (-2520.889) (-2524.762) [-2518.761] * [-2523.223] (-2525.906) (-2521.859) (-2525.402) -- 0:01:49 Average standard deviation of split frequencies: 0.000000 495500 -- (-2529.377) (-2516.810) (-2524.470) [-2524.122] * (-2531.649) (-2517.975) [-2517.497] (-2517.924) -- 0:01:48 496000 -- [-2523.383] (-2517.243) (-2522.161) (-2523.996) * (-2521.469) (-2522.602) (-2523.055) [-2521.226] -- 0:01:48 496500 -- (-2522.697) (-2518.762) [-2518.720] (-2519.879) * (-2521.635) (-2520.655) [-2522.760] (-2523.585) -- 0:01:48 497000 -- (-2522.412) [-2519.660] (-2518.226) (-2523.348) * (-2524.613) (-2518.094) (-2522.336) [-2526.598] -- 0:01:48 497500 -- (-2524.108) (-2516.718) (-2532.647) [-2519.963] * (-2518.397) (-2525.632) [-2518.086] (-2522.259) -- 0:01:49 498000 -- (-2516.173) [-2519.190] (-2518.042) (-2521.472) * (-2524.160) (-2528.416) (-2521.526) [-2520.800] -- 0:01:48 498500 -- (-2519.292) (-2526.463) [-2521.832] (-2518.968) * (-2529.140) (-2524.053) [-2520.487] (-2525.466) -- 0:01:48 499000 -- (-2515.919) [-2524.800] (-2519.332) (-2525.201) * (-2531.856) [-2524.760] (-2524.060) (-2522.517) -- 0:01:48 499500 -- [-2516.988] (-2523.378) (-2521.210) (-2523.130) * (-2534.479) (-2523.434) [-2519.672] (-2519.554) -- 0:01:48 500000 -- (-2518.716) [-2519.573] (-2521.449) (-2522.674) * (-2527.803) (-2524.387) [-2518.499] (-2523.328) -- 0:01:48 Average standard deviation of split frequencies: 0.000000 500500 -- (-2518.497) [-2518.470] (-2517.549) (-2527.723) * (-2525.303) [-2523.895] (-2519.853) (-2519.763) -- 0:01:47 501000 -- [-2518.566] (-2522.414) (-2519.861) (-2526.286) * (-2521.399) (-2517.130) (-2518.278) [-2518.889] -- 0:01:47 501500 -- [-2522.676] (-2523.093) (-2519.829) (-2523.000) * (-2521.935) [-2521.667] (-2525.463) (-2528.148) -- 0:01:47 502000 -- [-2525.145] (-2525.187) (-2519.848) (-2519.876) * (-2524.356) [-2518.239] (-2525.477) (-2523.606) -- 0:01:47 502500 -- [-2522.153] (-2526.163) (-2521.405) (-2516.246) * (-2524.769) (-2517.906) (-2520.768) [-2519.349] -- 0:01:47 503000 -- (-2524.689) [-2522.514] (-2522.007) (-2519.454) * (-2517.707) (-2520.808) (-2520.503) [-2523.432] -- 0:01:47 503500 -- (-2524.951) (-2523.300) (-2527.248) [-2515.876] * (-2524.212) (-2526.026) (-2518.531) [-2527.288] -- 0:01:47 504000 -- (-2527.510) (-2522.019) [-2521.449] (-2523.632) * [-2523.124] (-2521.470) (-2525.057) (-2520.845) -- 0:01:47 504500 -- (-2529.276) [-2524.536] (-2521.908) (-2525.853) * [-2527.324] (-2524.326) (-2520.274) (-2522.236) -- 0:01:47 505000 -- (-2521.358) (-2523.362) [-2520.265] (-2524.743) * (-2523.124) (-2527.784) (-2520.237) [-2521.678] -- 0:01:46 Average standard deviation of split frequencies: 0.000000 505500 -- (-2518.883) (-2523.640) [-2524.895] (-2525.043) * (-2522.924) [-2520.904] (-2522.979) (-2528.889) -- 0:01:46 506000 -- (-2516.584) [-2519.201] (-2524.743) (-2519.640) * (-2522.362) (-2518.856) [-2519.233] (-2522.631) -- 0:01:46 506500 -- (-2528.632) (-2520.331) [-2524.078] (-2522.113) * (-2519.220) (-2517.976) (-2526.719) [-2519.062] -- 0:01:46 507000 -- (-2520.203) (-2517.744) [-2520.435] (-2523.599) * [-2526.499] (-2520.673) (-2517.558) (-2518.588) -- 0:01:46 507500 -- (-2522.390) (-2518.837) (-2526.870) [-2522.364] * [-2525.611] (-2528.121) (-2519.024) (-2524.486) -- 0:01:46 508000 -- [-2523.437] (-2521.074) (-2525.528) (-2516.680) * (-2517.488) (-2526.337) (-2521.496) [-2521.657] -- 0:01:46 508500 -- [-2520.240] (-2525.337) (-2527.585) (-2526.573) * (-2521.879) (-2530.558) (-2524.574) [-2521.883] -- 0:01:46 509000 -- (-2519.037) [-2518.695] (-2525.415) (-2522.471) * (-2520.981) (-2525.552) (-2521.955) [-2519.792] -- 0:01:46 509500 -- (-2523.538) (-2520.299) (-2518.903) [-2518.917] * [-2520.596] (-2520.153) (-2521.612) (-2518.841) -- 0:01:45 510000 -- (-2521.728) (-2522.252) (-2519.823) [-2519.503] * (-2523.492) [-2526.025] (-2516.713) (-2523.485) -- 0:01:45 Average standard deviation of split frequencies: 0.000000 510500 -- [-2524.342] (-2521.385) (-2522.639) (-2525.349) * [-2520.417] (-2520.875) (-2519.863) (-2524.302) -- 0:01:45 511000 -- (-2524.277) [-2521.242] (-2526.614) (-2523.729) * (-2519.409) [-2522.724] (-2518.438) (-2523.667) -- 0:01:45 511500 -- (-2524.204) (-2523.716) [-2519.436] (-2523.388) * (-2520.704) (-2524.594) [-2519.847] (-2525.344) -- 0:01:46 512000 -- (-2520.891) (-2525.011) [-2517.775] (-2519.365) * (-2524.214) [-2522.347] (-2528.275) (-2519.933) -- 0:01:45 512500 -- (-2525.781) (-2521.539) [-2523.814] (-2519.645) * (-2525.548) (-2521.343) (-2527.448) [-2520.685] -- 0:01:45 513000 -- (-2523.759) [-2523.656] (-2518.410) (-2519.551) * (-2518.201) [-2524.152] (-2518.399) (-2522.153) -- 0:01:45 513500 -- (-2525.688) (-2523.007) (-2519.763) [-2527.756] * (-2519.113) [-2520.510] (-2521.903) (-2521.327) -- 0:01:45 514000 -- (-2530.956) [-2524.479] (-2520.823) (-2520.004) * (-2523.480) (-2521.021) [-2519.185] (-2519.181) -- 0:01:44 514500 -- [-2520.192] (-2528.042) (-2523.755) (-2523.227) * (-2523.354) (-2517.284) (-2516.368) [-2526.763] -- 0:01:44 515000 -- (-2522.492) (-2525.511) [-2518.500] (-2520.273) * [-2519.411] (-2521.852) (-2519.906) (-2519.697) -- 0:01:44 Average standard deviation of split frequencies: 0.000000 515500 -- (-2523.560) (-2527.053) [-2521.535] (-2520.764) * (-2531.562) [-2524.480] (-2522.105) (-2516.311) -- 0:01:44 516000 -- (-2516.824) (-2526.127) (-2524.318) [-2521.331] * (-2521.166) [-2522.083] (-2522.580) (-2516.495) -- 0:01:45 516500 -- (-2523.772) (-2521.475) [-2516.242] (-2517.256) * (-2527.032) [-2518.053] (-2522.559) (-2518.054) -- 0:01:44 517000 -- (-2527.348) (-2522.574) [-2517.906] (-2520.517) * (-2521.553) (-2518.278) (-2518.231) [-2520.910] -- 0:01:44 517500 -- (-2521.346) (-2517.250) [-2522.739] (-2518.994) * [-2522.171] (-2523.459) (-2520.416) (-2522.276) -- 0:01:44 518000 -- (-2518.092) (-2520.448) (-2521.674) [-2521.312] * (-2521.950) (-2526.365) (-2525.376) [-2522.456] -- 0:01:44 518500 -- (-2528.575) [-2519.464] (-2520.507) (-2518.746) * (-2518.502) (-2523.378) [-2524.633] (-2523.843) -- 0:01:44 519000 -- [-2525.538] (-2518.866) (-2527.136) (-2519.687) * (-2519.669) [-2525.648] (-2519.315) (-2521.012) -- 0:01:43 519500 -- (-2519.351) (-2518.404) [-2518.534] (-2520.941) * [-2516.502] (-2521.972) (-2529.641) (-2526.302) -- 0:01:43 520000 -- [-2524.124] (-2526.865) (-2521.764) (-2524.122) * (-2520.024) (-2517.628) (-2526.203) [-2523.468] -- 0:01:44 Average standard deviation of split frequencies: 0.000000 520500 -- [-2522.058] (-2520.671) (-2520.646) (-2522.914) * [-2518.278] (-2519.033) (-2527.303) (-2522.392) -- 0:01:44 521000 -- (-2526.827) (-2526.292) [-2516.925] (-2522.975) * [-2518.075] (-2522.590) (-2522.912) (-2521.993) -- 0:01:43 521500 -- (-2525.455) (-2517.698) [-2522.276] (-2526.142) * (-2516.114) [-2524.647] (-2517.734) (-2519.432) -- 0:01:43 522000 -- (-2526.810) (-2522.370) [-2520.605] (-2527.506) * (-2524.858) (-2523.151) [-2520.024] (-2523.945) -- 0:01:43 522500 -- (-2529.539) (-2520.086) [-2521.676] (-2524.174) * (-2522.120) [-2528.444] (-2522.167) (-2523.985) -- 0:01:43 523000 -- (-2525.275) [-2515.872] (-2526.741) (-2523.459) * (-2523.951) (-2524.163) [-2519.131] (-2521.507) -- 0:01:43 523500 -- [-2518.140] (-2516.468) (-2523.603) (-2524.912) * (-2523.027) [-2523.057] (-2525.552) (-2526.465) -- 0:01:43 524000 -- (-2525.031) (-2516.901) [-2520.302] (-2525.272) * (-2523.335) (-2519.963) (-2521.122) [-2521.190] -- 0:01:43 524500 -- (-2522.535) (-2516.973) (-2524.102) [-2521.450] * (-2523.692) [-2524.107] (-2520.430) (-2531.011) -- 0:01:43 525000 -- (-2522.597) [-2522.615] (-2529.881) (-2527.841) * [-2519.496] (-2520.606) (-2523.628) (-2528.834) -- 0:01:43 Average standard deviation of split frequencies: 0.000000 525500 -- (-2519.615) [-2518.499] (-2522.914) (-2525.722) * [-2523.758] (-2525.316) (-2526.711) (-2529.347) -- 0:01:42 526000 -- (-2520.204) [-2521.580] (-2520.065) (-2522.757) * (-2524.272) (-2521.930) [-2524.018] (-2527.196) -- 0:01:42 526500 -- [-2521.156] (-2516.775) (-2521.381) (-2522.181) * (-2522.686) [-2519.490] (-2527.505) (-2523.168) -- 0:01:42 527000 -- [-2520.558] (-2521.843) (-2519.755) (-2523.176) * [-2525.078] (-2517.697) (-2523.009) (-2521.142) -- 0:01:42 527500 -- (-2522.697) (-2523.972) (-2524.281) [-2521.689] * (-2516.961) (-2521.563) (-2524.065) [-2522.095] -- 0:01:42 528000 -- (-2526.560) (-2524.159) [-2520.683] (-2523.327) * (-2519.979) (-2526.332) (-2521.400) [-2520.752] -- 0:01:42 528500 -- (-2525.572) (-2522.875) (-2520.638) [-2524.522] * (-2525.358) (-2527.212) [-2519.870] (-2523.205) -- 0:01:42 529000 -- (-2521.341) (-2518.566) [-2520.651] (-2519.971) * (-2518.234) [-2526.246] (-2525.426) (-2525.799) -- 0:01:42 529500 -- [-2521.519] (-2522.887) (-2525.779) (-2524.226) * (-2529.323) [-2521.321] (-2526.737) (-2526.250) -- 0:01:42 530000 -- (-2515.970) (-2519.231) [-2517.445] (-2525.624) * [-2523.196] (-2517.659) (-2523.200) (-2527.419) -- 0:01:41 Average standard deviation of split frequencies: 0.000000 530500 -- (-2522.045) (-2523.857) (-2521.433) [-2527.575] * (-2523.140) (-2524.755) [-2519.613] (-2525.983) -- 0:01:41 531000 -- (-2521.856) [-2520.632] (-2524.376) (-2525.831) * [-2521.881] (-2519.093) (-2519.979) (-2522.126) -- 0:01:41 531500 -- (-2524.473) (-2522.796) [-2522.730] (-2522.115) * (-2519.513) (-2522.093) [-2519.546] (-2521.268) -- 0:01:41 532000 -- (-2521.331) [-2519.149] (-2519.354) (-2521.630) * [-2522.123] (-2518.730) (-2521.998) (-2522.837) -- 0:01:41 532500 -- (-2527.249) (-2522.971) [-2517.522] (-2533.228) * (-2526.097) (-2520.824) [-2518.729] (-2526.095) -- 0:01:41 533000 -- [-2518.280] (-2528.318) (-2519.170) (-2524.306) * (-2520.874) (-2517.273) [-2521.004] (-2523.401) -- 0:01:41 533500 -- (-2521.438) (-2520.468) (-2521.320) [-2521.089] * (-2523.455) (-2525.512) (-2524.441) [-2520.684] -- 0:01:41 534000 -- [-2523.366] (-2521.599) (-2522.165) (-2518.046) * (-2524.929) [-2522.755] (-2519.418) (-2531.859) -- 0:01:41 534500 -- [-2517.562] (-2518.644) (-2523.941) (-2522.196) * [-2523.342] (-2521.619) (-2518.190) (-2523.637) -- 0:01:41 535000 -- (-2522.612) [-2519.712] (-2520.918) (-2525.468) * [-2524.832] (-2524.202) (-2521.079) (-2530.883) -- 0:01:40 Average standard deviation of split frequencies: 0.000000 535500 -- (-2522.882) (-2518.584) [-2516.857] (-2517.084) * [-2524.839] (-2531.374) (-2522.361) (-2523.909) -- 0:01:40 536000 -- (-2520.528) (-2519.134) [-2519.511] (-2515.693) * [-2523.235] (-2525.867) (-2525.424) (-2523.620) -- 0:01:40 536500 -- (-2525.150) (-2517.298) (-2521.632) [-2530.749] * (-2522.706) [-2524.203] (-2522.563) (-2521.977) -- 0:01:41 537000 -- (-2520.892) (-2519.860) (-2519.858) [-2524.207] * (-2521.852) (-2524.272) (-2517.611) [-2520.852] -- 0:01:40 537500 -- (-2525.740) (-2518.478) [-2530.094] (-2519.826) * [-2521.143] (-2523.798) (-2524.826) (-2525.414) -- 0:01:40 538000 -- [-2521.179] (-2526.290) (-2522.562) (-2518.683) * (-2517.845) (-2521.392) (-2518.252) [-2516.869] -- 0:01:40 538500 -- (-2522.492) (-2522.039) [-2522.113] (-2521.179) * [-2527.538] (-2525.542) (-2526.104) (-2517.632) -- 0:01:40 539000 -- [-2520.032] (-2520.544) (-2527.306) (-2520.947) * (-2529.081) (-2517.196) [-2520.658] (-2523.548) -- 0:01:40 539500 -- (-2518.813) (-2528.314) [-2522.869] (-2517.655) * (-2522.061) (-2528.630) [-2522.926] (-2522.912) -- 0:01:39 540000 -- (-2519.652) (-2531.528) (-2525.962) [-2521.603] * (-2521.895) (-2526.235) [-2520.478] (-2524.972) -- 0:01:39 Average standard deviation of split frequencies: 0.000000 540500 -- (-2518.149) (-2528.069) (-2525.443) [-2519.663] * (-2519.351) (-2524.456) [-2523.501] (-2521.782) -- 0:01:40 541000 -- (-2520.908) (-2524.800) [-2518.928] (-2525.758) * (-2525.552) [-2520.479] (-2517.458) (-2519.118) -- 0:01:40 541500 -- [-2518.535] (-2517.787) (-2524.782) (-2516.816) * (-2523.979) (-2523.436) [-2522.300] (-2522.589) -- 0:01:39 542000 -- (-2521.430) (-2522.801) (-2520.230) [-2520.552] * (-2525.379) (-2518.913) [-2521.155] (-2519.547) -- 0:01:39 542500 -- (-2526.558) [-2519.118] (-2525.729) (-2522.124) * (-2518.349) [-2521.930] (-2520.853) (-2519.516) -- 0:01:39 543000 -- (-2520.330) [-2525.764] (-2518.414) (-2520.400) * [-2524.319] (-2523.435) (-2518.237) (-2521.099) -- 0:01:39 543500 -- (-2526.544) [-2518.687] (-2520.515) (-2523.985) * (-2524.384) (-2519.816) [-2517.300] (-2523.793) -- 0:01:39 544000 -- [-2520.230] (-2522.870) (-2522.894) (-2524.457) * (-2518.477) (-2518.613) [-2520.485] (-2523.615) -- 0:01:38 544500 -- [-2522.216] (-2526.179) (-2516.673) (-2531.584) * (-2520.939) [-2524.017] (-2521.616) (-2518.968) -- 0:01:38 545000 -- (-2522.206) [-2521.669] (-2517.004) (-2527.859) * (-2522.009) [-2523.320] (-2515.406) (-2520.227) -- 0:01:38 Average standard deviation of split frequencies: 0.000000 545500 -- (-2521.858) (-2518.411) [-2517.770] (-2525.854) * (-2526.420) (-2524.076) (-2517.311) [-2520.992] -- 0:01:39 546000 -- (-2520.906) (-2521.973) (-2520.367) [-2520.342] * (-2520.622) [-2521.180] (-2519.890) (-2521.765) -- 0:01:38 546500 -- (-2522.684) (-2526.909) [-2516.500] (-2523.797) * [-2521.427] (-2520.484) (-2520.456) (-2521.062) -- 0:01:38 547000 -- (-2522.914) [-2529.253] (-2527.502) (-2522.793) * (-2523.370) (-2521.382) [-2520.740] (-2520.990) -- 0:01:38 547500 -- (-2525.264) (-2524.605) (-2522.342) [-2522.322] * (-2519.773) (-2519.348) [-2518.606] (-2517.791) -- 0:01:38 548000 -- (-2521.167) (-2527.392) (-2523.884) [-2523.466] * (-2517.539) [-2523.208] (-2519.916) (-2519.690) -- 0:01:38 548500 -- (-2518.225) [-2523.871] (-2520.915) (-2522.383) * (-2517.920) (-2517.271) [-2516.398] (-2521.615) -- 0:01:37 549000 -- [-2517.870] (-2521.248) (-2517.319) (-2522.824) * (-2524.458) (-2520.702) [-2519.117] (-2523.242) -- 0:01:37 549500 -- (-2526.984) [-2521.395] (-2521.953) (-2527.529) * (-2528.640) (-2523.881) [-2519.329] (-2517.976) -- 0:01:37 550000 -- (-2524.604) [-2524.460] (-2522.072) (-2525.696) * [-2522.837] (-2525.855) (-2526.028) (-2517.310) -- 0:01:38 Average standard deviation of split frequencies: 0.000000 550500 -- (-2520.661) [-2519.214] (-2530.319) (-2527.731) * (-2522.441) [-2521.563] (-2523.837) (-2524.716) -- 0:01:37 551000 -- [-2518.826] (-2520.583) (-2519.666) (-2522.324) * (-2526.349) (-2518.808) [-2524.293] (-2519.177) -- 0:01:37 551500 -- [-2519.908] (-2526.561) (-2522.424) (-2524.804) * (-2522.671) (-2519.263) (-2524.297) [-2517.308] -- 0:01:37 552000 -- (-2530.071) (-2522.401) (-2521.831) [-2524.016] * (-2520.537) [-2522.932] (-2524.756) (-2524.739) -- 0:01:37 552500 -- (-2520.805) (-2519.306) (-2518.685) [-2520.707] * [-2517.670] (-2524.596) (-2526.436) (-2525.354) -- 0:01:37 553000 -- (-2521.472) (-2523.366) [-2522.249] (-2521.194) * (-2519.165) (-2523.121) [-2520.665] (-2527.500) -- 0:01:36 553500 -- (-2519.208) [-2525.671] (-2519.182) (-2522.312) * [-2521.413] (-2524.676) (-2522.126) (-2521.755) -- 0:01:36 554000 -- (-2521.217) [-2520.917] (-2519.397) (-2520.356) * [-2517.007] (-2516.979) (-2522.887) (-2520.859) -- 0:01:36 554500 -- [-2525.831] (-2518.966) (-2523.297) (-2528.327) * [-2522.111] (-2521.042) (-2521.783) (-2521.508) -- 0:01:37 555000 -- (-2518.780) [-2516.780] (-2523.329) (-2520.936) * [-2526.149] (-2526.272) (-2519.395) (-2518.854) -- 0:01:37 Average standard deviation of split frequencies: 0.000000 555500 -- [-2521.772] (-2521.104) (-2526.135) (-2520.610) * (-2527.305) (-2525.197) (-2528.298) [-2516.132] -- 0:01:36 556000 -- (-2519.463) (-2519.501) (-2519.890) [-2521.219] * (-2524.379) [-2524.272] (-2523.864) (-2519.559) -- 0:01:36 556500 -- (-2517.538) [-2519.676] (-2521.778) (-2521.012) * (-2522.620) (-2519.885) [-2522.468] (-2519.299) -- 0:01:36 557000 -- (-2517.244) (-2518.493) [-2525.602] (-2524.291) * (-2517.483) (-2517.256) [-2520.148] (-2518.256) -- 0:01:36 557500 -- (-2518.567) (-2523.344) [-2522.341] (-2521.350) * (-2522.573) [-2521.395] (-2522.841) (-2522.690) -- 0:01:36 558000 -- [-2519.717] (-2525.972) (-2524.344) (-2520.391) * [-2521.084] (-2523.370) (-2525.184) (-2521.509) -- 0:01:35 558500 -- (-2516.869) (-2524.879) (-2522.447) [-2517.568] * [-2516.362] (-2525.310) (-2515.997) (-2522.235) -- 0:01:35 559000 -- [-2516.033] (-2525.833) (-2524.262) (-2524.379) * (-2528.302) [-2525.349] (-2518.941) (-2521.393) -- 0:01:35 559500 -- (-2523.330) (-2522.078) (-2518.614) [-2519.382] * [-2514.794] (-2524.923) (-2522.771) (-2525.691) -- 0:01:36 560000 -- (-2521.178) (-2522.996) [-2515.557] (-2529.556) * (-2521.956) (-2523.075) [-2521.725] (-2527.021) -- 0:01:35 Average standard deviation of split frequencies: 0.000000 560500 -- (-2518.166) (-2519.764) [-2518.465] (-2530.551) * (-2517.338) [-2524.073] (-2525.021) (-2525.280) -- 0:01:35 561000 -- [-2519.311] (-2523.818) (-2517.827) (-2527.326) * (-2525.142) (-2519.653) (-2519.786) [-2521.083] -- 0:01:35 561500 -- [-2522.133] (-2523.942) (-2522.472) (-2522.897) * (-2520.659) [-2521.231] (-2526.617) (-2520.628) -- 0:01:35 562000 -- (-2521.172) (-2523.705) (-2525.527) [-2523.063] * (-2519.637) [-2514.880] (-2533.468) (-2532.537) -- 0:01:35 562500 -- [-2524.235] (-2522.080) (-2527.171) (-2517.599) * (-2520.677) (-2522.162) [-2524.011] (-2519.302) -- 0:01:34 563000 -- [-2520.172] (-2521.098) (-2518.092) (-2525.920) * [-2517.696] (-2522.853) (-2522.299) (-2521.546) -- 0:01:34 563500 -- [-2522.220] (-2522.553) (-2525.278) (-2521.556) * [-2518.530] (-2522.518) (-2522.505) (-2522.924) -- 0:01:34 564000 -- (-2527.806) [-2518.389] (-2527.013) (-2521.662) * (-2525.130) (-2518.439) [-2520.645] (-2521.408) -- 0:01:35 564500 -- (-2526.238) (-2520.130) [-2523.808] (-2522.332) * (-2521.586) [-2521.558] (-2518.416) (-2522.142) -- 0:01:34 565000 -- [-2519.980] (-2525.368) (-2523.057) (-2524.275) * (-2527.105) (-2518.580) [-2518.567] (-2520.527) -- 0:01:34 Average standard deviation of split frequencies: 0.000000 565500 -- (-2517.661) (-2520.436) [-2520.721] (-2523.456) * (-2521.031) [-2516.363] (-2522.059) (-2515.704) -- 0:01:34 566000 -- (-2522.966) (-2521.750) (-2520.908) [-2521.966] * [-2523.452] (-2517.091) (-2532.232) (-2517.174) -- 0:01:34 566500 -- [-2520.394] (-2522.661) (-2519.379) (-2517.863) * (-2517.502) (-2522.199) [-2520.798] (-2520.599) -- 0:01:34 567000 -- (-2530.680) (-2521.914) (-2527.501) [-2522.155] * [-2517.596] (-2518.677) (-2520.576) (-2520.271) -- 0:01:33 567500 -- (-2529.417) (-2521.910) (-2519.388) [-2525.558] * (-2520.643) (-2518.056) [-2523.489] (-2522.980) -- 0:01:33 568000 -- (-2525.379) (-2516.263) (-2520.937) [-2521.468] * (-2523.553) [-2525.758] (-2517.792) (-2517.504) -- 0:01:33 568500 -- [-2520.441] (-2517.539) (-2525.322) (-2522.542) * (-2523.349) (-2522.808) (-2522.203) [-2518.331] -- 0:01:34 569000 -- (-2526.882) (-2522.971) [-2517.080] (-2526.812) * (-2527.642) (-2522.935) (-2523.237) [-2522.842] -- 0:01:33 569500 -- [-2523.642] (-2517.799) (-2525.108) (-2522.181) * (-2524.333) [-2518.128] (-2524.527) (-2528.599) -- 0:01:33 570000 -- (-2525.221) [-2516.810] (-2525.180) (-2531.161) * (-2520.182) [-2519.840] (-2522.759) (-2524.431) -- 0:01:33 Average standard deviation of split frequencies: 0.000000 570500 -- [-2525.043] (-2518.884) (-2526.052) (-2522.839) * (-2518.377) (-2524.812) (-2521.239) [-2521.371] -- 0:01:33 571000 -- (-2520.450) [-2520.879] (-2521.465) (-2519.966) * (-2522.342) (-2525.720) (-2525.364) [-2518.340] -- 0:01:33 571500 -- (-2521.010) [-2517.648] (-2525.495) (-2518.422) * (-2525.394) [-2518.630] (-2529.307) (-2517.218) -- 0:01:32 572000 -- [-2530.742] (-2528.187) (-2516.853) (-2518.831) * (-2518.521) [-2521.029] (-2525.807) (-2520.382) -- 0:01:32 572500 -- (-2524.133) (-2522.498) (-2521.728) [-2521.384] * [-2517.560] (-2528.514) (-2525.494) (-2520.052) -- 0:01:32 573000 -- (-2524.481) (-2525.312) (-2522.354) [-2522.602] * [-2520.476] (-2517.822) (-2520.206) (-2521.527) -- 0:01:33 573500 -- (-2518.383) [-2518.176] (-2522.963) (-2520.743) * (-2517.864) [-2523.177] (-2519.745) (-2522.078) -- 0:01:32 574000 -- (-2525.020) (-2524.387) [-2528.177] (-2526.339) * (-2521.273) (-2520.168) (-2525.210) [-2526.654] -- 0:01:32 574500 -- (-2522.385) [-2525.735] (-2519.925) (-2519.971) * (-2526.668) (-2517.252) [-2524.954] (-2524.514) -- 0:01:32 575000 -- (-2523.053) [-2520.501] (-2526.174) (-2524.641) * [-2522.162] (-2521.392) (-2525.165) (-2526.661) -- 0:01:32 Average standard deviation of split frequencies: 0.000000 575500 -- [-2521.727] (-2519.162) (-2522.240) (-2524.101) * (-2528.273) (-2520.766) (-2519.671) [-2522.161] -- 0:01:32 576000 -- (-2522.521) [-2521.277] (-2519.492) (-2525.001) * [-2518.849] (-2520.291) (-2522.383) (-2524.567) -- 0:01:32 576500 -- [-2519.254] (-2523.400) (-2526.023) (-2531.561) * (-2530.503) (-2521.622) (-2531.791) [-2524.079] -- 0:01:31 577000 -- (-2520.061) [-2519.233] (-2521.982) (-2524.264) * (-2520.613) (-2520.917) (-2523.921) [-2522.440] -- 0:01:31 577500 -- [-2520.012] (-2523.716) (-2529.088) (-2528.335) * (-2520.222) [-2522.815] (-2518.467) (-2522.770) -- 0:01:32 578000 -- (-2522.406) (-2525.160) [-2516.583] (-2522.431) * (-2518.789) [-2518.657] (-2520.254) (-2520.089) -- 0:01:31 578500 -- [-2517.534] (-2523.838) (-2522.028) (-2518.391) * (-2520.508) (-2528.190) [-2519.785] (-2527.916) -- 0:01:31 579000 -- (-2524.212) (-2521.932) (-2522.989) [-2517.945] * (-2528.243) (-2518.707) [-2523.297] (-2530.641) -- 0:01:31 579500 -- (-2516.634) (-2529.350) [-2520.873] (-2517.357) * [-2518.938] (-2517.882) (-2520.168) (-2521.600) -- 0:01:31 580000 -- (-2518.716) (-2523.730) [-2518.535] (-2521.357) * (-2525.161) [-2517.671] (-2521.098) (-2524.361) -- 0:01:31 Average standard deviation of split frequencies: 0.000000 580500 -- (-2519.461) (-2517.448) (-2528.922) [-2521.205] * (-2523.130) [-2518.671] (-2519.479) (-2519.130) -- 0:01:31 581000 -- [-2520.408] (-2522.679) (-2521.964) (-2526.469) * [-2521.208] (-2523.249) (-2519.960) (-2524.209) -- 0:01:31 581500 -- (-2525.621) (-2520.687) (-2518.772) [-2519.614] * [-2519.628] (-2524.767) (-2523.771) (-2527.797) -- 0:01:31 582000 -- (-2520.521) (-2516.529) (-2522.425) [-2521.556] * (-2528.396) (-2518.650) (-2521.163) [-2523.368] -- 0:01:31 582500 -- (-2519.795) (-2516.930) [-2522.295] (-2518.958) * (-2518.976) (-2521.519) [-2520.704] (-2519.565) -- 0:01:31 583000 -- [-2518.761] (-2520.168) (-2517.677) (-2521.303) * (-2520.679) (-2519.928) (-2528.260) [-2520.587] -- 0:01:30 583500 -- (-2521.369) (-2522.019) (-2526.900) [-2521.368] * (-2524.021) (-2527.355) (-2521.854) [-2517.113] -- 0:01:30 584000 -- (-2520.587) (-2519.134) (-2520.504) [-2526.167] * (-2524.993) [-2522.627] (-2528.799) (-2519.176) -- 0:01:30 584500 -- (-2523.478) (-2525.328) [-2520.323] (-2525.171) * (-2526.667) [-2522.787] (-2517.804) (-2522.932) -- 0:01:30 585000 -- (-2524.678) (-2518.966) [-2521.918] (-2517.967) * (-2521.231) (-2516.564) (-2517.285) [-2516.888] -- 0:01:30 Average standard deviation of split frequencies: 0.000000 585500 -- (-2519.567) [-2518.405] (-2519.031) (-2523.191) * (-2522.071) (-2527.871) [-2519.363] (-2515.780) -- 0:01:29 586000 -- (-2521.177) [-2518.233] (-2524.809) (-2519.359) * (-2517.881) (-2530.634) [-2525.798] (-2516.222) -- 0:01:30 586500 -- [-2520.029] (-2525.067) (-2521.626) (-2523.579) * (-2520.002) [-2521.974] (-2523.823) (-2520.239) -- 0:01:30 587000 -- (-2517.707) (-2523.256) (-2525.835) [-2522.598] * (-2520.570) (-2519.337) (-2519.305) [-2518.323] -- 0:01:30 587500 -- (-2518.507) (-2522.434) (-2529.462) [-2525.242] * (-2528.281) (-2518.581) [-2520.165] (-2516.964) -- 0:01:29 588000 -- (-2520.436) (-2520.607) [-2524.454] (-2524.325) * (-2524.633) (-2522.907) (-2523.189) [-2519.370] -- 0:01:29 588500 -- [-2519.613] (-2523.902) (-2522.262) (-2520.657) * [-2521.129] (-2520.303) (-2518.452) (-2524.625) -- 0:01:29 589000 -- [-2529.945] (-2530.818) (-2526.734) (-2520.576) * (-2528.528) [-2518.333] (-2521.891) (-2523.172) -- 0:01:29 589500 -- (-2520.495) [-2516.690] (-2527.202) (-2518.217) * (-2523.350) [-2518.855] (-2517.906) (-2517.445) -- 0:01:29 590000 -- (-2520.089) (-2521.107) [-2520.511] (-2521.287) * [-2523.362] (-2519.841) (-2519.874) (-2520.432) -- 0:01:28 Average standard deviation of split frequencies: 0.000000 590500 -- [-2524.285] (-2523.130) (-2527.266) (-2528.250) * [-2521.808] (-2515.870) (-2523.526) (-2519.877) -- 0:01:29 591000 -- (-2523.306) [-2516.610] (-2520.110) (-2521.250) * [-2526.803] (-2528.295) (-2519.452) (-2518.771) -- 0:01:29 591500 -- (-2520.122) [-2522.154] (-2520.475) (-2523.507) * (-2522.353) (-2524.278) (-2528.550) [-2523.439] -- 0:01:29 592000 -- (-2524.288) [-2524.382] (-2520.398) (-2520.988) * (-2522.331) (-2521.884) [-2520.530] (-2520.964) -- 0:01:28 592500 -- (-2517.635) [-2525.294] (-2521.687) (-2524.225) * (-2521.215) [-2519.487] (-2520.075) (-2520.471) -- 0:01:28 593000 -- [-2522.076] (-2526.628) (-2522.100) (-2524.964) * (-2522.765) [-2521.344] (-2530.106) (-2517.620) -- 0:01:28 593500 -- (-2518.413) (-2524.921) [-2520.435] (-2532.755) * (-2523.332) (-2517.919) [-2517.224] (-2523.295) -- 0:01:28 594000 -- (-2517.329) (-2521.767) [-2524.247] (-2526.607) * (-2525.907) (-2520.762) [-2521.378] (-2518.645) -- 0:01:28 594500 -- (-2517.579) [-2525.295] (-2521.737) (-2523.724) * [-2523.552] (-2527.933) (-2521.725) (-2522.385) -- 0:01:27 595000 -- (-2518.957) (-2517.029) (-2518.144) [-2517.028] * (-2523.845) (-2522.830) (-2523.682) [-2524.479] -- 0:01:28 Average standard deviation of split frequencies: 0.000000 595500 -- (-2520.856) (-2517.827) [-2517.674] (-2519.410) * [-2518.685] (-2521.443) (-2521.087) (-2520.642) -- 0:01:28 596000 -- (-2522.616) [-2519.021] (-2521.098) (-2525.330) * (-2527.062) (-2518.866) (-2518.818) [-2520.227] -- 0:01:28 596500 -- [-2519.537] (-2523.754) (-2521.065) (-2524.060) * (-2519.876) [-2519.645] (-2522.600) (-2525.397) -- 0:01:27 597000 -- (-2519.756) (-2524.982) (-2520.530) [-2517.517] * (-2519.647) (-2524.092) [-2518.332] (-2521.192) -- 0:01:27 597500 -- (-2524.545) [-2523.747] (-2526.028) (-2529.702) * (-2519.680) (-2529.092) [-2519.102] (-2518.379) -- 0:01:27 598000 -- (-2518.923) [-2517.443] (-2527.292) (-2526.248) * (-2526.671) [-2518.980] (-2520.233) (-2519.649) -- 0:01:27 598500 -- (-2517.971) (-2523.045) [-2522.660] (-2517.486) * (-2520.695) (-2519.918) (-2520.034) [-2522.969] -- 0:01:27 599000 -- (-2520.422) (-2518.496) (-2521.424) [-2529.078] * [-2524.155] (-2521.043) (-2519.053) (-2526.949) -- 0:01:27 599500 -- (-2522.260) (-2518.795) (-2518.827) [-2519.511] * (-2519.789) [-2516.129] (-2522.922) (-2521.823) -- 0:01:27 600000 -- (-2521.352) (-2525.616) [-2521.879] (-2518.571) * (-2527.538) (-2522.818) (-2522.733) [-2524.153] -- 0:01:27 Average standard deviation of split frequencies: 0.000000 600500 -- [-2520.532] (-2527.086) (-2520.714) (-2532.695) * (-2533.529) (-2523.148) (-2521.766) [-2522.806] -- 0:01:27 601000 -- (-2517.080) (-2520.351) [-2526.827] (-2527.300) * (-2526.453) (-2524.316) (-2518.308) [-2522.164] -- 0:01:26 601500 -- (-2519.027) (-2520.166) [-2521.761] (-2535.048) * (-2525.973) (-2523.126) (-2522.720) [-2522.052] -- 0:01:26 602000 -- (-2521.933) (-2525.647) [-2518.607] (-2527.897) * (-2521.693) (-2528.823) (-2521.818) [-2522.349] -- 0:01:26 602500 -- (-2521.913) (-2519.787) [-2526.619] (-2526.346) * (-2527.018) [-2521.361] (-2518.309) (-2526.397) -- 0:01:26 603000 -- (-2524.070) [-2520.729] (-2525.554) (-2518.686) * (-2517.391) [-2520.542] (-2521.267) (-2525.909) -- 0:01:26 603500 -- [-2523.924] (-2517.689) (-2524.534) (-2527.717) * (-2519.350) [-2521.422] (-2527.474) (-2520.447) -- 0:01:26 604000 -- (-2526.162) (-2523.878) [-2515.769] (-2526.430) * [-2520.781] (-2521.804) (-2523.868) (-2523.466) -- 0:01:26 604500 -- [-2523.707] (-2518.854) (-2522.626) (-2519.620) * (-2518.325) (-2526.873) [-2520.356] (-2522.445) -- 0:01:26 605000 -- [-2519.261] (-2517.489) (-2516.240) (-2520.024) * [-2519.771] (-2526.411) (-2519.286) (-2523.696) -- 0:01:26 Average standard deviation of split frequencies: 0.000000 605500 -- (-2519.884) (-2525.235) (-2525.841) [-2521.668] * (-2523.000) (-2527.072) (-2518.538) [-2519.962] -- 0:01:26 606000 -- [-2519.217] (-2529.786) (-2520.855) (-2523.187) * (-2521.979) (-2524.641) (-2517.759) [-2525.558] -- 0:01:25 606500 -- (-2525.884) (-2533.042) (-2521.276) [-2522.079] * (-2525.724) [-2534.182] (-2521.715) (-2529.983) -- 0:01:25 607000 -- (-2519.768) (-2523.141) [-2518.827] (-2521.730) * [-2521.968] (-2524.346) (-2520.119) (-2529.660) -- 0:01:25 607500 -- (-2522.090) (-2518.582) [-2528.426] (-2523.716) * (-2521.869) [-2518.613] (-2518.794) (-2523.454) -- 0:01:25 608000 -- (-2521.555) (-2518.723) (-2521.112) [-2518.378] * (-2523.176) (-2530.013) [-2521.228] (-2520.802) -- 0:01:25 608500 -- [-2524.058] (-2526.055) (-2521.379) (-2520.877) * (-2527.814) (-2523.386) (-2530.757) [-2522.606] -- 0:01:25 609000 -- [-2527.767] (-2525.910) (-2521.755) (-2522.883) * (-2523.661) (-2519.679) [-2517.476] (-2524.154) -- 0:01:25 609500 -- (-2525.070) (-2521.796) [-2519.675] (-2528.088) * (-2526.941) (-2520.390) (-2522.172) [-2525.630] -- 0:01:25 610000 -- [-2518.482] (-2516.855) (-2521.522) (-2526.296) * (-2529.063) (-2519.883) [-2522.638] (-2518.242) -- 0:01:25 Average standard deviation of split frequencies: 0.000000 610500 -- (-2524.285) (-2523.627) (-2524.599) [-2519.869] * (-2522.405) (-2518.488) (-2517.722) [-2522.475] -- 0:01:24 611000 -- (-2522.719) (-2529.440) [-2520.179] (-2524.629) * (-2528.943) (-2521.917) (-2518.596) [-2516.367] -- 0:01:24 611500 -- [-2516.954] (-2526.833) (-2518.575) (-2518.636) * (-2524.175) (-2521.839) [-2521.250] (-2523.209) -- 0:01:24 612000 -- (-2524.024) [-2523.583] (-2516.427) (-2518.396) * [-2521.176] (-2521.645) (-2518.036) (-2526.961) -- 0:01:24 612500 -- (-2522.991) (-2519.869) [-2524.720] (-2521.939) * (-2525.083) [-2515.755] (-2518.243) (-2522.115) -- 0:01:24 613000 -- (-2523.066) (-2524.300) (-2515.829) [-2520.901] * (-2518.585) (-2520.956) (-2518.553) [-2518.704] -- 0:01:24 613500 -- [-2524.406] (-2523.351) (-2518.329) (-2532.975) * (-2518.399) (-2521.568) [-2518.313] (-2526.037) -- 0:01:24 614000 -- (-2525.537) (-2519.112) [-2521.495] (-2523.395) * [-2522.978] (-2519.975) (-2524.735) (-2520.694) -- 0:01:24 614500 -- (-2520.348) [-2520.983] (-2524.080) (-2526.064) * (-2519.577) (-2521.873) [-2516.971] (-2522.022) -- 0:01:24 615000 -- (-2515.941) (-2520.313) [-2524.051] (-2528.982) * (-2519.736) (-2522.339) (-2517.741) [-2521.241] -- 0:01:23 Average standard deviation of split frequencies: 0.000000 615500 -- [-2518.424] (-2524.982) (-2519.875) (-2523.881) * (-2515.925) (-2519.724) (-2518.035) [-2524.193] -- 0:01:23 616000 -- [-2518.993] (-2521.205) (-2519.251) (-2519.068) * [-2522.821] (-2529.802) (-2521.911) (-2520.618) -- 0:01:23 616500 -- (-2522.369) (-2524.623) (-2523.174) [-2518.992] * [-2518.384] (-2524.661) (-2527.600) (-2522.437) -- 0:01:23 617000 -- [-2518.806] (-2520.868) (-2517.329) (-2526.682) * (-2524.071) (-2525.450) [-2519.979] (-2520.758) -- 0:01:23 617500 -- (-2523.039) (-2517.526) (-2518.192) [-2519.378] * (-2519.252) (-2526.477) [-2521.369] (-2523.024) -- 0:01:23 618000 -- (-2522.164) [-2522.095] (-2518.973) (-2519.992) * (-2521.545) (-2527.266) [-2518.788] (-2517.594) -- 0:01:23 618500 -- (-2519.442) (-2516.173) (-2519.421) [-2517.317] * (-2526.449) (-2525.539) [-2522.359] (-2518.477) -- 0:01:23 619000 -- [-2519.330] (-2520.703) (-2522.297) (-2524.656) * (-2526.276) (-2526.592) [-2520.578] (-2533.024) -- 0:01:23 619500 -- (-2517.951) (-2520.648) (-2526.328) [-2519.467] * [-2522.421] (-2522.801) (-2520.355) (-2525.774) -- 0:01:22 620000 -- (-2522.274) (-2522.604) (-2525.760) [-2526.445] * (-2516.114) [-2522.861] (-2519.950) (-2527.891) -- 0:01:22 Average standard deviation of split frequencies: 0.000000 620500 -- [-2520.208] (-2521.357) (-2522.891) (-2525.974) * (-2519.549) (-2523.391) [-2524.235] (-2525.613) -- 0:01:22 621000 -- (-2519.867) [-2517.238] (-2525.225) (-2524.607) * (-2519.464) (-2522.494) [-2517.678] (-2516.964) -- 0:01:22 621500 -- [-2522.139] (-2526.406) (-2528.492) (-2526.592) * (-2517.890) [-2518.039] (-2519.955) (-2522.465) -- 0:01:22 622000 -- [-2522.269] (-2526.957) (-2522.388) (-2523.615) * (-2523.139) (-2522.219) [-2517.965] (-2521.483) -- 0:01:22 622500 -- (-2521.149) (-2519.193) [-2520.359] (-2526.639) * (-2525.672) (-2520.151) [-2521.569] (-2518.663) -- 0:01:22 623000 -- (-2521.526) (-2523.661) (-2520.666) [-2527.461] * (-2519.324) (-2516.705) (-2517.849) [-2520.011] -- 0:01:22 623500 -- (-2527.456) (-2522.118) [-2518.708] (-2518.627) * [-2526.165] (-2518.015) (-2519.468) (-2517.029) -- 0:01:22 624000 -- [-2522.323] (-2524.650) (-2524.357) (-2520.832) * [-2520.134] (-2521.802) (-2520.616) (-2523.969) -- 0:01:21 624500 -- (-2517.706) (-2522.390) [-2519.256] (-2526.046) * (-2529.996) (-2520.850) [-2519.114] (-2519.816) -- 0:01:21 625000 -- (-2516.122) (-2521.371) (-2525.429) [-2522.607] * (-2525.571) (-2523.526) (-2517.531) [-2520.409] -- 0:01:21 Average standard deviation of split frequencies: 0.000000 625500 -- (-2519.566) (-2521.744) [-2525.847] (-2524.948) * (-2519.337) [-2521.054] (-2524.655) (-2517.767) -- 0:01:21 626000 -- (-2522.107) (-2526.931) (-2530.384) [-2515.440] * (-2521.282) (-2527.653) (-2521.078) [-2523.215] -- 0:01:21 626500 -- (-2526.541) [-2523.777] (-2526.777) (-2522.323) * (-2519.090) (-2522.462) [-2518.821] (-2535.112) -- 0:01:21 627000 -- (-2522.059) [-2519.226] (-2526.481) (-2520.698) * (-2525.936) (-2530.821) [-2514.843] (-2529.933) -- 0:01:21 627500 -- (-2528.896) (-2520.598) (-2528.726) [-2518.678] * (-2520.813) [-2519.510] (-2521.274) (-2519.713) -- 0:01:21 628000 -- (-2520.271) (-2518.348) [-2525.039] (-2525.816) * (-2527.662) [-2518.509] (-2520.854) (-2520.387) -- 0:01:21 628500 -- (-2516.039) (-2526.651) [-2519.511] (-2520.052) * (-2519.773) (-2519.991) [-2516.601] (-2525.675) -- 0:01:20 629000 -- (-2519.279) (-2521.958) [-2517.299] (-2526.383) * [-2516.559] (-2518.580) (-2525.584) (-2520.282) -- 0:01:20 629500 -- [-2518.899] (-2520.708) (-2522.661) (-2523.955) * (-2522.462) (-2525.074) [-2522.330] (-2520.787) -- 0:01:20 630000 -- (-2526.844) (-2520.370) (-2518.959) [-2528.324] * (-2520.626) (-2520.567) (-2520.367) [-2524.339] -- 0:01:20 Average standard deviation of split frequencies: 0.000000 630500 -- (-2526.929) [-2520.656] (-2516.653) (-2520.988) * (-2521.452) [-2521.026] (-2529.933) (-2521.016) -- 0:01:20 631000 -- (-2527.438) [-2519.904] (-2519.027) (-2519.750) * (-2522.001) (-2521.839) [-2520.561] (-2524.795) -- 0:01:20 631500 -- (-2521.879) (-2525.378) (-2526.707) [-2521.574] * (-2523.893) [-2522.328] (-2520.710) (-2516.153) -- 0:01:20 632000 -- [-2524.134] (-2517.908) (-2519.811) (-2519.162) * (-2520.399) [-2519.806] (-2520.100) (-2521.927) -- 0:01:20 632500 -- (-2516.573) [-2523.106] (-2521.351) (-2523.283) * (-2519.366) [-2521.752] (-2520.782) (-2527.329) -- 0:01:20 633000 -- (-2517.073) [-2517.017] (-2519.525) (-2525.461) * [-2521.380] (-2515.801) (-2524.189) (-2515.458) -- 0:01:20 633500 -- (-2520.696) (-2521.495) [-2520.532] (-2526.532) * [-2517.914] (-2522.929) (-2522.651) (-2523.943) -- 0:01:19 634000 -- (-2523.792) (-2520.818) [-2522.788] (-2516.443) * (-2516.989) (-2524.879) (-2523.686) [-2522.277] -- 0:01:19 634500 -- (-2518.413) [-2520.800] (-2519.707) (-2521.220) * [-2521.967] (-2526.007) (-2528.416) (-2524.592) -- 0:01:19 635000 -- (-2517.652) (-2523.530) (-2518.405) [-2516.957] * [-2522.252] (-2528.095) (-2520.589) (-2522.855) -- 0:01:19 Average standard deviation of split frequencies: 0.000000 635500 -- (-2527.027) [-2518.964] (-2518.111) (-2518.313) * (-2520.350) [-2522.954] (-2522.422) (-2524.659) -- 0:01:19 636000 -- (-2524.323) (-2523.116) (-2522.313) [-2522.020] * (-2523.555) [-2523.821] (-2529.019) (-2526.585) -- 0:01:19 636500 -- (-2516.887) [-2523.330] (-2523.234) (-2523.308) * (-2525.729) [-2527.052] (-2523.762) (-2519.153) -- 0:01:19 637000 -- [-2519.216] (-2525.981) (-2519.112) (-2526.458) * (-2530.262) (-2527.725) [-2522.327] (-2521.378) -- 0:01:19 637500 -- (-2520.562) [-2520.522] (-2520.357) (-2523.414) * (-2520.021) (-2527.276) (-2520.027) [-2521.047] -- 0:01:19 638000 -- (-2518.206) (-2518.456) (-2523.273) [-2517.978] * [-2522.723] (-2522.672) (-2516.801) (-2525.709) -- 0:01:18 638500 -- (-2522.163) (-2518.375) [-2521.433] (-2529.306) * (-2522.376) (-2519.307) (-2519.029) [-2524.274] -- 0:01:18 639000 -- (-2518.837) (-2525.387) (-2521.310) [-2517.981] * (-2529.015) [-2518.843] (-2515.234) (-2520.118) -- 0:01:18 639500 -- (-2523.771) (-2520.799) (-2526.855) [-2517.897] * (-2518.209) (-2519.886) (-2521.047) [-2521.673] -- 0:01:18 640000 -- [-2519.361] (-2524.888) (-2523.327) (-2520.073) * (-2521.648) (-2518.769) [-2518.473] (-2520.569) -- 0:01:18 Average standard deviation of split frequencies: 0.000000 640500 -- [-2519.531] (-2523.969) (-2525.311) (-2520.767) * (-2519.648) [-2518.226] (-2517.012) (-2518.700) -- 0:01:18 641000 -- [-2521.275] (-2521.440) (-2522.052) (-2525.796) * [-2517.204] (-2523.402) (-2521.147) (-2524.853) -- 0:01:18 641500 -- (-2520.052) (-2517.806) [-2519.338] (-2517.245) * (-2518.468) (-2520.727) (-2518.200) [-2529.034] -- 0:01:18 642000 -- (-2525.189) (-2526.201) [-2523.578] (-2524.363) * [-2519.779] (-2519.042) (-2518.321) (-2519.842) -- 0:01:18 642500 -- (-2518.601) (-2524.371) [-2519.790] (-2519.734) * [-2518.825] (-2521.370) (-2517.955) (-2518.146) -- 0:01:17 643000 -- [-2522.604] (-2519.375) (-2523.085) (-2515.905) * (-2521.631) [-2521.475] (-2524.284) (-2516.887) -- 0:01:17 643500 -- (-2523.078) (-2520.207) [-2525.290] (-2521.976) * (-2518.290) (-2522.117) [-2521.673] (-2521.609) -- 0:01:17 644000 -- (-2524.266) (-2522.011) (-2532.895) [-2519.533] * (-2520.650) (-2526.326) [-2521.003] (-2520.597) -- 0:01:17 644500 -- (-2521.005) (-2519.193) (-2523.572) [-2520.949] * (-2524.761) [-2520.703] (-2522.336) (-2527.080) -- 0:01:17 645000 -- (-2521.441) (-2521.897) (-2522.721) [-2520.241] * (-2523.437) (-2527.209) (-2527.886) [-2524.049] -- 0:01:17 Average standard deviation of split frequencies: 0.000000 645500 -- [-2518.509] (-2520.921) (-2524.916) (-2519.939) * (-2518.291) (-2522.495) [-2524.185] (-2525.729) -- 0:01:17 646000 -- (-2518.823) [-2525.069] (-2522.246) (-2523.131) * (-2524.022) [-2525.861] (-2519.033) (-2521.031) -- 0:01:17 646500 -- [-2516.329] (-2519.238) (-2524.892) (-2519.528) * (-2522.502) (-2520.966) (-2517.803) [-2522.799] -- 0:01:17 647000 -- (-2519.383) [-2523.951] (-2521.782) (-2518.707) * (-2519.143) (-2517.560) [-2518.799] (-2526.629) -- 0:01:16 647500 -- (-2522.550) (-2526.001) (-2525.358) [-2522.520] * (-2524.544) (-2518.495) (-2515.605) [-2518.349] -- 0:01:16 648000 -- (-2520.815) [-2517.975] (-2519.924) (-2521.219) * [-2522.137] (-2525.197) (-2523.643) (-2524.101) -- 0:01:16 648500 -- (-2519.595) (-2521.833) [-2518.023] (-2525.006) * [-2530.118] (-2525.650) (-2524.501) (-2523.221) -- 0:01:16 649000 -- (-2519.206) [-2515.977] (-2517.116) (-2522.769) * [-2521.945] (-2522.291) (-2539.845) (-2519.622) -- 0:01:16 649500 -- (-2518.591) [-2520.191] (-2518.784) (-2525.997) * (-2525.435) [-2518.514] (-2524.781) (-2517.933) -- 0:01:16 650000 -- [-2522.360] (-2527.856) (-2519.838) (-2524.537) * [-2531.439] (-2520.386) (-2525.812) (-2527.807) -- 0:01:16 Average standard deviation of split frequencies: 0.000000 650500 -- [-2518.965] (-2519.833) (-2517.597) (-2519.937) * (-2530.075) (-2520.347) (-2521.897) [-2520.184] -- 0:01:16 651000 -- (-2520.018) (-2518.052) (-2517.008) [-2524.473] * [-2524.641] (-2518.189) (-2523.833) (-2515.552) -- 0:01:16 651500 -- [-2524.203] (-2518.837) (-2520.613) (-2520.971) * (-2520.089) [-2518.652] (-2521.950) (-2520.754) -- 0:01:15 652000 -- [-2524.399] (-2517.268) (-2521.093) (-2522.929) * (-2523.646) [-2520.556] (-2519.467) (-2523.004) -- 0:01:15 652500 -- [-2521.165] (-2516.377) (-2521.693) (-2519.482) * (-2525.569) (-2515.765) [-2516.192] (-2524.365) -- 0:01:15 653000 -- (-2517.576) [-2521.521] (-2520.859) (-2518.453) * (-2521.335) [-2522.397] (-2521.947) (-2523.313) -- 0:01:15 653500 -- (-2522.262) (-2525.506) [-2521.511] (-2525.983) * (-2524.338) [-2517.973] (-2518.840) (-2519.187) -- 0:01:15 654000 -- (-2518.798) (-2518.684) [-2523.121] (-2522.695) * (-2520.181) [-2521.416] (-2525.878) (-2528.356) -- 0:01:15 654500 -- (-2521.105) [-2523.814] (-2516.261) (-2519.981) * (-2521.337) (-2522.820) [-2519.173] (-2518.907) -- 0:01:15 655000 -- (-2524.206) (-2521.934) (-2518.801) [-2523.594] * [-2519.997] (-2516.393) (-2521.861) (-2517.418) -- 0:01:15 Average standard deviation of split frequencies: 0.000000 655500 -- (-2522.284) (-2524.492) (-2523.267) [-2520.518] * (-2518.501) [-2519.930] (-2528.194) (-2520.242) -- 0:01:15 656000 -- (-2516.039) (-2523.331) [-2521.630] (-2525.395) * (-2517.758) (-2524.083) [-2521.663] (-2522.229) -- 0:01:14 656500 -- (-2518.897) [-2518.882] (-2524.257) (-2521.789) * [-2517.448] (-2527.449) (-2522.706) (-2518.537) -- 0:01:14 657000 -- (-2535.161) (-2521.009) [-2523.962] (-2520.155) * (-2518.460) [-2522.919] (-2517.044) (-2521.947) -- 0:01:14 657500 -- (-2526.307) (-2517.739) (-2518.712) [-2518.957] * (-2515.097) (-2526.058) [-2530.687] (-2519.122) -- 0:01:14 658000 -- (-2514.933) [-2526.041] (-2519.880) (-2520.157) * (-2523.186) (-2519.026) (-2527.815) [-2522.789] -- 0:01:14 658500 -- (-2526.618) [-2519.820] (-2516.922) (-2518.093) * [-2522.426] (-2519.801) (-2523.447) (-2521.567) -- 0:01:14 659000 -- (-2522.071) (-2527.296) (-2523.692) [-2520.503] * (-2523.390) (-2520.754) [-2519.236] (-2518.729) -- 0:01:14 659500 -- (-2518.162) (-2519.128) [-2517.114] (-2527.841) * [-2523.376] (-2518.324) (-2522.275) (-2516.886) -- 0:01:14 660000 -- (-2520.632) (-2520.194) [-2517.640] (-2528.254) * [-2523.456] (-2519.459) (-2522.097) (-2522.357) -- 0:01:14 Average standard deviation of split frequencies: 0.000000 660500 -- (-2525.643) (-2521.063) (-2515.905) [-2531.989] * [-2524.684] (-2528.299) (-2528.095) (-2518.042) -- 0:01:14 661000 -- (-2524.417) (-2525.112) (-2521.799) [-2524.170] * (-2531.418) (-2520.268) [-2525.238] (-2518.102) -- 0:01:13 661500 -- (-2528.602) [-2524.458] (-2523.292) (-2519.122) * [-2525.484] (-2519.873) (-2522.747) (-2525.495) -- 0:01:13 662000 -- (-2525.481) (-2519.049) [-2522.025] (-2520.661) * [-2523.885] (-2526.553) (-2533.234) (-2521.447) -- 0:01:13 662500 -- (-2529.367) [-2525.269] (-2519.129) (-2522.678) * (-2519.301) (-2522.820) [-2520.038] (-2521.559) -- 0:01:13 663000 -- (-2520.641) (-2518.640) (-2519.364) [-2518.556] * (-2520.976) (-2522.090) [-2519.034] (-2519.216) -- 0:01:13 663500 -- (-2521.999) (-2520.997) (-2518.662) [-2518.891] * [-2523.616] (-2523.774) (-2529.936) (-2518.900) -- 0:01:13 664000 -- (-2520.435) (-2522.526) (-2521.630) [-2524.902] * (-2522.240) (-2523.078) (-2523.372) [-2519.365] -- 0:01:13 664500 -- (-2518.828) (-2517.787) [-2520.057] (-2520.124) * (-2523.965) (-2528.057) (-2525.644) [-2516.601] -- 0:01:13 665000 -- [-2521.554] (-2525.362) (-2524.174) (-2521.905) * [-2520.074] (-2523.369) (-2522.872) (-2517.556) -- 0:01:13 Average standard deviation of split frequencies: 0.000000 665500 -- (-2521.139) (-2518.821) (-2520.112) [-2523.622] * (-2521.893) (-2518.310) (-2524.046) [-2519.121] -- 0:01:12 666000 -- (-2521.293) (-2523.504) (-2519.458) [-2518.934] * (-2520.965) (-2524.946) [-2516.905] (-2525.353) -- 0:01:12 666500 -- (-2522.698) (-2519.158) [-2520.836] (-2519.665) * (-2518.593) (-2534.942) [-2520.433] (-2525.306) -- 0:01:12 667000 -- (-2524.244) (-2519.570) [-2520.418] (-2521.888) * [-2515.735] (-2526.570) (-2523.044) (-2523.623) -- 0:01:12 667500 -- (-2524.529) [-2519.777] (-2528.209) (-2520.488) * [-2517.475] (-2520.561) (-2522.544) (-2521.813) -- 0:01:12 668000 -- (-2521.411) (-2520.522) [-2517.708] (-2517.854) * (-2517.493) (-2522.453) (-2523.128) [-2520.655] -- 0:01:12 668500 -- (-2521.262) (-2524.249) (-2519.575) [-2518.187] * (-2520.849) (-2520.688) (-2522.737) [-2519.554] -- 0:01:12 669000 -- (-2524.044) (-2519.798) (-2521.511) [-2518.158] * [-2518.495] (-2522.271) (-2526.494) (-2518.188) -- 0:01:12 669500 -- (-2520.072) [-2516.671] (-2519.489) (-2520.884) * (-2520.140) (-2518.397) (-2521.954) [-2519.082] -- 0:01:12 670000 -- (-2519.859) (-2521.537) [-2524.128] (-2526.168) * (-2520.375) (-2525.323) (-2531.839) [-2520.015] -- 0:01:11 Average standard deviation of split frequencies: 0.000000 670500 -- [-2519.464] (-2522.270) (-2517.330) (-2521.682) * (-2525.995) (-2523.666) [-2519.083] (-2520.901) -- 0:01:11 671000 -- (-2524.359) [-2527.087] (-2518.593) (-2521.880) * [-2516.802] (-2530.341) (-2522.802) (-2521.694) -- 0:01:11 671500 -- (-2523.037) (-2520.846) [-2520.640] (-2520.592) * (-2519.122) (-2522.488) (-2518.258) [-2519.037] -- 0:01:11 672000 -- (-2522.162) (-2524.419) (-2520.716) [-2523.329] * (-2518.644) [-2519.948] (-2521.474) (-2519.549) -- 0:01:11 672500 -- [-2517.755] (-2526.817) (-2525.148) (-2523.780) * (-2517.562) (-2530.089) (-2522.845) [-2519.475] -- 0:01:11 673000 -- (-2523.258) (-2523.283) [-2516.956] (-2520.989) * [-2518.776] (-2520.193) (-2521.661) (-2526.806) -- 0:01:11 673500 -- (-2520.253) [-2520.128] (-2516.582) (-2523.631) * (-2519.818) (-2522.599) [-2517.131] (-2527.511) -- 0:01:11 674000 -- (-2518.926) (-2525.718) [-2521.253] (-2522.327) * [-2518.993] (-2519.248) (-2516.817) (-2517.791) -- 0:01:11 674500 -- (-2524.146) (-2520.152) [-2518.031] (-2519.702) * (-2523.402) (-2517.818) [-2519.448] (-2522.078) -- 0:01:10 675000 -- [-2520.413] (-2517.985) (-2519.583) (-2522.880) * (-2520.072) (-2528.415) [-2521.828] (-2522.297) -- 0:01:10 Average standard deviation of split frequencies: 0.000000 675500 -- (-2519.900) [-2515.493] (-2519.194) (-2518.799) * (-2520.428) (-2528.206) [-2518.495] (-2524.347) -- 0:01:10 676000 -- (-2519.589) [-2515.759] (-2521.608) (-2523.269) * (-2520.445) (-2526.262) [-2521.049] (-2529.366) -- 0:01:10 676500 -- (-2515.699) [-2520.743] (-2520.934) (-2527.027) * (-2519.995) [-2519.975] (-2522.700) (-2529.773) -- 0:01:10 677000 -- (-2521.874) [-2525.343] (-2518.261) (-2526.862) * (-2522.488) (-2520.226) (-2524.091) [-2521.218] -- 0:01:10 677500 -- (-2519.645) (-2527.654) [-2522.787] (-2523.156) * [-2522.724] (-2519.681) (-2525.869) (-2521.038) -- 0:01:10 678000 -- (-2523.217) (-2525.184) (-2519.368) [-2519.726] * (-2521.466) [-2519.169] (-2533.653) (-2521.648) -- 0:01:10 678500 -- (-2520.725) (-2526.602) (-2529.484) [-2521.471] * (-2521.122) (-2529.401) [-2515.910] (-2525.529) -- 0:01:10 679000 -- (-2523.117) [-2521.915] (-2523.870) (-2518.117) * (-2522.246) (-2523.324) [-2521.363] (-2521.532) -- 0:01:09 679500 -- (-2527.866) [-2518.662] (-2531.576) (-2523.102) * (-2518.021) [-2524.623] (-2519.883) (-2522.834) -- 0:01:09 680000 -- (-2525.585) (-2519.354) [-2520.851] (-2519.318) * (-2522.711) (-2525.006) (-2520.835) [-2520.785] -- 0:01:09 Average standard deviation of split frequencies: 0.000000 680500 -- [-2519.486] (-2520.248) (-2524.767) (-2523.673) * [-2520.845] (-2521.623) (-2521.282) (-2518.972) -- 0:01:09 681000 -- [-2516.832] (-2520.044) (-2520.463) (-2521.470) * [-2517.104] (-2523.274) (-2521.205) (-2517.923) -- 0:01:09 681500 -- (-2516.871) [-2522.301] (-2522.633) (-2519.309) * (-2518.038) (-2526.534) [-2520.654] (-2524.676) -- 0:01:09 682000 -- [-2520.843] (-2517.825) (-2523.410) (-2514.888) * [-2521.392] (-2516.525) (-2523.601) (-2522.658) -- 0:01:09 682500 -- (-2516.543) [-2521.110] (-2519.203) (-2518.419) * (-2523.041) (-2527.384) [-2521.507] (-2523.936) -- 0:01:09 683000 -- (-2523.357) (-2517.676) (-2520.404) [-2520.183] * [-2522.577] (-2527.264) (-2518.197) (-2524.119) -- 0:01:09 683500 -- (-2523.145) (-2518.912) [-2518.556] (-2519.673) * (-2523.951) (-2523.543) [-2518.667] (-2530.111) -- 0:01:08 684000 -- (-2524.973) (-2529.415) (-2520.499) [-2523.745] * [-2525.424] (-2523.037) (-2523.170) (-2527.824) -- 0:01:08 684500 -- (-2523.248) (-2519.596) [-2521.276] (-2533.963) * (-2523.738) (-2524.210) (-2525.112) [-2520.489] -- 0:01:08 685000 -- (-2519.825) (-2520.590) [-2521.372] (-2528.247) * (-2521.021) (-2532.697) [-2525.821] (-2522.283) -- 0:01:08 Average standard deviation of split frequencies: 0.000000 685500 -- (-2520.430) [-2521.780] (-2518.430) (-2519.212) * (-2517.518) (-2524.726) (-2520.085) [-2525.258] -- 0:01:08 686000 -- (-2523.231) (-2517.842) (-2517.156) [-2523.854] * (-2519.613) (-2524.339) [-2525.707] (-2517.748) -- 0:01:08 686500 -- (-2518.721) (-2523.659) (-2524.623) [-2524.754] * [-2519.976] (-2523.946) (-2526.628) (-2521.287) -- 0:01:08 687000 -- (-2525.079) (-2528.196) (-2523.279) [-2520.165] * [-2521.532] (-2522.130) (-2527.046) (-2523.715) -- 0:01:08 687500 -- (-2526.739) [-2522.146] (-2521.975) (-2521.018) * (-2521.488) (-2524.710) (-2521.764) [-2528.655] -- 0:01:08 688000 -- (-2522.663) (-2522.168) (-2526.046) [-2520.741] * (-2525.489) [-2517.959] (-2523.364) (-2524.150) -- 0:01:08 688500 -- [-2515.803] (-2528.052) (-2520.103) (-2522.778) * (-2521.746) (-2518.876) (-2519.849) [-2520.644] -- 0:01:07 689000 -- (-2522.528) (-2527.126) (-2521.269) [-2522.005] * [-2519.408] (-2518.997) (-2520.189) (-2517.219) -- 0:01:07 689500 -- (-2525.938) (-2521.938) [-2517.260] (-2522.801) * (-2523.892) [-2519.200] (-2518.594) (-2519.572) -- 0:01:07 690000 -- (-2522.502) (-2526.418) [-2524.042] (-2519.513) * [-2515.869] (-2521.943) (-2527.369) (-2526.564) -- 0:01:07 Average standard deviation of split frequencies: 0.000000 690500 -- (-2519.036) (-2525.998) [-2518.471] (-2519.756) * [-2521.000] (-2518.691) (-2528.892) (-2523.191) -- 0:01:07 691000 -- (-2522.335) (-2528.772) [-2520.204] (-2521.393) * (-2525.590) [-2519.977] (-2522.314) (-2526.761) -- 0:01:07 691500 -- (-2522.967) (-2527.821) [-2521.712] (-2518.361) * (-2519.964) [-2518.380] (-2518.660) (-2529.637) -- 0:01:07 692000 -- (-2518.566) (-2529.721) (-2527.571) [-2522.563] * (-2522.600) [-2521.130] (-2532.726) (-2519.665) -- 0:01:07 692500 -- (-2518.834) [-2518.975] (-2527.916) (-2516.221) * (-2521.085) [-2522.182] (-2525.655) (-2521.154) -- 0:01:07 693000 -- (-2521.091) (-2516.875) (-2523.424) [-2516.892] * (-2527.509) (-2516.890) (-2529.163) [-2525.961] -- 0:01:06 693500 -- [-2518.000] (-2522.166) (-2526.710) (-2519.954) * (-2520.013) [-2521.861] (-2517.556) (-2521.176) -- 0:01:06 694000 -- [-2516.690] (-2521.649) (-2522.085) (-2531.851) * (-2524.032) (-2520.907) [-2517.370] (-2518.812) -- 0:01:06 694500 -- (-2519.199) (-2523.918) (-2521.574) [-2514.207] * [-2519.927] (-2518.562) (-2521.756) (-2519.115) -- 0:01:06 695000 -- (-2524.771) (-2520.831) [-2520.317] (-2523.040) * [-2523.039] (-2526.811) (-2520.966) (-2523.895) -- 0:01:06 Average standard deviation of split frequencies: 0.000000 695500 -- (-2520.643) [-2518.416] (-2523.278) (-2532.295) * [-2520.038] (-2519.211) (-2524.159) (-2526.577) -- 0:01:06 696000 -- (-2518.805) (-2525.215) (-2517.581) [-2517.356] * (-2522.399) (-2521.131) (-2518.277) [-2517.390] -- 0:01:06 696500 -- [-2520.743] (-2522.180) (-2518.034) (-2521.603) * [-2524.934] (-2521.560) (-2524.520) (-2518.291) -- 0:01:06 697000 -- (-2531.290) (-2522.205) [-2517.359] (-2522.636) * [-2519.855] (-2520.522) (-2525.590) (-2526.063) -- 0:01:06 697500 -- [-2524.569] (-2528.777) (-2524.366) (-2519.507) * (-2519.582) (-2521.851) [-2520.446] (-2521.586) -- 0:01:05 698000 -- (-2520.798) (-2525.980) (-2519.835) [-2519.441] * [-2515.517] (-2517.730) (-2517.180) (-2523.664) -- 0:01:05 698500 -- (-2526.246) (-2523.541) (-2519.928) [-2520.541] * (-2522.805) (-2522.360) (-2520.226) [-2517.267] -- 0:01:05 699000 -- (-2519.566) (-2523.264) [-2516.935] (-2518.468) * [-2523.418] (-2517.077) (-2519.148) (-2520.906) -- 0:01:05 699500 -- (-2525.773) (-2519.112) [-2520.613] (-2523.002) * (-2526.026) (-2523.976) (-2521.826) [-2520.574] -- 0:01:05 700000 -- (-2525.205) (-2519.822) [-2520.546] (-2522.159) * [-2521.216] (-2521.017) (-2518.947) (-2516.603) -- 0:01:05 Average standard deviation of split frequencies: 0.000000 700500 -- (-2521.267) (-2529.161) [-2520.675] (-2525.028) * (-2526.518) (-2519.249) (-2520.138) [-2520.492] -- 0:01:05 701000 -- (-2524.874) [-2526.897] (-2523.944) (-2523.498) * (-2523.648) (-2521.825) [-2517.213] (-2523.989) -- 0:01:05 701500 -- (-2523.296) (-2522.383) (-2523.044) [-2517.818] * (-2528.148) (-2516.939) (-2516.762) [-2521.997] -- 0:01:05 702000 -- (-2520.940) [-2520.177] (-2520.053) (-2522.044) * (-2521.440) [-2525.791] (-2523.789) (-2523.475) -- 0:01:04 702500 -- (-2520.482) (-2519.445) [-2515.924] (-2521.514) * [-2521.349] (-2530.117) (-2523.293) (-2522.103) -- 0:01:04 703000 -- [-2518.938] (-2520.642) (-2520.606) (-2527.955) * (-2520.048) (-2528.759) (-2520.751) [-2523.789] -- 0:01:04 703500 -- (-2528.868) [-2520.315] (-2522.773) (-2522.884) * (-2524.753) (-2522.487) [-2519.055] (-2523.849) -- 0:01:04 704000 -- (-2524.650) (-2518.417) [-2519.832] (-2524.170) * [-2519.380] (-2521.937) (-2524.679) (-2522.672) -- 0:01:04 704500 -- (-2521.933) (-2519.844) (-2517.577) [-2519.047] * [-2519.392] (-2525.517) (-2521.548) (-2523.224) -- 0:01:04 705000 -- (-2521.737) (-2524.239) (-2522.857) [-2525.455] * (-2524.897) (-2520.800) (-2519.378) [-2526.996] -- 0:01:04 Average standard deviation of split frequencies: 0.000000 705500 -- [-2520.964] (-2523.792) (-2531.466) (-2517.984) * (-2521.631) (-2527.067) [-2515.420] (-2518.380) -- 0:01:04 706000 -- (-2525.033) (-2522.731) (-2522.535) [-2520.725] * (-2533.025) (-2528.976) (-2522.789) [-2520.648] -- 0:01:04 706500 -- [-2521.195] (-2519.028) (-2525.110) (-2521.837) * [-2526.454] (-2518.793) (-2523.814) (-2519.069) -- 0:01:03 707000 -- (-2517.362) [-2519.952] (-2522.713) (-2519.209) * (-2522.184) (-2522.281) [-2520.016] (-2530.810) -- 0:01:03 707500 -- (-2519.354) [-2520.448] (-2528.768) (-2516.779) * (-2516.689) (-2523.552) [-2525.520] (-2527.035) -- 0:01:03 708000 -- (-2520.269) [-2521.740] (-2526.199) (-2521.329) * (-2519.960) (-2522.935) (-2516.713) [-2522.012] -- 0:01:03 708500 -- (-2526.398) (-2519.418) (-2522.205) [-2528.560] * [-2516.717] (-2519.766) (-2518.876) (-2519.389) -- 0:01:03 709000 -- (-2521.427) (-2524.445) (-2520.893) [-2521.620] * (-2525.937) (-2522.590) [-2523.733] (-2523.215) -- 0:01:03 709500 -- [-2520.616] (-2530.158) (-2517.981) (-2519.066) * (-2521.943) (-2520.714) [-2523.292] (-2524.726) -- 0:01:03 710000 -- [-2518.782] (-2527.059) (-2521.804) (-2522.922) * [-2521.801] (-2530.977) (-2524.960) (-2524.141) -- 0:01:03 Average standard deviation of split frequencies: 0.000000 710500 -- (-2518.656) [-2524.053] (-2525.995) (-2524.141) * (-2519.411) (-2524.815) [-2515.071] (-2523.440) -- 0:01:03 711000 -- (-2524.575) [-2518.586] (-2521.641) (-2524.816) * (-2520.541) (-2517.506) [-2519.111] (-2518.838) -- 0:01:03 711500 -- [-2517.843] (-2524.304) (-2522.958) (-2520.990) * (-2526.155) (-2516.250) (-2518.436) [-2518.116] -- 0:01:02 712000 -- [-2519.957] (-2522.662) (-2520.602) (-2520.371) * (-2531.920) (-2525.467) [-2520.089] (-2522.162) -- 0:01:02 712500 -- (-2519.460) [-2525.131] (-2519.155) (-2518.694) * (-2525.276) [-2524.621] (-2523.165) (-2526.612) -- 0:01:02 713000 -- [-2521.392] (-2526.514) (-2523.445) (-2517.873) * [-2519.319] (-2524.772) (-2522.856) (-2526.469) -- 0:01:02 713500 -- (-2524.646) (-2520.991) (-2520.134) [-2522.845] * (-2524.238) (-2520.025) (-2521.408) [-2521.305] -- 0:01:02 714000 -- (-2519.999) (-2524.448) (-2525.686) [-2520.213] * [-2520.513] (-2519.117) (-2531.101) (-2520.186) -- 0:01:02 714500 -- (-2521.667) (-2521.410) (-2524.739) [-2520.554] * (-2520.565) (-2522.789) (-2521.126) [-2516.951] -- 0:01:02 715000 -- (-2527.093) (-2522.813) [-2521.418] (-2521.034) * (-2521.719) (-2518.945) [-2517.172] (-2519.389) -- 0:01:02 Average standard deviation of split frequencies: 0.000000 715500 -- (-2520.783) (-2525.453) (-2518.050) [-2524.579] * (-2522.506) (-2522.638) [-2522.213] (-2522.062) -- 0:01:02 716000 -- [-2517.092] (-2521.501) (-2520.726) (-2525.237) * (-2519.069) (-2522.975) [-2522.151] (-2517.910) -- 0:01:01 716500 -- (-2525.852) (-2521.617) [-2525.521] (-2529.792) * (-2519.926) (-2519.355) (-2521.834) [-2516.918] -- 0:01:01 717000 -- [-2521.868] (-2518.407) (-2524.462) (-2519.863) * (-2518.612) (-2518.675) (-2519.230) [-2518.354] -- 0:01:01 717500 -- (-2518.126) (-2524.771) (-2531.842) [-2519.576] * (-2524.346) (-2518.885) [-2527.251] (-2522.400) -- 0:01:01 718000 -- [-2523.627] (-2514.482) (-2525.712) (-2521.588) * (-2518.621) (-2522.699) [-2519.337] (-2520.674) -- 0:01:01 718500 -- [-2524.696] (-2527.759) (-2525.670) (-2526.972) * [-2517.866] (-2529.457) (-2529.632) (-2523.182) -- 0:01:01 719000 -- [-2519.998] (-2520.285) (-2520.078) (-2523.903) * (-2522.501) (-2519.202) (-2526.138) [-2520.888] -- 0:01:01 719500 -- [-2522.098] (-2516.018) (-2520.424) (-2527.916) * (-2522.486) (-2520.034) (-2521.159) [-2517.383] -- 0:01:01 720000 -- (-2519.494) (-2522.890) [-2519.201] (-2516.589) * (-2521.299) (-2532.927) [-2518.214] (-2518.830) -- 0:01:01 Average standard deviation of split frequencies: 0.000000 720500 -- (-2517.458) (-2521.581) (-2522.392) [-2519.279] * [-2529.619] (-2521.708) (-2518.813) (-2525.545) -- 0:01:00 721000 -- (-2519.146) [-2519.279] (-2522.678) (-2525.049) * (-2522.340) [-2521.915] (-2523.997) (-2523.477) -- 0:01:00 721500 -- (-2522.265) (-2521.152) (-2519.909) [-2522.860] * [-2521.600] (-2519.916) (-2523.419) (-2521.984) -- 0:01:00 722000 -- (-2526.472) [-2524.426] (-2519.955) (-2520.002) * (-2529.559) (-2522.111) (-2521.645) [-2519.959] -- 0:01:00 722500 -- (-2522.333) [-2521.873] (-2521.483) (-2518.822) * [-2532.451] (-2520.728) (-2523.231) (-2528.547) -- 0:01:00 723000 -- [-2517.473] (-2517.467) (-2525.771) (-2524.654) * (-2518.854) (-2521.995) (-2519.377) [-2518.330] -- 0:01:00 723500 -- (-2521.523) (-2519.535) [-2523.271] (-2522.997) * (-2522.356) (-2518.789) [-2517.270] (-2523.228) -- 0:01:00 724000 -- (-2518.333) (-2528.603) [-2522.713] (-2520.504) * (-2523.490) (-2521.220) (-2520.739) [-2519.248] -- 0:01:00 724500 -- (-2521.620) [-2523.111] (-2523.102) (-2522.264) * (-2522.194) [-2519.985] (-2521.855) (-2521.005) -- 0:01:00 725000 -- (-2519.609) [-2519.464] (-2528.299) (-2533.183) * (-2520.556) (-2517.061) [-2516.531] (-2517.574) -- 0:00:59 Average standard deviation of split frequencies: 0.000000 725500 -- (-2518.490) [-2517.957] (-2519.944) (-2535.239) * (-2524.454) (-2529.346) (-2519.742) [-2519.587] -- 0:00:59 726000 -- (-2521.935) [-2517.827] (-2516.846) (-2520.097) * (-2525.420) [-2519.168] (-2523.724) (-2520.689) -- 0:00:59 726500 -- (-2521.546) [-2521.550] (-2524.552) (-2525.366) * (-2519.208) [-2521.600] (-2519.401) (-2526.265) -- 0:00:59 727000 -- (-2518.447) [-2523.752] (-2530.703) (-2523.037) * (-2522.750) (-2523.588) [-2523.667] (-2521.667) -- 0:00:59 727500 -- (-2521.406) (-2522.010) [-2527.873] (-2525.736) * (-2520.131) (-2527.088) [-2521.596] (-2522.176) -- 0:00:59 728000 -- (-2522.893) [-2525.467] (-2520.781) (-2526.895) * (-2522.722) (-2525.258) (-2522.880) [-2529.266] -- 0:00:59 728500 -- (-2518.535) (-2519.509) (-2529.744) [-2518.699] * (-2517.540) [-2518.304] (-2522.549) (-2522.722) -- 0:00:59 729000 -- (-2519.589) (-2522.886) (-2529.124) [-2519.757] * (-2524.783) (-2524.595) (-2521.768) [-2519.512] -- 0:00:59 729500 -- (-2523.654) [-2525.010] (-2519.345) (-2516.652) * [-2518.260] (-2524.320) (-2519.098) (-2521.927) -- 0:00:58 730000 -- [-2519.117] (-2521.577) (-2517.824) (-2528.989) * (-2519.296) (-2525.503) [-2519.922] (-2523.808) -- 0:00:58 Average standard deviation of split frequencies: 0.000000 730500 -- (-2517.973) (-2518.713) [-2523.528] (-2523.792) * (-2519.387) (-2525.606) [-2520.178] (-2521.146) -- 0:00:58 731000 -- (-2522.288) (-2526.982) (-2520.008) [-2518.605] * (-2526.187) (-2519.751) [-2522.069] (-2525.730) -- 0:00:58 731500 -- (-2521.148) (-2526.922) (-2524.477) [-2517.106] * (-2520.774) [-2522.041] (-2521.484) (-2521.241) -- 0:00:58 732000 -- [-2521.699] (-2524.329) (-2522.925) (-2518.695) * (-2518.412) [-2515.414] (-2516.624) (-2520.292) -- 0:00:58 732500 -- [-2518.759] (-2519.335) (-2525.714) (-2526.905) * [-2515.617] (-2518.241) (-2523.321) (-2525.790) -- 0:00:58 733000 -- [-2515.829] (-2521.863) (-2525.311) (-2515.124) * (-2522.902) (-2526.292) (-2516.495) [-2523.017] -- 0:00:58 733500 -- (-2515.329) [-2524.396] (-2521.203) (-2519.805) * (-2523.038) (-2522.800) (-2519.617) [-2517.669] -- 0:00:58 734000 -- (-2517.481) [-2525.371] (-2521.583) (-2525.021) * [-2519.515] (-2522.003) (-2523.527) (-2520.997) -- 0:00:57 734500 -- (-2519.262) (-2521.602) (-2523.083) [-2518.741] * [-2523.709] (-2530.322) (-2522.371) (-2520.932) -- 0:00:57 735000 -- (-2522.812) (-2523.103) (-2524.205) [-2522.389] * [-2521.257] (-2519.699) (-2520.431) (-2524.192) -- 0:00:57 Average standard deviation of split frequencies: 0.000000 735500 -- (-2520.435) [-2520.931] (-2526.226) (-2525.328) * [-2521.302] (-2520.793) (-2522.332) (-2527.045) -- 0:00:57 736000 -- [-2524.435] (-2517.951) (-2527.378) (-2521.098) * (-2527.552) (-2521.408) (-2521.605) [-2521.685] -- 0:00:57 736500 -- (-2522.840) [-2519.482] (-2527.173) (-2521.411) * [-2518.474] (-2519.556) (-2525.576) (-2522.896) -- 0:00:57 737000 -- (-2519.862) (-2518.441) [-2524.383] (-2524.456) * (-2530.085) (-2519.055) (-2519.029) [-2518.706] -- 0:00:57 737500 -- [-2518.056] (-2522.322) (-2518.905) (-2521.362) * (-2516.881) (-2517.418) (-2518.111) [-2519.291] -- 0:00:57 738000 -- (-2525.765) [-2519.801] (-2520.561) (-2522.872) * (-2520.763) (-2523.123) (-2518.352) [-2522.029] -- 0:00:57 738500 -- (-2520.994) [-2519.811] (-2524.843) (-2520.615) * (-2518.503) (-2523.168) (-2522.698) [-2517.654] -- 0:00:57 739000 -- (-2520.374) (-2524.399) [-2520.541] (-2528.899) * [-2518.595] (-2519.310) (-2523.594) (-2523.044) -- 0:00:56 739500 -- (-2522.787) (-2518.757) [-2527.010] (-2523.707) * [-2518.424] (-2517.280) (-2524.851) (-2520.363) -- 0:00:56 740000 -- (-2519.729) (-2524.683) (-2518.941) [-2521.089] * (-2521.450) (-2516.913) [-2518.117] (-2523.098) -- 0:00:56 Average standard deviation of split frequencies: 0.000000 740500 -- (-2519.591) (-2521.063) (-2517.899) [-2519.826] * (-2517.720) (-2527.567) [-2519.205] (-2523.831) -- 0:00:56 741000 -- (-2522.900) (-2518.967) (-2521.758) [-2527.369] * (-2521.812) [-2522.510] (-2522.889) (-2524.145) -- 0:00:56 741500 -- (-2527.244) (-2522.986) [-2520.241] (-2526.824) * (-2522.099) [-2516.513] (-2523.801) (-2521.781) -- 0:00:56 742000 -- (-2518.334) [-2518.981] (-2522.380) (-2519.445) * (-2520.487) (-2520.890) (-2527.878) [-2519.780] -- 0:00:56 742500 -- [-2523.541] (-2522.265) (-2522.672) (-2519.768) * (-2521.034) (-2519.587) (-2522.640) [-2529.045] -- 0:00:56 743000 -- (-2523.004) (-2523.890) [-2518.247] (-2522.266) * (-2532.067) [-2523.289] (-2521.424) (-2515.418) -- 0:00:56 743500 -- [-2520.512] (-2530.827) (-2521.301) (-2522.264) * (-2521.837) [-2521.828] (-2523.327) (-2520.537) -- 0:00:55 744000 -- (-2525.905) [-2526.439] (-2524.919) (-2520.954) * (-2516.955) [-2520.650] (-2522.138) (-2524.011) -- 0:00:55 744500 -- (-2519.279) (-2521.988) (-2525.703) [-2521.447] * (-2515.139) (-2525.502) (-2525.661) [-2526.331] -- 0:00:55 745000 -- [-2519.389] (-2516.038) (-2522.198) (-2519.459) * (-2518.496) [-2522.252] (-2518.094) (-2519.109) -- 0:00:55 Average standard deviation of split frequencies: 0.000000 745500 -- [-2525.898] (-2522.589) (-2523.562) (-2521.020) * (-2526.642) (-2521.052) (-2515.147) [-2522.889] -- 0:00:55 746000 -- (-2528.321) (-2523.695) (-2521.428) [-2519.231] * (-2517.501) (-2527.956) [-2517.842] (-2523.797) -- 0:00:55 746500 -- (-2530.977) (-2520.743) (-2525.093) [-2518.603] * (-2522.692) [-2524.771] (-2520.798) (-2520.732) -- 0:00:55 747000 -- (-2522.991) [-2521.162] (-2518.955) (-2526.080) * [-2523.121] (-2517.036) (-2527.958) (-2518.298) -- 0:00:55 747500 -- (-2517.413) (-2516.725) [-2519.130] (-2526.237) * (-2524.037) (-2520.211) [-2516.611] (-2522.009) -- 0:00:55 748000 -- [-2521.479] (-2523.950) (-2522.438) (-2523.454) * [-2521.380] (-2520.924) (-2522.724) (-2523.908) -- 0:00:54 748500 -- (-2522.964) (-2522.797) (-2523.111) [-2519.608] * (-2525.960) (-2521.399) [-2518.024] (-2524.782) -- 0:00:54 749000 -- (-2523.514) [-2518.553] (-2523.575) (-2517.367) * [-2521.146] (-2521.104) (-2521.398) (-2522.784) -- 0:00:54 749500 -- (-2516.561) (-2519.371) (-2525.238) [-2516.410] * [-2520.304] (-2520.850) (-2525.275) (-2523.752) -- 0:00:54 750000 -- (-2524.152) (-2516.929) (-2520.055) [-2517.553] * [-2516.594] (-2517.408) (-2525.734) (-2523.975) -- 0:00:54 Average standard deviation of split frequencies: 0.000000 750500 -- (-2517.261) (-2523.671) [-2520.076] (-2522.406) * [-2519.876] (-2516.068) (-2521.472) (-2527.533) -- 0:00:54 751000 -- (-2519.026) [-2521.921] (-2525.927) (-2521.178) * [-2520.402] (-2526.637) (-2530.420) (-2521.290) -- 0:00:54 751500 -- (-2525.896) (-2518.087) [-2517.062] (-2522.437) * (-2522.426) (-2524.400) [-2525.268] (-2523.657) -- 0:00:54 752000 -- (-2516.991) [-2521.015] (-2520.991) (-2517.727) * (-2521.295) (-2528.111) (-2522.893) [-2522.289] -- 0:00:54 752500 -- (-2520.491) (-2518.138) [-2520.542] (-2517.413) * (-2521.025) [-2520.981] (-2525.164) (-2522.245) -- 0:00:53 753000 -- (-2524.102) [-2523.801] (-2527.098) (-2517.294) * (-2522.649) (-2516.985) [-2520.027] (-2522.967) -- 0:00:53 753500 -- (-2520.583) (-2520.239) [-2520.770] (-2521.770) * (-2522.665) (-2516.370) [-2517.101] (-2521.045) -- 0:00:53 754000 -- (-2525.232) (-2518.190) [-2521.803] (-2522.719) * (-2525.640) [-2525.145] (-2527.929) (-2521.202) -- 0:00:53 754500 -- (-2522.397) (-2521.333) [-2523.695] (-2526.301) * (-2522.258) (-2522.549) (-2516.828) [-2519.893] -- 0:00:53 755000 -- [-2518.470] (-2521.125) (-2527.211) (-2522.611) * (-2526.263) (-2516.946) [-2519.144] (-2522.409) -- 0:00:53 Average standard deviation of split frequencies: 0.000000 755500 -- (-2517.263) (-2519.734) [-2518.628] (-2520.024) * [-2523.574] (-2521.903) (-2519.371) (-2523.051) -- 0:00:53 756000 -- [-2523.237] (-2523.863) (-2523.455) (-2522.638) * (-2529.864) (-2521.783) [-2518.043] (-2526.857) -- 0:00:53 756500 -- (-2517.892) (-2521.590) (-2520.846) [-2520.543] * (-2518.638) [-2516.574] (-2531.167) (-2519.957) -- 0:00:53 757000 -- (-2524.046) [-2520.328] (-2522.930) (-2524.123) * (-2518.157) (-2525.573) [-2529.217] (-2518.831) -- 0:00:52 757500 -- (-2526.975) [-2516.732] (-2521.405) (-2526.562) * [-2519.116] (-2519.103) (-2533.308) (-2521.708) -- 0:00:52 758000 -- (-2524.203) [-2524.759] (-2517.648) (-2529.047) * (-2518.178) (-2522.095) [-2518.366] (-2518.010) -- 0:00:52 758500 -- (-2520.856) [-2515.805] (-2531.570) (-2521.561) * (-2521.458) (-2524.367) [-2525.227] (-2525.566) -- 0:00:52 759000 -- (-2517.316) [-2519.553] (-2530.162) (-2518.088) * (-2516.642) [-2526.187] (-2521.009) (-2524.679) -- 0:00:52 759500 -- [-2522.261] (-2521.988) (-2518.205) (-2529.929) * [-2521.785] (-2519.804) (-2524.491) (-2527.696) -- 0:00:52 760000 -- [-2518.323] (-2518.385) (-2520.103) (-2518.927) * (-2519.576) [-2523.152] (-2528.242) (-2521.836) -- 0:00:52 Average standard deviation of split frequencies: 0.000000 760500 -- (-2523.005) [-2520.252] (-2516.439) (-2523.371) * (-2525.331) (-2520.322) (-2524.356) [-2525.066] -- 0:00:52 761000 -- (-2520.325) (-2528.535) [-2520.297] (-2519.830) * [-2518.577] (-2520.018) (-2524.895) (-2517.848) -- 0:00:52 761500 -- [-2519.650] (-2523.612) (-2524.638) (-2523.334) * (-2519.927) (-2518.390) [-2525.960] (-2521.928) -- 0:00:51 762000 -- (-2525.987) (-2519.086) (-2522.508) [-2521.300] * (-2517.490) (-2520.764) (-2528.932) [-2520.341] -- 0:00:51 762500 -- (-2518.953) (-2518.115) (-2519.799) [-2521.252] * (-2520.308) (-2520.176) (-2519.085) [-2520.845] -- 0:00:51 763000 -- (-2522.274) (-2522.863) [-2517.405] (-2524.106) * (-2522.720) (-2524.415) (-2527.426) [-2519.046] -- 0:00:51 763500 -- (-2517.856) [-2518.615] (-2526.657) (-2523.461) * (-2519.928) (-2521.894) (-2521.266) [-2521.523] -- 0:00:51 764000 -- (-2517.432) [-2521.880] (-2520.237) (-2520.381) * (-2519.937) [-2520.562] (-2521.813) (-2523.288) -- 0:00:51 764500 -- (-2524.901) (-2521.265) (-2523.581) [-2521.449] * (-2518.930) (-2525.755) [-2517.375] (-2521.410) -- 0:00:51 765000 -- (-2525.730) (-2528.972) (-2527.270) [-2523.063] * (-2518.242) (-2521.098) (-2519.777) [-2518.959] -- 0:00:51 Average standard deviation of split frequencies: 0.000000 765500 -- (-2517.646) (-2519.567) [-2525.855] (-2516.486) * [-2518.241] (-2516.065) (-2526.058) (-2522.123) -- 0:00:51 766000 -- [-2516.154] (-2521.015) (-2521.374) (-2518.185) * (-2518.751) (-2526.445) (-2523.342) [-2519.808] -- 0:00:51 766500 -- [-2521.678] (-2526.853) (-2519.151) (-2519.570) * (-2522.355) [-2516.651] (-2520.545) (-2516.563) -- 0:00:50 767000 -- (-2520.092) (-2527.580) [-2519.254] (-2525.231) * (-2524.017) (-2520.799) (-2525.111) [-2519.296] -- 0:00:50 767500 -- (-2521.410) (-2521.530) [-2518.474] (-2524.064) * [-2520.465] (-2519.528) (-2525.268) (-2525.940) -- 0:00:50 768000 -- (-2519.754) (-2524.242) [-2519.398] (-2519.964) * [-2518.112] (-2517.506) (-2519.123) (-2526.341) -- 0:00:50 768500 -- (-2520.405) [-2519.530] (-2517.601) (-2523.972) * (-2519.330) (-2518.215) (-2522.201) [-2524.620] -- 0:00:50 769000 -- [-2518.086] (-2519.354) (-2523.886) (-2520.733) * [-2519.037] (-2520.223) (-2521.122) (-2528.158) -- 0:00:50 769500 -- (-2518.283) [-2516.051] (-2524.900) (-2527.320) * (-2518.826) (-2525.724) [-2519.331] (-2522.482) -- 0:00:50 770000 -- (-2518.853) [-2518.452] (-2520.375) (-2526.301) * (-2520.174) (-2522.907) (-2521.299) [-2519.637] -- 0:00:50 Average standard deviation of split frequencies: 0.000000 770500 -- (-2523.876) [-2523.034] (-2523.619) (-2529.489) * (-2517.205) (-2533.921) (-2521.934) [-2520.095] -- 0:00:50 771000 -- (-2522.588) [-2523.257] (-2523.675) (-2522.930) * (-2518.711) (-2529.374) [-2523.074] (-2516.567) -- 0:00:49 771500 -- (-2528.907) [-2518.440] (-2526.602) (-2527.354) * (-2517.578) [-2518.908] (-2514.864) (-2520.522) -- 0:00:49 772000 -- (-2523.473) [-2518.923] (-2524.860) (-2526.729) * (-2528.192) (-2525.292) (-2515.810) [-2520.039] -- 0:00:49 772500 -- (-2520.729) (-2525.552) (-2527.131) [-2523.873] * (-2521.036) (-2524.929) (-2527.373) [-2518.739] -- 0:00:49 773000 -- (-2522.884) (-2522.482) (-2518.722) [-2519.354] * (-2519.909) (-2519.142) [-2521.392] (-2520.756) -- 0:00:49 773500 -- [-2521.748] (-2521.985) (-2522.864) (-2521.205) * (-2521.714) (-2522.228) (-2522.050) [-2520.462] -- 0:00:49 774000 -- (-2528.734) (-2526.597) (-2518.634) [-2519.295] * [-2519.966] (-2518.126) (-2522.173) (-2519.861) -- 0:00:49 774500 -- (-2522.917) (-2523.298) (-2517.317) [-2525.131] * (-2524.916) (-2528.119) (-2521.735) [-2518.875] -- 0:00:49 775000 -- (-2519.407) (-2524.787) (-2522.865) [-2520.329] * [-2516.938] (-2523.634) (-2525.712) (-2521.015) -- 0:00:49 Average standard deviation of split frequencies: 0.000000 775500 -- (-2517.550) (-2525.015) [-2516.125] (-2519.671) * (-2521.866) [-2524.786] (-2519.130) (-2521.815) -- 0:00:48 776000 -- (-2517.973) (-2530.923) [-2519.566] (-2519.623) * (-2529.994) (-2523.360) [-2518.757] (-2519.900) -- 0:00:48 776500 -- (-2522.678) (-2521.856) (-2520.656) [-2527.930] * (-2524.986) (-2525.045) [-2521.952] (-2517.739) -- 0:00:48 777000 -- (-2532.524) (-2521.033) [-2521.280] (-2521.035) * (-2522.705) [-2520.213] (-2518.784) (-2524.271) -- 0:00:48 777500 -- (-2524.814) (-2519.884) [-2520.708] (-2521.202) * [-2520.648] (-2525.082) (-2520.800) (-2522.756) -- 0:00:48 778000 -- (-2522.833) (-2521.980) [-2519.488] (-2523.336) * (-2522.067) (-2524.343) (-2519.398) [-2523.156] -- 0:00:48 778500 -- (-2525.203) (-2520.694) [-2516.490] (-2521.285) * (-2518.037) (-2521.639) (-2529.051) [-2524.057] -- 0:00:48 779000 -- (-2521.450) [-2518.733] (-2520.735) (-2521.596) * (-2519.222) (-2524.366) [-2519.608] (-2522.900) -- 0:00:48 779500 -- [-2521.592] (-2519.864) (-2520.327) (-2521.575) * (-2522.362) (-2518.968) [-2518.909] (-2527.026) -- 0:00:48 780000 -- [-2521.121] (-2515.603) (-2520.665) (-2520.322) * (-2523.640) (-2523.067) (-2524.067) [-2522.828] -- 0:00:47 Average standard deviation of split frequencies: 0.000000 780500 -- (-2525.916) [-2520.080] (-2520.977) (-2520.077) * (-2526.985) (-2522.109) (-2518.099) [-2520.696] -- 0:00:47 781000 -- (-2537.110) (-2518.693) (-2517.089) [-2519.261] * (-2519.415) (-2523.522) (-2520.306) [-2523.800] -- 0:00:47 781500 -- (-2521.582) (-2528.176) (-2524.169) [-2521.905] * (-2517.817) (-2523.116) (-2522.168) [-2529.315] -- 0:00:47 782000 -- [-2525.160] (-2518.750) (-2524.252) (-2525.130) * (-2522.457) (-2527.935) [-2518.347] (-2526.546) -- 0:00:47 782500 -- (-2521.161) (-2516.318) [-2526.992] (-2523.746) * [-2520.633] (-2525.996) (-2522.574) (-2520.156) -- 0:00:47 783000 -- (-2516.497) (-2516.315) (-2523.731) [-2523.108] * (-2524.690) (-2521.764) [-2517.382] (-2523.713) -- 0:00:47 783500 -- (-2523.653) (-2519.881) (-2522.090) [-2515.717] * (-2526.579) (-2518.557) (-2521.689) [-2523.398] -- 0:00:47 784000 -- (-2519.009) (-2521.439) [-2521.987] (-2519.137) * (-2520.400) (-2521.214) (-2520.723) [-2526.831] -- 0:00:47 784500 -- (-2518.794) (-2523.624) [-2517.997] (-2519.389) * (-2517.600) (-2519.966) (-2522.105) [-2523.438] -- 0:00:46 785000 -- [-2525.045] (-2521.724) (-2521.786) (-2518.993) * [-2520.411] (-2520.395) (-2523.825) (-2520.665) -- 0:00:46 Average standard deviation of split frequencies: 0.000000 785500 -- (-2524.860) (-2518.389) [-2519.024] (-2522.619) * (-2519.088) (-2520.003) (-2517.892) [-2522.586] -- 0:00:46 786000 -- (-2526.765) (-2524.435) [-2519.588] (-2525.463) * [-2517.140] (-2523.063) (-2521.170) (-2522.875) -- 0:00:46 786500 -- (-2521.239) (-2519.742) (-2522.292) [-2522.426] * (-2522.055) [-2526.112] (-2521.107) (-2531.791) -- 0:00:46 787000 -- (-2528.477) (-2523.133) (-2518.585) [-2518.695] * (-2523.061) [-2519.806] (-2527.099) (-2520.784) -- 0:00:46 787500 -- (-2518.865) (-2521.776) [-2519.787] (-2518.224) * (-2518.679) (-2518.880) (-2524.715) [-2519.681] -- 0:00:46 788000 -- (-2519.920) [-2520.855] (-2524.061) (-2523.923) * (-2520.628) (-2523.148) [-2521.670] (-2522.647) -- 0:00:46 788500 -- (-2522.153) [-2525.072] (-2527.422) (-2518.557) * [-2520.298] (-2522.387) (-2521.383) (-2522.162) -- 0:00:46 789000 -- (-2518.950) (-2522.422) [-2521.386] (-2519.530) * (-2526.567) (-2518.936) (-2522.680) [-2521.314] -- 0:00:45 789500 -- [-2518.254] (-2521.981) (-2524.244) (-2519.972) * (-2522.850) (-2519.348) (-2525.119) [-2521.247] -- 0:00:45 790000 -- [-2518.584] (-2521.476) (-2519.702) (-2517.809) * (-2522.934) (-2521.131) (-2519.490) [-2522.603] -- 0:00:45 Average standard deviation of split frequencies: 0.000000 790500 -- [-2521.088] (-2528.010) (-2515.440) (-2519.438) * [-2523.845] (-2525.715) (-2517.971) (-2521.177) -- 0:00:45 791000 -- (-2523.478) (-2528.126) [-2521.975] (-2521.801) * (-2523.034) [-2520.352] (-2519.864) (-2523.803) -- 0:00:45 791500 -- (-2524.616) [-2522.226] (-2518.855) (-2519.358) * (-2519.699) (-2519.633) (-2520.598) [-2516.376] -- 0:00:45 792000 -- (-2521.093) [-2523.444] (-2527.200) (-2519.332) * [-2525.115] (-2524.732) (-2528.154) (-2522.720) -- 0:00:45 792500 -- (-2521.269) (-2532.248) (-2520.936) [-2522.790] * (-2518.747) (-2521.398) [-2517.113] (-2517.500) -- 0:00:45 793000 -- [-2525.126] (-2522.282) (-2520.044) (-2520.062) * [-2521.143] (-2523.463) (-2520.261) (-2520.817) -- 0:00:45 793500 -- (-2524.525) (-2522.391) (-2518.836) [-2518.891] * (-2518.945) (-2515.973) [-2517.155] (-2523.523) -- 0:00:45 794000 -- (-2525.054) [-2520.066] (-2522.919) (-2525.581) * [-2525.287] (-2525.422) (-2527.623) (-2516.287) -- 0:00:44 794500 -- [-2517.741] (-2522.262) (-2519.010) (-2521.840) * (-2526.738) [-2522.629] (-2518.572) (-2522.489) -- 0:00:44 795000 -- [-2521.063] (-2520.550) (-2519.976) (-2523.369) * [-2522.014] (-2517.961) (-2524.639) (-2522.784) -- 0:00:44 Average standard deviation of split frequencies: 0.000000 795500 -- (-2519.297) (-2520.044) [-2517.484] (-2520.039) * (-2526.930) [-2518.154] (-2523.477) (-2516.650) -- 0:00:44 796000 -- (-2524.834) (-2521.896) (-2520.731) [-2525.534] * [-2520.652] (-2525.194) (-2521.183) (-2522.374) -- 0:00:44 796500 -- (-2519.756) (-2521.549) [-2526.301] (-2516.301) * (-2525.412) (-2519.188) (-2521.729) [-2520.833] -- 0:00:44 797000 -- [-2522.754] (-2522.434) (-2523.556) (-2525.796) * (-2525.073) (-2524.533) (-2520.603) [-2522.718] -- 0:00:44 797500 -- (-2521.430) [-2523.501] (-2527.463) (-2522.308) * [-2524.758] (-2519.050) (-2521.244) (-2523.490) -- 0:00:44 798000 -- [-2522.736] (-2523.151) (-2527.534) (-2534.116) * (-2520.934) (-2523.313) [-2527.812] (-2523.823) -- 0:00:44 798500 -- (-2525.855) (-2521.774) (-2523.979) [-2522.633] * (-2525.104) (-2520.622) [-2518.579] (-2516.988) -- 0:00:43 799000 -- (-2525.475) [-2520.851] (-2521.552) (-2523.247) * (-2519.403) (-2519.571) (-2529.118) [-2521.369] -- 0:00:43 799500 -- (-2524.954) (-2519.623) [-2517.483] (-2519.407) * [-2518.552] (-2529.358) (-2517.689) (-2521.822) -- 0:00:43 800000 -- (-2519.161) [-2521.664] (-2530.013) (-2520.664) * (-2519.458) (-2522.176) [-2518.115] (-2522.916) -- 0:00:43 Average standard deviation of split frequencies: 0.000000 800500 -- [-2522.462] (-2525.718) (-2524.676) (-2523.737) * (-2523.424) (-2523.762) [-2519.833] (-2524.720) -- 0:00:43 801000 -- (-2519.730) [-2523.717] (-2523.907) (-2520.664) * (-2523.596) (-2527.900) [-2522.797] (-2524.890) -- 0:00:43 801500 -- [-2516.972] (-2526.427) (-2521.210) (-2524.666) * (-2525.442) [-2524.309] (-2516.112) (-2523.769) -- 0:00:43 802000 -- (-2519.957) (-2524.966) (-2524.773) [-2516.928] * (-2525.975) (-2522.780) (-2518.213) [-2524.556] -- 0:00:43 802500 -- [-2524.401] (-2519.012) (-2521.807) (-2516.651) * (-2523.660) (-2519.161) (-2520.051) [-2518.120] -- 0:00:43 803000 -- [-2519.718] (-2524.172) (-2518.738) (-2520.942) * (-2521.441) (-2517.506) [-2518.335] (-2519.141) -- 0:00:42 803500 -- (-2530.438) (-2522.091) (-2522.822) [-2523.330] * [-2522.234] (-2523.305) (-2517.222) (-2529.533) -- 0:00:42 804000 -- (-2521.490) [-2520.339] (-2525.033) (-2518.299) * (-2521.579) (-2518.586) (-2534.049) [-2519.630] -- 0:00:42 804500 -- (-2517.366) [-2516.890] (-2515.978) (-2520.820) * [-2522.325] (-2520.754) (-2525.290) (-2520.232) -- 0:00:42 805000 -- (-2519.209) (-2518.487) [-2520.825] (-2525.097) * (-2521.426) [-2521.752] (-2520.201) (-2525.309) -- 0:00:42 Average standard deviation of split frequencies: 0.000000 805500 -- (-2521.121) (-2521.958) [-2521.456] (-2528.207) * (-2519.779) (-2522.064) [-2519.428] (-2523.769) -- 0:00:42 806000 -- [-2521.811] (-2520.629) (-2522.148) (-2534.612) * [-2524.096] (-2529.133) (-2517.693) (-2521.286) -- 0:00:42 806500 -- (-2522.025) (-2521.644) (-2527.329) [-2519.948] * (-2524.954) (-2524.763) (-2521.968) [-2519.789] -- 0:00:42 807000 -- [-2527.573] (-2519.237) (-2528.283) (-2530.658) * (-2528.444) (-2518.411) (-2524.081) [-2525.735] -- 0:00:42 807500 -- (-2523.481) (-2520.459) [-2520.527] (-2526.134) * (-2519.498) (-2522.816) [-2522.002] (-2522.229) -- 0:00:41 808000 -- (-2521.861) [-2520.690] (-2518.140) (-2522.244) * (-2521.359) (-2519.493) (-2516.102) [-2520.206] -- 0:00:41 808500 -- (-2524.070) (-2519.831) [-2516.291] (-2523.122) * (-2519.012) (-2527.414) (-2526.619) [-2517.933] -- 0:00:41 809000 -- (-2522.943) (-2520.396) [-2519.932] (-2520.484) * (-2520.679) (-2518.350) (-2521.930) [-2517.419] -- 0:00:41 809500 -- [-2523.208] (-2522.434) (-2523.939) (-2517.958) * (-2526.159) (-2516.960) (-2525.909) [-2521.583] -- 0:00:41 810000 -- (-2527.590) (-2525.716) [-2522.699] (-2522.950) * (-2523.423) (-2520.995) [-2521.932] (-2521.499) -- 0:00:41 Average standard deviation of split frequencies: 0.000000 810500 -- (-2518.709) (-2522.132) (-2521.084) [-2520.586] * (-2526.103) (-2521.667) (-2523.374) [-2521.921] -- 0:00:41 811000 -- (-2521.786) [-2519.096] (-2520.216) (-2527.003) * (-2530.176) (-2521.557) (-2520.809) [-2518.738] -- 0:00:41 811500 -- (-2518.357) (-2525.901) [-2516.523] (-2522.934) * (-2529.838) (-2516.437) (-2521.336) [-2517.555] -- 0:00:41 812000 -- (-2520.844) [-2517.711] (-2530.568) (-2526.102) * (-2519.936) [-2519.854] (-2524.673) (-2517.644) -- 0:00:40 812500 -- (-2516.744) (-2520.155) [-2517.586] (-2521.074) * (-2525.538) (-2525.014) (-2523.196) [-2515.265] -- 0:00:40 813000 -- [-2519.182] (-2520.626) (-2523.002) (-2520.467) * (-2520.510) [-2518.760] (-2521.452) (-2520.753) -- 0:00:40 813500 -- [-2523.996] (-2528.603) (-2518.280) (-2516.811) * (-2533.549) (-2519.401) (-2526.553) [-2521.065] -- 0:00:40 814000 -- (-2528.278) [-2522.446] (-2520.380) (-2519.899) * (-2515.738) (-2517.606) (-2521.233) [-2518.485] -- 0:00:40 814500 -- (-2528.843) (-2526.894) (-2517.272) [-2518.075] * (-2520.719) (-2520.752) (-2522.016) [-2517.976] -- 0:00:40 815000 -- (-2521.807) (-2525.908) (-2525.575) [-2520.274] * (-2528.482) [-2519.996] (-2522.071) (-2519.115) -- 0:00:40 Average standard deviation of split frequencies: 0.000000 815500 -- (-2519.856) (-2521.036) [-2524.850] (-2523.954) * (-2520.509) (-2520.505) [-2519.524] (-2517.979) -- 0:00:40 816000 -- (-2524.682) [-2520.759] (-2523.888) (-2520.982) * [-2522.030] (-2522.242) (-2526.513) (-2520.502) -- 0:00:40 816500 -- (-2526.589) (-2518.738) (-2519.419) [-2524.421] * (-2518.163) [-2520.814] (-2522.409) (-2528.351) -- 0:00:40 817000 -- (-2520.688) (-2522.032) (-2518.846) [-2520.810] * [-2520.855] (-2520.143) (-2520.921) (-2519.360) -- 0:00:39 817500 -- (-2516.423) (-2521.913) (-2517.006) [-2520.130] * (-2520.256) (-2520.986) (-2520.218) [-2521.988] -- 0:00:39 818000 -- (-2520.366) (-2525.598) (-2531.203) [-2520.688] * [-2518.294] (-2520.585) (-2528.833) (-2525.241) -- 0:00:39 818500 -- (-2518.748) (-2529.520) (-2519.612) [-2523.099] * (-2525.547) [-2519.865] (-2528.670) (-2521.322) -- 0:00:39 819000 -- (-2518.924) (-2526.636) [-2522.706] (-2523.604) * (-2523.255) (-2527.591) [-2517.399] (-2523.152) -- 0:00:39 819500 -- (-2522.481) (-2521.150) (-2517.974) [-2515.141] * (-2523.729) (-2520.450) (-2520.093) [-2522.836] -- 0:00:39 820000 -- [-2519.227] (-2525.514) (-2522.177) (-2520.053) * (-2518.595) (-2520.797) [-2525.179] (-2518.371) -- 0:00:39 Average standard deviation of split frequencies: 0.000000 820500 -- (-2528.564) (-2521.395) [-2521.382] (-2517.533) * (-2522.892) (-2525.464) (-2525.219) [-2526.156] -- 0:00:39 821000 -- [-2517.438] (-2519.934) (-2524.639) (-2522.833) * (-2519.180) (-2527.295) [-2520.511] (-2524.342) -- 0:00:39 821500 -- [-2517.076] (-2526.815) (-2517.831) (-2526.353) * (-2522.359) (-2521.240) [-2522.589] (-2519.656) -- 0:00:38 822000 -- [-2522.546] (-2527.488) (-2530.090) (-2524.820) * (-2518.191) [-2516.052] (-2519.577) (-2521.425) -- 0:00:38 822500 -- (-2522.240) [-2517.350] (-2525.266) (-2518.935) * [-2518.096] (-2516.150) (-2518.120) (-2518.276) -- 0:00:38 823000 -- (-2525.539) (-2526.223) (-2527.078) [-2524.741] * (-2520.694) (-2516.247) (-2524.611) [-2518.726] -- 0:00:38 823500 -- [-2516.799] (-2523.867) (-2527.665) (-2530.828) * (-2518.505) [-2521.514] (-2530.238) (-2522.802) -- 0:00:38 824000 -- (-2518.610) (-2527.153) (-2519.033) [-2519.308] * (-2516.827) [-2520.152] (-2521.856) (-2517.197) -- 0:00:38 824500 -- [-2519.582] (-2519.079) (-2519.656) (-2531.802) * (-2527.520) (-2524.223) [-2522.398] (-2519.234) -- 0:00:38 825000 -- [-2519.161] (-2524.015) (-2521.656) (-2526.518) * (-2523.919) [-2519.897] (-2518.513) (-2522.146) -- 0:00:38 Average standard deviation of split frequencies: 0.000000 825500 -- [-2519.529] (-2522.043) (-2527.809) (-2521.494) * (-2525.948) (-2522.210) (-2521.603) [-2521.541] -- 0:00:38 826000 -- (-2520.902) [-2524.270] (-2518.932) (-2523.640) * (-2523.334) (-2520.886) [-2520.813] (-2523.848) -- 0:00:37 826500 -- (-2520.027) [-2518.716] (-2525.365) (-2520.083) * (-2521.954) [-2517.258] (-2524.548) (-2530.815) -- 0:00:37 827000 -- (-2528.532) (-2520.934) (-2522.720) [-2524.001] * (-2520.588) (-2519.810) (-2518.470) [-2525.423] -- 0:00:37 827500 -- (-2525.131) (-2521.066) (-2523.107) [-2517.990] * (-2517.897) [-2523.506] (-2521.319) (-2521.644) -- 0:00:37 828000 -- (-2523.276) [-2522.293] (-2519.402) (-2531.011) * [-2525.686] (-2528.415) (-2524.007) (-2523.983) -- 0:00:37 828500 -- [-2526.349] (-2521.207) (-2525.706) (-2527.283) * (-2525.371) [-2524.737] (-2527.269) (-2518.922) -- 0:00:37 829000 -- (-2526.584) (-2517.153) [-2520.110] (-2519.981) * (-2530.948) (-2516.812) (-2527.292) [-2526.629] -- 0:00:37 829500 -- (-2522.895) (-2522.357) (-2519.090) [-2520.349] * (-2531.940) (-2518.962) [-2525.799] (-2522.277) -- 0:00:37 830000 -- (-2520.409) [-2522.703] (-2527.539) (-2526.106) * (-2523.096) (-2520.191) [-2521.568] (-2521.894) -- 0:00:37 Average standard deviation of split frequencies: 0.000000 830500 -- (-2521.017) (-2521.103) (-2523.023) [-2516.915] * (-2525.141) (-2532.868) [-2526.225] (-2521.994) -- 0:00:36 831000 -- [-2528.284] (-2523.493) (-2522.619) (-2526.735) * (-2523.838) [-2519.103] (-2525.293) (-2520.333) -- 0:00:36 831500 -- (-2520.697) [-2525.034] (-2521.123) (-2523.158) * [-2521.185] (-2521.995) (-2519.915) (-2518.685) -- 0:00:36 832000 -- [-2526.020] (-2516.058) (-2519.104) (-2522.672) * (-2531.002) (-2527.291) [-2520.402] (-2518.768) -- 0:00:36 832500 -- (-2519.011) (-2522.291) [-2524.078] (-2524.627) * (-2525.636) (-2518.339) [-2518.254] (-2520.566) -- 0:00:36 833000 -- (-2528.738) [-2522.032] (-2523.650) (-2522.705) * (-2525.899) (-2518.748) (-2524.392) [-2521.399] -- 0:00:36 833500 -- (-2525.748) [-2519.881] (-2520.687) (-2525.658) * (-2524.123) (-2522.919) (-2519.495) [-2518.803] -- 0:00:36 834000 -- (-2523.179) (-2522.140) [-2524.236] (-2523.148) * (-2522.925) (-2520.802) [-2517.975] (-2533.561) -- 0:00:36 834500 -- (-2524.173) [-2523.820] (-2525.442) (-2517.684) * [-2524.236] (-2519.371) (-2518.432) (-2523.440) -- 0:00:36 835000 -- (-2520.808) [-2524.241] (-2523.016) (-2520.620) * (-2528.538) (-2524.855) (-2521.432) [-2529.219] -- 0:00:35 Average standard deviation of split frequencies: 0.000000 835500 -- [-2517.445] (-2518.706) (-2520.452) (-2530.203) * (-2530.454) (-2518.687) [-2521.762] (-2533.306) -- 0:00:35 836000 -- (-2518.445) [-2520.874] (-2525.210) (-2522.078) * (-2521.357) (-2518.273) (-2516.709) [-2525.329] -- 0:00:35 836500 -- (-2523.951) (-2520.082) (-2522.685) [-2524.141] * (-2520.351) (-2518.781) (-2529.182) [-2525.184] -- 0:00:35 837000 -- [-2519.087] (-2528.538) (-2521.792) (-2520.237) * [-2527.082] (-2524.473) (-2528.260) (-2529.668) -- 0:00:35 837500 -- (-2524.000) (-2520.979) [-2516.949] (-2521.497) * [-2519.017] (-2519.849) (-2524.950) (-2518.670) -- 0:00:35 838000 -- (-2517.287) [-2524.414] (-2521.240) (-2524.106) * (-2521.366) (-2522.296) [-2520.969] (-2518.209) -- 0:00:35 838500 -- (-2521.382) [-2527.854] (-2518.367) (-2519.268) * (-2526.962) [-2519.295] (-2522.909) (-2518.783) -- 0:00:35 839000 -- [-2519.517] (-2516.048) (-2535.497) (-2521.111) * [-2524.624] (-2523.985) (-2516.443) (-2533.546) -- 0:00:35 839500 -- (-2520.749) [-2524.510] (-2520.590) (-2522.360) * (-2521.942) (-2518.438) [-2520.635] (-2519.723) -- 0:00:34 840000 -- (-2519.732) (-2526.735) [-2521.431] (-2516.027) * (-2525.674) (-2520.370) (-2519.454) [-2522.074] -- 0:00:34 Average standard deviation of split frequencies: 0.000000 840500 -- (-2519.731) (-2525.609) (-2524.296) [-2516.334] * (-2520.072) (-2524.445) (-2519.200) [-2523.163] -- 0:00:34 841000 -- (-2524.846) (-2523.213) [-2519.844] (-2522.441) * (-2525.224) [-2523.793] (-2521.368) (-2526.382) -- 0:00:34 841500 -- (-2533.439) (-2521.135) (-2518.607) [-2522.888] * (-2522.076) (-2523.628) (-2523.360) [-2521.294] -- 0:00:34 842000 -- (-2531.977) (-2517.653) [-2525.015] (-2520.478) * [-2520.731] (-2520.526) (-2521.001) (-2519.536) -- 0:00:34 842500 -- [-2522.350] (-2520.954) (-2523.760) (-2516.409) * (-2525.731) (-2519.075) (-2519.794) [-2517.211] -- 0:00:34 843000 -- (-2527.765) [-2522.131] (-2520.614) (-2524.766) * (-2529.186) (-2520.217) [-2524.319] (-2526.292) -- 0:00:34 843500 -- (-2518.002) (-2524.015) (-2520.779) [-2518.271] * (-2526.051) (-2521.512) [-2520.802] (-2520.177) -- 0:00:34 844000 -- (-2520.576) (-2522.649) (-2520.774) [-2521.763] * (-2518.889) (-2522.744) [-2519.918] (-2521.206) -- 0:00:34 844500 -- (-2527.513) (-2523.804) [-2522.404] (-2520.039) * (-2521.370) (-2519.188) (-2520.262) [-2518.661] -- 0:00:33 845000 -- (-2518.754) (-2520.503) (-2518.035) [-2518.987] * [-2532.010] (-2520.804) (-2521.736) (-2518.953) -- 0:00:33 Average standard deviation of split frequencies: 0.000000 845500 -- (-2523.791) (-2526.753) [-2520.437] (-2518.396) * [-2519.480] (-2524.420) (-2524.712) (-2520.089) -- 0:00:33 846000 -- [-2519.103] (-2521.423) (-2520.231) (-2526.489) * (-2522.992) [-2527.429] (-2532.133) (-2517.305) -- 0:00:33 846500 -- (-2520.955) [-2519.805] (-2524.828) (-2522.436) * (-2521.096) (-2521.135) (-2520.766) [-2518.940] -- 0:00:33 847000 -- (-2520.186) (-2518.455) (-2521.314) [-2522.965] * [-2517.976] (-2518.939) (-2521.656) (-2523.485) -- 0:00:33 847500 -- (-2519.956) (-2519.837) (-2520.681) [-2520.639] * [-2523.976] (-2518.438) (-2524.435) (-2521.660) -- 0:00:33 848000 -- (-2521.234) (-2523.858) (-2522.221) [-2517.180] * (-2524.666) (-2522.291) (-2523.642) [-2524.985] -- 0:00:33 848500 -- (-2522.229) (-2522.545) [-2519.702] (-2521.571) * (-2521.437) [-2523.521] (-2520.244) (-2520.525) -- 0:00:33 849000 -- (-2524.494) (-2521.992) [-2519.910] (-2521.578) * (-2524.091) [-2520.544] (-2527.744) (-2522.996) -- 0:00:32 849500 -- [-2516.704] (-2520.599) (-2527.855) (-2519.294) * (-2525.889) [-2520.394] (-2522.741) (-2520.243) -- 0:00:32 850000 -- [-2519.491] (-2519.774) (-2525.931) (-2523.230) * (-2518.304) (-2528.399) (-2520.391) [-2516.589] -- 0:00:32 Average standard deviation of split frequencies: 0.000000 850500 -- (-2527.806) (-2522.601) [-2532.971] (-2522.761) * (-2516.034) [-2519.255] (-2526.413) (-2521.475) -- 0:00:32 851000 -- (-2521.807) (-2536.826) (-2520.343) [-2525.685] * (-2517.991) [-2520.655] (-2520.179) (-2520.541) -- 0:00:32 851500 -- (-2518.860) (-2522.099) (-2524.666) [-2520.068] * (-2517.214) (-2518.285) (-2522.240) [-2520.152] -- 0:00:32 852000 -- (-2524.716) [-2522.184] (-2530.268) (-2527.788) * [-2519.705] (-2520.949) (-2519.693) (-2525.539) -- 0:00:32 852500 -- [-2529.790] (-2525.113) (-2520.085) (-2519.905) * [-2514.996] (-2524.338) (-2519.370) (-2517.887) -- 0:00:32 853000 -- (-2521.808) [-2520.340] (-2524.549) (-2520.231) * [-2522.006] (-2522.054) (-2522.648) (-2519.952) -- 0:00:32 853500 -- (-2522.231) [-2522.748] (-2517.623) (-2517.933) * [-2520.061] (-2518.208) (-2521.584) (-2525.948) -- 0:00:31 854000 -- [-2525.906] (-2518.034) (-2519.831) (-2522.161) * (-2522.640) (-2524.264) (-2526.715) [-2518.053] -- 0:00:31 854500 -- (-2525.928) (-2522.653) (-2526.038) [-2522.159] * (-2521.633) (-2521.784) (-2520.917) [-2526.775] -- 0:00:31 855000 -- [-2520.145] (-2524.734) (-2524.751) (-2524.366) * (-2524.254) (-2525.073) [-2519.372] (-2525.281) -- 0:00:31 Average standard deviation of split frequencies: 0.000000 855500 -- [-2518.982] (-2525.658) (-2519.684) (-2519.697) * (-2521.652) (-2524.454) [-2518.700] (-2516.185) -- 0:00:31 856000 -- (-2520.293) (-2524.523) [-2519.663] (-2516.115) * (-2523.551) (-2518.462) [-2519.963] (-2524.013) -- 0:00:31 856500 -- (-2518.097) [-2518.010] (-2520.386) (-2522.808) * (-2517.824) (-2520.529) [-2514.403] (-2522.920) -- 0:00:31 857000 -- (-2525.666) [-2519.905] (-2521.428) (-2516.309) * (-2524.265) [-2525.903] (-2526.456) (-2529.049) -- 0:00:31 857500 -- (-2524.523) (-2524.323) [-2519.539] (-2519.715) * [-2521.200] (-2522.547) (-2521.305) (-2522.939) -- 0:00:31 858000 -- [-2522.400] (-2525.020) (-2524.663) (-2523.493) * (-2522.485) (-2523.806) (-2521.747) [-2519.692] -- 0:00:30 858500 -- [-2514.578] (-2522.191) (-2525.562) (-2522.497) * (-2519.405) (-2519.877) (-2522.526) [-2518.700] -- 0:00:30 859000 -- [-2516.866] (-2521.935) (-2528.812) (-2524.970) * (-2525.577) (-2518.524) (-2524.758) [-2523.302] -- 0:00:30 859500 -- [-2517.509] (-2521.837) (-2528.977) (-2518.524) * (-2522.134) (-2524.989) [-2523.269] (-2522.951) -- 0:00:30 860000 -- (-2517.417) (-2526.014) [-2524.028] (-2521.269) * (-2522.909) (-2523.416) [-2522.852] (-2521.813) -- 0:00:30 Average standard deviation of split frequencies: 0.000000 860500 -- [-2519.020] (-2525.486) (-2528.579) (-2523.672) * (-2525.857) (-2525.595) (-2522.685) [-2518.453] -- 0:00:30 861000 -- (-2521.370) [-2519.623] (-2530.923) (-2522.769) * (-2534.514) (-2527.952) (-2523.155) [-2515.733] -- 0:00:30 861500 -- (-2521.887) (-2518.505) [-2518.820] (-2528.272) * (-2523.214) (-2526.447) [-2522.872] (-2518.230) -- 0:00:30 862000 -- (-2520.658) (-2525.589) [-2518.008] (-2524.572) * [-2518.874] (-2523.278) (-2522.048) (-2524.289) -- 0:00:30 862500 -- [-2518.680] (-2517.843) (-2519.704) (-2527.735) * [-2525.945] (-2530.313) (-2520.656) (-2515.970) -- 0:00:29 863000 -- (-2518.925) [-2518.921] (-2519.185) (-2515.686) * (-2522.636) (-2522.397) [-2525.524] (-2522.504) -- 0:00:29 863500 -- (-2526.325) [-2520.297] (-2527.837) (-2527.596) * (-2531.445) [-2520.084] (-2521.514) (-2516.258) -- 0:00:29 864000 -- [-2516.493] (-2527.043) (-2525.584) (-2523.668) * (-2521.057) (-2529.591) (-2518.778) [-2517.561] -- 0:00:29 864500 -- [-2522.461] (-2527.618) (-2525.140) (-2519.226) * (-2521.476) (-2519.039) [-2518.735] (-2527.009) -- 0:00:29 865000 -- (-2519.513) (-2529.308) [-2524.136] (-2519.644) * (-2518.886) (-2520.457) [-2526.544] (-2526.895) -- 0:00:29 Average standard deviation of split frequencies: 0.000000 865500 -- (-2523.743) [-2516.181] (-2518.910) (-2525.431) * [-2523.272] (-2522.096) (-2518.301) (-2522.630) -- 0:00:29 866000 -- (-2516.811) (-2528.726) (-2521.178) [-2522.659] * (-2519.329) [-2525.482] (-2524.815) (-2519.299) -- 0:00:29 866500 -- [-2523.399] (-2527.407) (-2521.951) (-2518.983) * (-2520.750) (-2527.511) (-2528.947) [-2520.792] -- 0:00:29 867000 -- (-2529.088) (-2526.576) (-2522.128) [-2522.236] * (-2520.717) (-2518.188) (-2522.909) [-2520.868] -- 0:00:28 867500 -- (-2517.266) [-2522.261] (-2529.114) (-2524.430) * (-2519.008) (-2521.277) (-2521.961) [-2520.770] -- 0:00:28 868000 -- (-2522.805) [-2521.479] (-2524.250) (-2517.127) * (-2521.937) (-2525.029) (-2526.166) [-2524.174] -- 0:00:28 868500 -- [-2519.837] (-2520.678) (-2526.506) (-2516.783) * (-2522.970) [-2519.023] (-2519.688) (-2519.438) -- 0:00:28 869000 -- (-2519.600) (-2517.998) (-2521.998) [-2519.373] * (-2523.423) (-2518.103) (-2524.494) [-2518.528] -- 0:00:28 869500 -- (-2527.461) (-2522.968) [-2519.779] (-2522.223) * [-2523.626] (-2524.571) (-2529.976) (-2519.508) -- 0:00:28 870000 -- (-2527.040) (-2521.973) (-2527.551) [-2515.987] * [-2520.463] (-2520.777) (-2524.909) (-2522.172) -- 0:00:28 Average standard deviation of split frequencies: 0.000000 870500 -- (-2520.228) [-2523.917] (-2526.569) (-2521.354) * (-2523.892) [-2519.428] (-2522.119) (-2517.283) -- 0:00:28 871000 -- (-2520.858) (-2525.095) [-2520.827] (-2523.208) * (-2524.763) (-2523.024) (-2532.507) [-2517.770] -- 0:00:28 871500 -- (-2522.399) (-2520.211) [-2525.270] (-2520.418) * (-2520.661) (-2521.276) [-2522.295] (-2522.393) -- 0:00:28 872000 -- (-2519.171) [-2518.629] (-2521.491) (-2524.240) * (-2529.514) (-2520.096) (-2524.131) [-2523.443] -- 0:00:27 872500 -- [-2521.188] (-2517.513) (-2527.586) (-2516.107) * (-2519.313) [-2519.055] (-2521.102) (-2519.436) -- 0:00:27 873000 -- (-2516.925) [-2519.031] (-2520.657) (-2530.607) * (-2523.483) (-2517.282) [-2526.329] (-2527.625) -- 0:00:27 873500 -- (-2518.511) [-2523.475] (-2519.364) (-2528.873) * (-2522.024) [-2517.668] (-2520.848) (-2521.865) -- 0:00:27 874000 -- [-2522.437] (-2520.726) (-2523.429) (-2520.807) * [-2518.367] (-2520.187) (-2517.182) (-2522.340) -- 0:00:27 874500 -- (-2520.586) (-2519.573) (-2518.487) [-2527.193] * [-2517.459] (-2524.338) (-2514.533) (-2525.980) -- 0:00:27 875000 -- (-2531.535) (-2523.043) [-2517.419] (-2522.691) * (-2519.695) (-2522.110) (-2526.433) [-2522.947] -- 0:00:27 Average standard deviation of split frequencies: 0.000000 875500 -- (-2521.295) (-2522.720) (-2519.172) [-2521.242] * (-2526.579) (-2523.301) [-2520.072] (-2517.606) -- 0:00:27 876000 -- (-2525.077) (-2527.709) (-2527.088) [-2520.491] * [-2520.129] (-2519.204) (-2520.494) (-2526.393) -- 0:00:27 876500 -- (-2517.914) (-2525.616) [-2518.551] (-2516.760) * (-2523.566) (-2518.763) [-2519.232] (-2530.139) -- 0:00:26 877000 -- (-2523.627) (-2527.951) [-2517.418] (-2523.742) * (-2529.358) [-2520.390] (-2532.553) (-2527.110) -- 0:00:26 877500 -- (-2520.241) (-2522.892) (-2520.809) [-2517.675] * (-2525.083) (-2524.212) (-2525.727) [-2516.250] -- 0:00:26 878000 -- (-2518.701) (-2522.510) (-2521.787) [-2523.037] * (-2521.790) (-2523.323) [-2526.847] (-2521.153) -- 0:00:26 878500 -- [-2520.103] (-2519.587) (-2519.912) (-2525.339) * [-2519.377] (-2523.485) (-2524.251) (-2521.901) -- 0:00:26 879000 -- (-2523.373) (-2521.179) (-2521.019) [-2520.374] * [-2520.233] (-2523.860) (-2528.605) (-2519.854) -- 0:00:26 879500 -- (-2522.915) (-2522.962) (-2523.912) [-2521.430] * (-2517.061) (-2527.978) (-2524.867) [-2518.407] -- 0:00:26 880000 -- [-2521.677] (-2524.528) (-2524.060) (-2526.006) * (-2524.223) (-2525.652) [-2516.246] (-2522.021) -- 0:00:26 Average standard deviation of split frequencies: 0.000000 880500 -- [-2523.587] (-2523.666) (-2527.833) (-2531.534) * (-2518.683) (-2516.450) (-2520.572) [-2520.683] -- 0:00:26 881000 -- (-2521.671) [-2519.444] (-2529.325) (-2527.872) * [-2519.790] (-2529.042) (-2526.520) (-2516.047) -- 0:00:25 881500 -- (-2519.395) [-2526.943] (-2532.101) (-2524.046) * (-2530.559) (-2530.163) [-2524.979] (-2532.797) -- 0:00:25 882000 -- (-2517.232) [-2522.151] (-2523.538) (-2522.226) * (-2521.142) (-2526.306) (-2524.704) [-2520.186] -- 0:00:25 882500 -- [-2518.178] (-2518.386) (-2522.602) (-2521.051) * (-2522.872) (-2520.348) (-2522.501) [-2523.482] -- 0:00:25 883000 -- (-2521.733) [-2518.424] (-2522.568) (-2519.521) * (-2532.144) [-2521.360] (-2520.522) (-2521.029) -- 0:00:25 883500 -- (-2522.118) [-2518.897] (-2519.524) (-2529.416) * (-2534.296) [-2522.003] (-2520.302) (-2517.818) -- 0:00:25 884000 -- (-2516.645) (-2522.459) (-2525.030) [-2531.613] * (-2526.895) [-2521.425] (-2521.353) (-2520.460) -- 0:00:25 884500 -- [-2519.374] (-2518.506) (-2523.507) (-2522.782) * (-2519.281) (-2517.825) (-2521.975) [-2522.507] -- 0:00:25 885000 -- (-2523.728) [-2518.352] (-2531.071) (-2525.459) * (-2517.518) (-2522.479) (-2517.626) [-2518.678] -- 0:00:25 Average standard deviation of split frequencies: 0.000000 885500 -- (-2524.754) (-2519.711) [-2519.263] (-2519.293) * (-2517.152) (-2520.847) [-2517.963] (-2520.382) -- 0:00:24 886000 -- (-2519.120) [-2520.603] (-2517.671) (-2521.509) * (-2522.000) [-2523.463] (-2519.765) (-2520.263) -- 0:00:24 886500 -- [-2520.077] (-2530.088) (-2520.620) (-2520.056) * (-2521.976) (-2520.580) (-2529.579) [-2523.883] -- 0:00:24 887000 -- [-2519.586] (-2518.925) (-2525.594) (-2527.570) * (-2523.622) (-2520.995) [-2520.055] (-2522.614) -- 0:00:24 887500 -- [-2520.302] (-2522.707) (-2524.655) (-2523.682) * (-2530.142) (-2524.983) (-2516.408) [-2515.633] -- 0:00:24 888000 -- (-2516.887) (-2521.729) (-2524.351) [-2519.563] * (-2521.312) (-2530.727) (-2521.548) [-2520.583] -- 0:00:24 888500 -- (-2525.826) (-2525.538) (-2519.138) [-2515.731] * (-2523.850) (-2526.164) [-2519.904] (-2520.105) -- 0:00:24 889000 -- (-2526.566) (-2522.238) (-2524.122) [-2515.583] * (-2521.486) (-2525.450) [-2524.361] (-2525.781) -- 0:00:24 889500 -- (-2518.050) (-2519.718) (-2517.090) [-2519.705] * (-2519.381) (-2532.864) (-2522.357) [-2519.245] -- 0:00:24 890000 -- (-2523.916) (-2526.998) (-2531.354) [-2521.646] * [-2520.058] (-2521.052) (-2523.172) (-2521.869) -- 0:00:23 Average standard deviation of split frequencies: 0.000000 890500 -- [-2521.109] (-2517.404) (-2521.444) (-2518.183) * (-2523.770) [-2521.446] (-2528.267) (-2521.341) -- 0:00:23 891000 -- (-2527.218) (-2517.870) [-2519.304] (-2520.421) * (-2522.570) [-2517.303] (-2521.413) (-2524.517) -- 0:00:23 891500 -- (-2522.527) (-2519.496) (-2521.236) [-2521.381] * (-2519.252) [-2521.146] (-2523.274) (-2525.231) -- 0:00:23 892000 -- (-2523.103) (-2519.367) (-2519.680) [-2517.301] * [-2518.260] (-2519.342) (-2520.821) (-2528.453) -- 0:00:23 892500 -- [-2520.389] (-2521.520) (-2520.498) (-2517.499) * (-2532.002) (-2520.827) (-2519.530) [-2519.069] -- 0:00:23 893000 -- (-2526.072) [-2521.984] (-2524.841) (-2525.228) * (-2525.208) [-2523.256] (-2519.643) (-2521.126) -- 0:00:23 893500 -- (-2521.691) [-2518.289] (-2522.006) (-2524.769) * (-2519.656) (-2519.279) (-2520.919) [-2522.600] -- 0:00:23 894000 -- (-2519.726) (-2519.612) (-2523.519) [-2526.569] * (-2519.598) [-2525.595] (-2523.041) (-2526.127) -- 0:00:23 894500 -- (-2523.462) (-2521.366) (-2522.888) [-2522.601] * [-2520.084] (-2524.167) (-2518.788) (-2525.128) -- 0:00:22 895000 -- (-2528.720) (-2531.817) [-2519.076] (-2521.163) * (-2521.466) (-2525.509) [-2525.472] (-2520.024) -- 0:00:22 Average standard deviation of split frequencies: 0.000000 895500 -- [-2523.044] (-2523.758) (-2518.938) (-2521.557) * (-2518.825) [-2517.741] (-2525.344) (-2525.545) -- 0:00:22 896000 -- (-2526.710) (-2520.911) (-2518.712) [-2520.017] * (-2521.719) (-2522.287) [-2517.748] (-2524.656) -- 0:00:22 896500 -- (-2531.424) (-2517.512) [-2517.895] (-2517.580) * (-2524.391) [-2525.235] (-2523.554) (-2522.768) -- 0:00:22 897000 -- (-2527.437) (-2521.774) [-2520.996] (-2520.452) * (-2526.975) (-2521.091) [-2519.048] (-2524.546) -- 0:00:22 897500 -- [-2520.756] (-2520.475) (-2522.789) (-2518.680) * [-2521.433] (-2519.160) (-2518.343) (-2524.753) -- 0:00:22 898000 -- (-2518.023) (-2518.765) [-2523.610] (-2526.091) * (-2526.875) [-2521.614] (-2517.642) (-2522.362) -- 0:00:22 898500 -- (-2525.621) (-2520.169) [-2524.255] (-2517.630) * (-2525.551) [-2518.308] (-2523.687) (-2520.286) -- 0:00:22 899000 -- [-2528.304] (-2525.825) (-2520.078) (-2518.722) * (-2523.716) (-2523.761) (-2523.248) [-2523.172] -- 0:00:22 899500 -- (-2530.910) [-2525.894] (-2521.408) (-2519.476) * (-2522.095) [-2519.091] (-2524.472) (-2523.854) -- 0:00:21 900000 -- (-2528.096) (-2521.348) (-2525.514) [-2519.530] * (-2522.808) [-2521.293] (-2525.178) (-2525.246) -- 0:00:21 Average standard deviation of split frequencies: 0.000000 900500 -- (-2524.548) [-2518.183] (-2524.296) (-2516.754) * (-2517.425) (-2519.201) [-2527.105] (-2528.093) -- 0:00:21 901000 -- (-2526.726) (-2515.659) [-2521.295] (-2524.775) * [-2518.113] (-2528.119) (-2522.708) (-2522.223) -- 0:00:21 901500 -- [-2522.415] (-2515.378) (-2519.098) (-2520.966) * [-2518.990] (-2521.683) (-2520.496) (-2523.110) -- 0:00:21 902000 -- [-2521.869] (-2516.640) (-2525.577) (-2525.740) * (-2525.401) [-2523.698] (-2521.038) (-2521.445) -- 0:00:21 902500 -- [-2517.993] (-2519.937) (-2524.164) (-2519.726) * (-2520.027) (-2518.226) [-2525.899] (-2523.998) -- 0:00:21 903000 -- (-2523.849) [-2518.345] (-2519.417) (-2520.835) * (-2518.630) (-2523.361) [-2521.999] (-2521.695) -- 0:00:21 903500 -- [-2520.322] (-2521.587) (-2520.649) (-2523.434) * (-2528.450) (-2519.099) [-2521.087] (-2524.889) -- 0:00:21 904000 -- (-2519.412) (-2523.681) [-2523.223] (-2523.506) * (-2529.786) (-2522.999) [-2519.057] (-2524.942) -- 0:00:20 904500 -- (-2519.641) (-2524.953) (-2521.570) [-2523.325] * [-2521.169] (-2525.334) (-2521.470) (-2530.735) -- 0:00:20 905000 -- (-2518.979) (-2518.998) [-2522.171] (-2521.495) * (-2527.824) (-2528.909) (-2519.490) [-2528.913] -- 0:00:20 Average standard deviation of split frequencies: 0.000000 905500 -- (-2521.195) (-2522.309) (-2531.562) [-2524.149] * (-2527.847) [-2526.961] (-2521.287) (-2521.275) -- 0:00:20 906000 -- (-2517.219) [-2516.639] (-2523.421) (-2519.685) * [-2523.001] (-2522.522) (-2520.116) (-2519.837) -- 0:00:20 906500 -- (-2519.444) [-2517.586] (-2518.631) (-2531.050) * (-2520.695) [-2518.351] (-2521.940) (-2523.562) -- 0:00:20 907000 -- (-2518.463) (-2526.174) (-2522.032) [-2520.954] * [-2523.049] (-2521.682) (-2521.075) (-2524.350) -- 0:00:20 907500 -- (-2521.951) [-2520.864] (-2523.463) (-2530.788) * [-2521.255] (-2525.532) (-2519.323) (-2520.141) -- 0:00:20 908000 -- [-2519.326] (-2523.148) (-2518.666) (-2524.623) * (-2521.818) (-2521.290) [-2523.935] (-2518.669) -- 0:00:20 908500 -- (-2520.243) (-2526.310) (-2523.130) [-2520.554] * [-2520.081] (-2522.538) (-2522.125) (-2520.717) -- 0:00:19 909000 -- (-2517.535) (-2524.545) [-2527.640] (-2523.030) * (-2521.342) [-2521.762] (-2526.981) (-2524.234) -- 0:00:19 909500 -- (-2535.403) [-2519.441] (-2521.358) (-2522.804) * (-2521.193) [-2523.632] (-2525.163) (-2522.028) -- 0:00:19 910000 -- [-2523.682] (-2524.101) (-2518.950) (-2523.093) * (-2518.294) [-2520.309] (-2523.446) (-2518.442) -- 0:00:19 Average standard deviation of split frequencies: 0.000000 910500 -- [-2524.912] (-2519.271) (-2526.294) (-2520.951) * (-2517.843) [-2521.539] (-2522.869) (-2523.537) -- 0:00:19 911000 -- [-2517.564] (-2521.771) (-2523.722) (-2525.036) * (-2518.057) (-2522.848) (-2528.350) [-2518.981] -- 0:00:19 911500 -- (-2519.790) [-2525.655] (-2522.808) (-2526.658) * (-2517.765) (-2531.248) [-2518.504] (-2520.155) -- 0:00:19 912000 -- (-2525.610) (-2521.965) [-2520.579] (-2515.583) * [-2520.400] (-2521.858) (-2518.584) (-2523.231) -- 0:00:19 912500 -- (-2528.192) (-2523.313) [-2521.589] (-2518.859) * [-2521.532] (-2518.601) (-2518.465) (-2520.860) -- 0:00:19 913000 -- (-2519.699) (-2522.956) [-2517.714] (-2526.653) * [-2521.393] (-2521.128) (-2527.341) (-2519.338) -- 0:00:18 913500 -- [-2517.808] (-2527.908) (-2514.489) (-2527.273) * [-2523.286] (-2520.581) (-2521.079) (-2522.173) -- 0:00:18 914000 -- [-2519.222] (-2520.808) (-2520.945) (-2531.754) * (-2524.209) (-2519.005) (-2523.365) [-2517.472] -- 0:00:18 914500 -- [-2518.633] (-2524.296) (-2520.100) (-2527.644) * (-2521.938) (-2517.819) [-2523.909] (-2517.582) -- 0:00:18 915000 -- (-2522.798) (-2524.695) [-2517.467] (-2527.874) * (-2525.023) (-2518.617) (-2521.345) [-2523.696] -- 0:00:18 Average standard deviation of split frequencies: 0.000000 915500 -- (-2525.013) (-2521.081) [-2525.020] (-2530.719) * (-2520.752) (-2518.477) (-2522.864) [-2520.126] -- 0:00:18 916000 -- [-2520.354] (-2525.359) (-2520.125) (-2527.477) * (-2523.995) (-2523.730) [-2523.907] (-2518.526) -- 0:00:18 916500 -- [-2520.628] (-2522.898) (-2522.442) (-2525.667) * (-2522.312) (-2521.922) (-2516.108) [-2523.889] -- 0:00:18 917000 -- (-2524.356) (-2525.918) (-2518.954) [-2518.301] * [-2517.509] (-2522.999) (-2518.811) (-2519.364) -- 0:00:18 917500 -- (-2520.977) (-2518.627) [-2518.371] (-2524.765) * (-2520.120) (-2521.535) [-2518.080] (-2529.303) -- 0:00:17 918000 -- [-2517.283] (-2524.079) (-2523.970) (-2521.045) * (-2520.413) [-2522.320] (-2522.797) (-2530.587) -- 0:00:17 918500 -- (-2520.331) (-2527.476) [-2518.850] (-2523.993) * [-2522.536] (-2527.855) (-2523.943) (-2526.817) -- 0:00:17 919000 -- [-2522.950] (-2521.709) (-2520.483) (-2523.710) * [-2520.083] (-2524.546) (-2524.564) (-2524.881) -- 0:00:17 919500 -- (-2518.750) [-2520.707] (-2534.067) (-2529.898) * (-2528.768) (-2529.887) [-2517.446] (-2521.610) -- 0:00:17 920000 -- (-2528.761) (-2521.175) (-2521.734) [-2523.357] * (-2521.727) (-2523.615) [-2524.388] (-2522.377) -- 0:00:17 Average standard deviation of split frequencies: 0.000000 920500 -- (-2518.508) (-2521.930) [-2524.441] (-2526.642) * [-2520.867] (-2523.603) (-2524.484) (-2520.301) -- 0:00:17 921000 -- (-2519.426) (-2523.742) (-2521.914) [-2519.023] * (-2522.749) (-2520.935) (-2533.070) [-2525.055] -- 0:00:17 921500 -- (-2515.443) (-2529.265) (-2522.465) [-2517.808] * [-2519.302] (-2528.667) (-2524.516) (-2522.698) -- 0:00:17 922000 -- (-2524.292) (-2526.617) (-2525.804) [-2515.377] * [-2516.360] (-2527.136) (-2519.506) (-2529.669) -- 0:00:17 922500 -- [-2519.827] (-2523.633) (-2522.567) (-2528.547) * (-2523.505) (-2524.150) [-2525.952] (-2523.098) -- 0:00:16 923000 -- (-2522.340) (-2520.913) [-2526.931] (-2520.444) * (-2519.705) (-2520.905) [-2520.787] (-2523.208) -- 0:00:16 923500 -- (-2520.542) (-2520.668) (-2530.585) [-2515.414] * [-2519.379] (-2519.084) (-2526.521) (-2520.398) -- 0:00:16 924000 -- (-2521.110) (-2524.876) (-2525.083) [-2520.160] * (-2522.290) [-2516.802] (-2518.343) (-2521.087) -- 0:00:16 924500 -- [-2521.231] (-2525.495) (-2518.207) (-2522.336) * (-2526.224) (-2523.459) (-2532.467) [-2518.932] -- 0:00:16 925000 -- (-2518.540) [-2524.318] (-2521.669) (-2521.969) * (-2524.104) (-2524.922) (-2524.505) [-2521.509] -- 0:00:16 Average standard deviation of split frequencies: 0.000000 925500 -- (-2518.878) (-2526.585) (-2519.343) [-2526.229] * (-2526.114) (-2522.824) (-2520.521) [-2519.948] -- 0:00:16 926000 -- (-2526.116) [-2521.852] (-2517.645) (-2522.840) * (-2527.733) [-2521.856] (-2521.225) (-2519.274) -- 0:00:16 926500 -- (-2527.781) (-2523.146) (-2520.651) [-2522.731] * (-2519.808) [-2523.251] (-2524.138) (-2518.408) -- 0:00:16 927000 -- (-2526.835) [-2529.272] (-2515.600) (-2520.742) * [-2520.132] (-2530.709) (-2524.664) (-2520.663) -- 0:00:15 927500 -- (-2524.412) [-2529.758] (-2520.751) (-2520.490) * [-2522.413] (-2521.315) (-2527.086) (-2518.001) -- 0:00:15 928000 -- (-2525.744) (-2514.845) (-2516.991) [-2520.717] * (-2523.659) (-2525.901) [-2522.442] (-2525.948) -- 0:00:15 928500 -- (-2528.976) [-2517.929] (-2517.589) (-2519.344) * (-2526.927) (-2522.226) [-2518.248] (-2527.904) -- 0:00:15 929000 -- [-2525.486] (-2524.537) (-2518.944) (-2518.860) * (-2529.469) (-2524.275) (-2525.881) [-2519.879] -- 0:00:15 929500 -- [-2520.521] (-2524.700) (-2517.706) (-2523.593) * (-2524.755) (-2518.050) (-2529.972) [-2522.923] -- 0:00:15 930000 -- [-2520.912] (-2517.465) (-2519.295) (-2517.117) * (-2523.155) (-2527.434) (-2522.196) [-2523.043] -- 0:00:15 Average standard deviation of split frequencies: 0.000000 930500 -- (-2525.082) [-2524.640] (-2522.003) (-2518.370) * (-2526.041) (-2523.347) [-2524.669] (-2522.349) -- 0:00:15 931000 -- [-2521.990] (-2521.638) (-2517.470) (-2519.084) * (-2520.535) [-2517.701] (-2523.628) (-2520.625) -- 0:00:15 931500 -- [-2526.274] (-2521.099) (-2520.113) (-2514.286) * (-2516.421) (-2518.496) (-2525.049) [-2519.025] -- 0:00:14 932000 -- (-2521.545) (-2520.953) (-2524.010) [-2522.621] * (-2525.531) [-2520.215] (-2522.938) (-2518.320) -- 0:00:14 932500 -- (-2520.752) (-2524.631) [-2520.230] (-2526.064) * [-2516.231] (-2523.171) (-2524.304) (-2518.887) -- 0:00:14 933000 -- (-2517.862) [-2519.842] (-2522.364) (-2518.557) * [-2515.697] (-2522.052) (-2521.765) (-2523.613) -- 0:00:14 933500 -- (-2525.315) [-2525.275] (-2521.800) (-2527.666) * [-2519.210] (-2527.370) (-2520.763) (-2520.728) -- 0:00:14 934000 -- (-2521.446) (-2518.835) [-2521.507] (-2523.498) * (-2525.712) [-2518.879] (-2521.661) (-2522.817) -- 0:00:14 934500 -- (-2521.603) (-2522.581) [-2516.759] (-2520.843) * (-2517.644) (-2518.506) [-2519.097] (-2514.852) -- 0:00:14 935000 -- (-2525.479) (-2522.987) [-2521.366] (-2520.319) * [-2519.744] (-2519.336) (-2523.406) (-2516.104) -- 0:00:14 Average standard deviation of split frequencies: 0.000000 935500 -- (-2520.390) (-2533.854) (-2524.811) [-2523.158] * (-2519.770) (-2520.668) (-2517.730) [-2522.900] -- 0:00:14 936000 -- [-2521.026] (-2522.510) (-2525.389) (-2521.417) * [-2521.876] (-2518.606) (-2515.821) (-2523.899) -- 0:00:13 936500 -- (-2517.738) (-2519.659) [-2518.927] (-2522.427) * (-2522.292) (-2525.685) (-2523.399) [-2515.939] -- 0:00:13 937000 -- (-2526.804) (-2529.966) (-2523.078) [-2517.529] * (-2521.918) (-2517.676) [-2519.972] (-2524.564) -- 0:00:13 937500 -- (-2521.836) [-2525.337] (-2524.918) (-2520.210) * (-2519.980) [-2519.591] (-2527.433) (-2522.981) -- 0:00:13 938000 -- (-2522.461) (-2521.602) (-2527.233) [-2525.124] * (-2519.672) [-2517.882] (-2523.476) (-2523.468) -- 0:00:13 938500 -- (-2520.384) (-2520.928) (-2528.554) [-2517.434] * (-2518.309) (-2515.863) [-2521.111] (-2525.438) -- 0:00:13 939000 -- (-2529.838) [-2520.839] (-2523.744) (-2517.123) * (-2525.369) (-2519.262) [-2521.774] (-2521.034) -- 0:00:13 939500 -- [-2525.132] (-2523.616) (-2525.310) (-2526.941) * (-2521.200) [-2518.543] (-2526.060) (-2522.936) -- 0:00:13 940000 -- (-2524.585) (-2528.338) (-2523.956) [-2520.328] * (-2520.551) (-2517.372) [-2525.348] (-2523.786) -- 0:00:13 Average standard deviation of split frequencies: 0.000000 940500 -- (-2522.064) (-2524.853) [-2525.605] (-2525.524) * [-2517.790] (-2521.444) (-2521.767) (-2523.815) -- 0:00:12 941000 -- (-2518.564) (-2522.847) [-2519.626] (-2519.793) * [-2518.107] (-2518.902) (-2518.794) (-2526.968) -- 0:00:12 941500 -- (-2518.199) [-2520.307] (-2520.272) (-2521.374) * (-2524.658) [-2518.777] (-2519.000) (-2518.888) -- 0:00:12 942000 -- (-2520.161) (-2521.329) [-2519.486] (-2530.058) * (-2524.134) (-2521.106) [-2519.896] (-2518.741) -- 0:00:12 942500 -- (-2525.729) [-2524.230] (-2516.547) (-2529.958) * (-2526.996) (-2523.656) (-2519.562) [-2519.694] -- 0:00:12 943000 -- (-2521.310) (-2523.607) [-2531.913] (-2526.830) * (-2523.406) (-2519.559) (-2518.557) [-2524.426] -- 0:00:12 943500 -- (-2525.138) (-2521.926) (-2523.883) [-2520.474] * (-2521.700) [-2522.407] (-2519.631) (-2527.776) -- 0:00:12 944000 -- (-2522.759) (-2519.159) (-2522.207) [-2525.941] * (-2520.907) [-2525.016] (-2522.402) (-2519.167) -- 0:00:12 944500 -- (-2523.159) [-2522.801] (-2532.369) (-2521.959) * (-2539.616) [-2518.830] (-2526.219) (-2519.437) -- 0:00:12 945000 -- (-2520.524) (-2522.178) (-2533.711) [-2522.159] * (-2521.489) (-2526.082) [-2521.668] (-2527.721) -- 0:00:11 Average standard deviation of split frequencies: 0.000000 945500 -- [-2521.798] (-2528.554) (-2526.016) (-2520.246) * (-2525.542) [-2516.679] (-2522.381) (-2527.577) -- 0:00:11 946000 -- (-2522.469) (-2521.314) (-2525.492) [-2519.058] * (-2524.904) [-2519.293] (-2516.911) (-2525.537) -- 0:00:11 946500 -- (-2525.495) (-2524.055) (-2527.661) [-2524.128] * (-2523.336) [-2519.085] (-2522.881) (-2519.299) -- 0:00:11 947000 -- (-2519.521) (-2524.331) [-2524.776] (-2520.799) * (-2520.577) [-2519.961] (-2520.613) (-2520.254) -- 0:00:11 947500 -- (-2522.225) (-2519.073) (-2517.899) [-2518.839] * [-2526.533] (-2519.691) (-2520.744) (-2517.649) -- 0:00:11 948000 -- (-2521.831) (-2523.236) (-2522.024) [-2525.140] * (-2519.143) [-2521.187] (-2522.492) (-2520.680) -- 0:00:11 948500 -- (-2519.691) (-2528.453) (-2529.562) [-2521.478] * [-2518.275] (-2525.589) (-2523.998) (-2525.888) -- 0:00:11 949000 -- (-2524.945) (-2531.907) (-2528.132) [-2519.399] * [-2516.174] (-2518.299) (-2521.764) (-2521.265) -- 0:00:11 949500 -- [-2523.671] (-2521.494) (-2523.471) (-2525.443) * (-2522.477) (-2522.681) [-2517.613] (-2519.635) -- 0:00:11 950000 -- (-2529.101) (-2525.453) [-2519.342] (-2519.082) * (-2520.720) (-2522.564) [-2516.640] (-2529.671) -- 0:00:10 Average standard deviation of split frequencies: 0.000000 950500 -- (-2527.209) [-2526.760] (-2521.219) (-2521.801) * (-2529.663) (-2522.230) [-2522.752] (-2522.299) -- 0:00:10 951000 -- (-2528.429) (-2523.913) [-2526.508] (-2520.163) * (-2522.280) [-2520.845] (-2521.449) (-2516.316) -- 0:00:10 951500 -- (-2518.688) [-2519.271] (-2522.002) (-2519.134) * (-2519.641) (-2517.046) (-2530.172) [-2517.804] -- 0:00:10 952000 -- (-2517.841) [-2520.362] (-2530.095) (-2519.556) * (-2520.493) (-2524.493) (-2521.343) [-2524.642] -- 0:00:10 952500 -- (-2522.614) (-2524.362) [-2526.767] (-2521.470) * (-2523.191) (-2518.014) (-2530.863) [-2517.398] -- 0:00:10 953000 -- [-2522.416] (-2522.284) (-2520.171) (-2519.959) * (-2525.246) [-2518.982] (-2524.550) (-2521.900) -- 0:00:10 953500 -- (-2522.484) [-2519.128] (-2529.071) (-2518.591) * (-2522.910) [-2516.877] (-2533.190) (-2520.968) -- 0:00:10 954000 -- (-2530.232) [-2517.466] (-2521.546) (-2521.194) * (-2525.219) (-2518.336) [-2524.231] (-2517.863) -- 0:00:10 954500 -- (-2520.990) [-2521.396] (-2519.809) (-2520.697) * (-2526.321) [-2518.218] (-2528.374) (-2519.765) -- 0:00:09 955000 -- (-2522.920) (-2525.617) [-2524.985] (-2519.158) * (-2520.679) (-2521.266) (-2519.780) [-2521.583] -- 0:00:09 Average standard deviation of split frequencies: 0.000000 955500 -- [-2518.965] (-2517.917) (-2523.366) (-2521.738) * (-2519.307) (-2527.112) (-2521.414) [-2515.980] -- 0:00:09 956000 -- (-2523.009) (-2520.650) (-2522.330) [-2522.454] * (-2525.825) (-2520.815) [-2521.215] (-2521.995) -- 0:00:09 956500 -- (-2521.886) [-2521.406] (-2525.423) (-2518.999) * (-2526.337) (-2518.211) (-2518.321) [-2517.014] -- 0:00:09 957000 -- (-2518.949) [-2523.420] (-2521.588) (-2526.229) * [-2521.562] (-2529.165) (-2523.137) (-2525.133) -- 0:00:09 957500 -- (-2521.181) (-2519.395) [-2521.482] (-2519.883) * (-2520.527) (-2518.993) [-2520.212] (-2524.269) -- 0:00:09 958000 -- (-2524.210) [-2514.690] (-2518.685) (-2521.851) * [-2519.741] (-2527.462) (-2523.413) (-2521.863) -- 0:00:09 958500 -- [-2523.608] (-2519.943) (-2525.784) (-2518.123) * (-2518.318) (-2524.414) [-2523.888] (-2527.712) -- 0:00:09 959000 -- (-2523.906) (-2522.784) [-2520.726] (-2522.877) * (-2518.772) (-2522.720) (-2519.096) [-2518.088] -- 0:00:08 959500 -- (-2521.573) [-2520.526] (-2521.877) (-2517.555) * (-2522.833) [-2522.085] (-2524.479) (-2520.314) -- 0:00:08 960000 -- (-2521.459) (-2532.885) (-2516.518) [-2532.780] * (-2521.108) (-2524.280) [-2523.335] (-2516.255) -- 0:00:08 Average standard deviation of split frequencies: 0.000000 960500 -- [-2521.388] (-2528.512) (-2517.541) (-2525.615) * (-2521.425) (-2522.272) (-2523.845) [-2518.091] -- 0:00:08 961000 -- (-2517.996) (-2533.417) [-2528.885] (-2524.905) * (-2517.492) [-2517.625] (-2522.132) (-2524.134) -- 0:00:08 961500 -- [-2517.881] (-2524.827) (-2523.017) (-2528.892) * (-2521.108) (-2526.129) (-2522.137) [-2522.746] -- 0:00:08 962000 -- [-2518.382] (-2524.389) (-2518.649) (-2525.649) * (-2517.610) (-2523.148) (-2519.389) [-2516.667] -- 0:00:08 962500 -- [-2523.187] (-2526.518) (-2522.218) (-2525.394) * (-2522.057) [-2525.717] (-2519.385) (-2519.905) -- 0:00:08 963000 -- [-2524.220] (-2528.474) (-2520.023) (-2526.563) * [-2517.452] (-2528.897) (-2521.342) (-2518.116) -- 0:00:08 963500 -- (-2528.143) [-2517.129] (-2526.161) (-2524.336) * (-2522.674) (-2540.477) [-2519.560] (-2519.622) -- 0:00:07 964000 -- (-2527.012) (-2519.180) [-2520.714] (-2520.054) * (-2527.797) (-2522.019) [-2522.066] (-2521.387) -- 0:00:07 964500 -- [-2530.456] (-2519.084) (-2523.994) (-2515.816) * (-2520.658) (-2518.876) [-2519.756] (-2523.385) -- 0:00:07 965000 -- (-2529.146) (-2521.936) (-2526.560) [-2517.730] * (-2526.538) (-2525.046) [-2520.658] (-2528.624) -- 0:00:07 Average standard deviation of split frequencies: 0.000000 965500 -- (-2529.233) (-2523.722) [-2519.283] (-2522.483) * (-2519.905) (-2525.286) [-2522.105] (-2521.482) -- 0:00:07 966000 -- (-2525.223) (-2520.318) [-2522.446] (-2526.890) * [-2518.009] (-2522.685) (-2523.893) (-2521.153) -- 0:00:07 966500 -- (-2523.907) (-2522.421) [-2518.985] (-2525.917) * [-2517.783] (-2519.283) (-2516.302) (-2520.420) -- 0:00:07 967000 -- (-2518.368) (-2520.494) [-2517.807] (-2523.986) * [-2517.841] (-2517.549) (-2518.201) (-2520.562) -- 0:00:07 967500 -- (-2519.862) (-2521.595) [-2522.487] (-2526.789) * (-2519.315) (-2523.822) (-2523.918) [-2518.225] -- 0:00:07 968000 -- (-2524.054) (-2522.603) [-2516.741] (-2523.771) * (-2530.472) (-2522.305) [-2521.929] (-2525.124) -- 0:00:06 968500 -- [-2520.604] (-2527.879) (-2529.744) (-2522.346) * (-2519.614) (-2521.408) [-2521.213] (-2529.160) -- 0:00:06 969000 -- [-2521.162] (-2523.968) (-2525.080) (-2529.600) * (-2522.337) (-2518.362) [-2518.755] (-2520.991) -- 0:00:06 969500 -- [-2527.044] (-2522.286) (-2527.023) (-2521.391) * [-2521.174] (-2523.247) (-2519.892) (-2519.517) -- 0:00:06 970000 -- (-2530.545) (-2525.972) [-2520.649] (-2521.871) * (-2526.710) [-2518.294] (-2522.593) (-2518.907) -- 0:00:06 Average standard deviation of split frequencies: 0.000000 970500 -- (-2519.913) [-2521.581] (-2527.367) (-2527.472) * (-2527.340) (-2525.552) [-2522.036] (-2524.985) -- 0:00:06 971000 -- [-2518.719] (-2518.410) (-2521.210) (-2518.534) * (-2524.520) (-2522.375) (-2520.944) [-2517.551] -- 0:00:06 971500 -- (-2521.743) [-2522.760] (-2527.759) (-2520.038) * [-2519.696] (-2517.338) (-2522.664) (-2526.692) -- 0:00:06 972000 -- (-2527.657) (-2527.225) (-2519.261) [-2525.589] * (-2518.357) [-2524.772] (-2516.688) (-2526.660) -- 0:00:06 972500 -- (-2528.247) [-2522.348] (-2525.785) (-2523.307) * [-2515.458] (-2521.506) (-2525.822) (-2522.768) -- 0:00:05 973000 -- (-2522.643) [-2518.333] (-2522.852) (-2526.583) * [-2522.540] (-2525.412) (-2517.996) (-2521.933) -- 0:00:05 973500 -- (-2525.746) [-2520.549] (-2525.247) (-2519.028) * (-2524.031) [-2519.532] (-2524.408) (-2531.117) -- 0:00:05 974000 -- (-2523.205) (-2522.844) [-2519.314] (-2524.489) * [-2523.468] (-2519.621) (-2519.825) (-2523.547) -- 0:00:05 974500 -- [-2523.137] (-2522.392) (-2519.622) (-2523.966) * (-2519.574) (-2519.186) [-2524.429] (-2519.829) -- 0:00:05 975000 -- (-2518.152) (-2520.867) [-2519.725] (-2518.206) * (-2528.589) (-2519.355) (-2517.599) [-2518.608] -- 0:00:05 Average standard deviation of split frequencies: 0.000000 975500 -- (-2521.362) [-2520.733] (-2522.925) (-2525.394) * (-2524.419) [-2520.819] (-2523.092) (-2523.706) -- 0:00:05 976000 -- (-2524.272) [-2520.497] (-2526.492) (-2519.433) * (-2526.518) [-2523.441] (-2517.658) (-2520.006) -- 0:00:05 976500 -- (-2522.370) (-2529.148) [-2517.347] (-2520.604) * [-2517.937] (-2521.717) (-2520.931) (-2525.294) -- 0:00:05 977000 -- (-2524.271) (-2525.377) [-2520.367] (-2520.487) * (-2523.038) (-2524.192) [-2517.655] (-2524.163) -- 0:00:05 977500 -- [-2518.575] (-2528.510) (-2523.301) (-2524.163) * (-2520.761) [-2520.257] (-2520.377) (-2524.830) -- 0:00:04 978000 -- [-2522.420] (-2525.509) (-2520.563) (-2519.962) * [-2520.543] (-2521.243) (-2518.277) (-2520.082) -- 0:00:04 978500 -- (-2522.095) (-2520.545) (-2520.425) [-2525.751] * (-2525.093) [-2520.836] (-2520.222) (-2522.383) -- 0:00:04 979000 -- [-2518.107] (-2521.286) (-2524.920) (-2522.938) * (-2524.048) (-2523.211) (-2522.749) [-2516.034] -- 0:00:04 979500 -- [-2518.977] (-2536.027) (-2522.159) (-2516.841) * (-2524.234) (-2524.112) [-2518.850] (-2519.051) -- 0:00:04 980000 -- (-2530.414) (-2521.413) (-2521.694) [-2522.000] * (-2522.935) [-2517.689] (-2521.088) (-2523.778) -- 0:00:04 Average standard deviation of split frequencies: 0.000000 980500 -- [-2522.285] (-2522.622) (-2524.475) (-2516.322) * [-2522.822] (-2523.630) (-2519.491) (-2519.643) -- 0:00:04 981000 -- (-2520.254) [-2520.111] (-2521.463) (-2523.078) * (-2522.390) (-2515.211) [-2518.780] (-2519.354) -- 0:00:04 981500 -- (-2524.224) (-2520.271) [-2522.968] (-2523.571) * [-2520.291] (-2521.023) (-2521.328) (-2520.736) -- 0:00:04 982000 -- (-2523.256) [-2522.607] (-2533.164) (-2533.402) * (-2517.047) (-2518.210) [-2518.738] (-2524.812) -- 0:00:03 982500 -- (-2525.086) (-2520.872) (-2520.189) [-2519.926] * (-2516.616) (-2521.932) (-2522.029) [-2517.026] -- 0:00:03 983000 -- (-2517.235) (-2521.686) (-2530.859) [-2521.564] * (-2522.042) (-2521.547) [-2517.324] (-2523.540) -- 0:00:03 983500 -- [-2520.689] (-2520.119) (-2527.069) (-2522.673) * (-2519.887) (-2522.431) (-2520.662) [-2517.439] -- 0:00:03 984000 -- [-2521.033] (-2520.089) (-2523.690) (-2523.630) * (-2528.002) (-2525.794) [-2521.556] (-2523.425) -- 0:00:03 984500 -- (-2522.425) [-2518.275] (-2525.901) (-2525.031) * (-2524.329) (-2529.346) [-2520.095] (-2527.445) -- 0:00:03 985000 -- [-2526.162] (-2526.302) (-2525.711) (-2518.749) * (-2521.561) (-2523.918) (-2519.927) [-2524.959] -- 0:00:03 Average standard deviation of split frequencies: 0.000000 985500 -- (-2521.337) [-2517.627] (-2518.416) (-2519.212) * (-2521.335) [-2526.741] (-2518.209) (-2520.715) -- 0:00:03 986000 -- (-2522.806) [-2516.706] (-2527.124) (-2518.958) * (-2521.986) (-2522.782) [-2523.877] (-2524.093) -- 0:00:03 986500 -- (-2523.166) [-2518.590] (-2519.268) (-2525.914) * [-2516.444] (-2521.497) (-2525.752) (-2533.089) -- 0:00:02 987000 -- (-2532.003) (-2530.253) [-2521.026] (-2522.641) * (-2520.494) (-2519.322) (-2521.511) [-2519.319] -- 0:00:02 987500 -- (-2522.372) (-2525.469) [-2519.284] (-2518.831) * (-2522.311) [-2518.330] (-2525.783) (-2524.165) -- 0:00:02 988000 -- (-2520.940) (-2522.430) [-2519.881] (-2522.906) * (-2517.439) (-2526.804) (-2526.416) [-2521.061] -- 0:00:02 988500 -- (-2530.354) (-2523.990) [-2516.519] (-2516.583) * [-2526.431] (-2523.054) (-2519.128) (-2524.675) -- 0:00:02 989000 -- (-2523.696) (-2523.336) [-2515.840] (-2519.393) * (-2524.874) (-2520.194) [-2519.528] (-2519.397) -- 0:00:02 989500 -- (-2524.308) [-2517.798] (-2520.873) (-2523.505) * (-2521.431) (-2519.907) [-2518.870] (-2526.437) -- 0:00:02 990000 -- (-2522.767) [-2521.039] (-2515.618) (-2523.060) * [-2526.511] (-2518.422) (-2525.019) (-2524.311) -- 0:00:02 Average standard deviation of split frequencies: 0.000000 990500 -- (-2520.950) [-2522.700] (-2518.802) (-2524.678) * (-2527.573) (-2519.937) (-2528.043) [-2523.155] -- 0:00:02 991000 -- (-2519.954) (-2523.030) (-2520.885) [-2522.111] * [-2524.880] (-2522.771) (-2530.334) (-2518.005) -- 0:00:01 991500 -- [-2519.305] (-2520.040) (-2529.019) (-2524.979) * (-2521.695) (-2529.203) (-2532.855) [-2519.829] -- 0:00:01 992000 -- (-2519.060) [-2516.431] (-2521.703) (-2517.572) * [-2522.641] (-2521.286) (-2532.160) (-2525.107) -- 0:00:01 992500 -- (-2521.959) (-2521.369) [-2518.546] (-2521.902) * (-2517.711) (-2525.086) [-2516.759] (-2521.864) -- 0:00:01 993000 -- (-2524.648) (-2517.590) [-2518.855] (-2517.904) * [-2520.347] (-2522.734) (-2524.013) (-2520.153) -- 0:00:01 993500 -- (-2521.666) [-2521.059] (-2518.219) (-2528.148) * (-2516.672) [-2523.338] (-2526.154) (-2520.244) -- 0:00:01 994000 -- (-2520.901) (-2518.936) (-2523.294) [-2522.747] * (-2517.270) [-2524.129] (-2521.940) (-2524.206) -- 0:00:01 994500 -- (-2521.457) (-2515.523) (-2525.261) [-2521.956] * (-2522.068) [-2519.938] (-2522.899) (-2526.379) -- 0:00:01 995000 -- (-2517.188) (-2523.393) (-2523.723) [-2523.653] * (-2518.801) [-2521.957] (-2517.226) (-2523.119) -- 0:00:01 Average standard deviation of split frequencies: 0.000000 995500 -- (-2519.188) (-2520.430) (-2522.565) [-2519.833] * [-2517.483] (-2524.202) (-2522.800) (-2519.439) -- 0:00:00 996000 -- (-2524.097) (-2528.692) [-2516.498] (-2530.322) * (-2522.978) [-2526.990] (-2524.147) (-2521.796) -- 0:00:00 996500 -- (-2520.841) [-2521.646] (-2520.347) (-2522.638) * [-2518.421] (-2528.895) (-2518.445) (-2520.828) -- 0:00:00 997000 -- (-2523.727) (-2523.500) (-2517.598) [-2525.654] * (-2528.473) [-2520.813] (-2521.081) (-2523.552) -- 0:00:00 997500 -- (-2525.129) (-2524.376) [-2518.907] (-2528.976) * (-2527.293) (-2524.787) [-2525.591] (-2523.011) -- 0:00:00 998000 -- (-2528.807) (-2525.331) [-2518.960] (-2521.380) * (-2520.880) [-2516.773] (-2521.210) (-2517.951) -- 0:00:00 998500 -- (-2523.170) (-2525.798) [-2524.632] (-2527.990) * (-2520.805) (-2522.700) [-2523.324] (-2521.387) -- 0:00:00 999000 -- (-2524.613) (-2517.894) [-2524.312] (-2533.324) * (-2517.973) [-2525.586] (-2522.560) (-2517.730) -- 0:00:00 999500 -- (-2525.873) [-2520.664] (-2517.975) (-2529.813) * (-2523.983) (-2523.998) [-2515.902] (-2521.233) -- 0:00:00 1000000 -- [-2523.024] (-2523.650) (-2527.931) (-2521.279) * (-2519.386) (-2520.468) (-2526.291) [-2523.943] -- 0:00:00 Average standard deviation of split frequencies: 0.000000 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2523.023814 -- 13.666591 Chain 1 -- -2523.023815 -- 13.666591 Chain 2 -- -2523.649861 -- 14.267324 Chain 2 -- -2523.649860 -- 14.267324 Chain 3 -- -2527.931461 -- 15.621588 Chain 3 -- -2527.931462 -- 15.621588 Chain 4 -- -2521.279226 -- 16.721888 Chain 4 -- -2521.279226 -- 16.721888 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2519.386165 -- 15.704117 Chain 1 -- -2519.386165 -- 15.704117 Chain 2 -- -2520.468171 -- 15.383661 Chain 2 -- -2520.468168 -- 15.383661 Chain 3 -- -2526.290836 -- 16.090858 Chain 3 -- -2526.290836 -- 16.090858 Chain 4 -- -2523.943477 -- 16.741489 Chain 4 -- -2523.943477 -- 16.741489 Analysis completed in 3 mins 38 seconds Analysis used 218.10 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2513.17 Likelihood of best state for "cold" chain of run 2 was -2513.11 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 48.9 % ( 34 %) Dirichlet(Revmat{all}) 63.4 % ( 56 %) Slider(Revmat{all}) 24.6 % ( 26 %) Dirichlet(Pi{all}) 27.0 % ( 21 %) Slider(Pi{all}) 65.4 % ( 33 %) Multiplier(Alpha{1,2}) 52.0 % ( 25 %) Multiplier(Alpha{3}) 77.0 % ( 51 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.0 % ( 31 %) Multiplier(V{all}) 22.7 % ( 23 %) Nodeslider(V{all}) 25.3 % ( 22 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 49.1 % ( 40 %) Dirichlet(Revmat{all}) 62.8 % ( 49 %) Slider(Revmat{all}) 24.6 % ( 32 %) Dirichlet(Pi{all}) 26.1 % ( 23 %) Slider(Pi{all}) 65.2 % ( 40 %) Multiplier(Alpha{1,2}) 51.1 % ( 34 %) Multiplier(Alpha{3}) 76.8 % ( 57 %) Slider(Pinvar{all}) 0.0 % ( 0 %) ExtSPR(Tau{all},V{all}) 0.0 % ( 0 %) ExtTBR(Tau{all},V{all}) 0.0 % ( 0 %) NNI(Tau{all},V{all}) 0.0 % ( 0 %) ParsSPR(Tau{all},V{all}) 26.0 % ( 34 %) Multiplier(V{all}) 22.7 % ( 15 %) Nodeslider(V{all}) 25.2 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.84 0.69 0.57 2 | 166968 0.85 0.72 3 | 166250 166513 0.86 4 | 166875 166654 166740 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.84 0.69 0.57 2 | 167355 0.85 0.72 3 | 166559 166557 0.86 4 | 166655 166432 166442 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2519.00 | 2 | | 1 2 1 1 | | 2 | | 1 2 1 2 2 | | 1 1 2 2 | | 12 2 1 21 1 1 2 2 11 * 2 2 1| | 2 2 1 2 1 12 1 | | 11 2 1 2 *222 2 1 *2 * 1 2 1 2 2 | |2 22 1 1 1112 11 2 11 11 | |1 1 1 * 1 2 1 1 2 1 | | 1222 2 1 2 2 2 2| | 121 2 222 1 12 1 2 2 | | 2 2 1 1 | | 1 1 | | 2 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2522.76 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2518.25 -2528.29 2 -2518.22 -2527.58 -------------------------------------- TOTAL -2518.23 -2528.00 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.218506 0.000593 0.172458 0.265924 0.216958 1455.13 1478.07 1.000 r(A<->C){all} 0.100739 0.000683 0.049751 0.151187 0.099331 913.64 1010.75 1.000 r(A<->G){all} 0.302085 0.001883 0.213195 0.384055 0.300900 874.77 886.74 1.000 r(A<->T){all} 0.062740 0.000362 0.028757 0.100305 0.060704 1063.91 1145.90 1.000 r(C<->G){all} 0.072377 0.000600 0.026632 0.120398 0.069959 905.27 1007.86 1.000 r(C<->T){all} 0.375596 0.002012 0.290225 0.461423 0.374746 939.97 978.77 1.000 r(G<->T){all} 0.086462 0.000510 0.043410 0.130271 0.084398 733.86 953.37 1.000 pi(A){all} 0.257812 0.000160 0.233417 0.282055 0.257504 1117.25 1264.97 1.000 pi(C){all} 0.213849 0.000133 0.191266 0.235865 0.213778 1137.88 1230.65 1.000 pi(G){all} 0.214174 0.000136 0.192680 0.238042 0.214037 1297.37 1307.16 1.000 pi(T){all} 0.314165 0.000174 0.286122 0.338098 0.313842 1262.36 1311.10 1.000 alpha{1,2} 0.117795 0.010068 0.000122 0.296380 0.096622 1198.34 1249.40 1.000 alpha{3} 1.551467 0.476559 0.424633 2.891054 1.439127 1296.66 1383.40 1.000 pinvar{all} 0.196005 0.013584 0.000126 0.397898 0.191459 1184.61 1194.21 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 Key to taxon bipartitions (saved to file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------- 1 -- .**** 2 -- .*... 3 -- ..*.. 4 -- ...*. 5 -- ....* 6 -- ...** 7 -- .**.. ----------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 6 3002 1.000000 0.000000 1.000000 1.000000 2 7 3002 1.000000 0.000000 1.000000 1.000000 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------ length{all}[1] 0.023996 0.000037 0.012738 0.035784 0.023454 1.000 2 length{all}[2] 0.005633 0.000007 0.001247 0.010811 0.005297 1.000 2 length{all}[3] 0.006216 0.000007 0.001750 0.011470 0.005891 1.001 2 length{all}[4] 0.073973 0.000175 0.050638 0.100436 0.072922 1.000 2 length{all}[5] 0.036201 0.000069 0.020883 0.052985 0.035531 1.000 2 length{all}[6] 0.048750 0.000106 0.030734 0.070059 0.047953 1.000 2 length{all}[7] 0.023737 0.000036 0.012612 0.035700 0.023175 1.000 2 ------------------------------------------------------------------------------------------ + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.000000 Maximum standard deviation of split frequencies = 0.000000 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | | /------------------------------------ C2 (2) |----------------100----------------+ + \------------------------------------ C3 (3) | | /------------------------------------ C4 (4) \----------------100----------------+ \------------------------------------ C5 (5) Phylogram (based on average branch lengths): /-------------- C1 (1) | | /--- C2 (2) |-------------+ + \--- C3 (3) | | /------------------------------------------- C4 (4) \----------------------------+ \--------------------- C5 (5) |----------| 0.020 expected changes per site Calculating tree probabilities... Credible sets of trees (1 tree sampled): 99 % credible set contains 1 tree Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 5 ls = 1143 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Sequences read.. Counting site patterns.. 0:00 194 patterns at 381 / 381 sites (100.0%), 0:00 Counting codons.. 80 bytes for distance 189344 bytes for conP 26384 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (2, 3), (4, 5)); MP score: 168 284016 bytes for conP, adjusted 0.061755 0.054752 0.009125 0.017300 0.106336 0.161992 0.092012 0.300000 1.300000 ntime & nrate & np: 7 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 9 lnL0 = -2639.123119 Iterating by ming2 Initial: fx= 2639.123119 x= 0.06175 0.05475 0.00912 0.01730 0.10634 0.16199 0.09201 0.30000 1.30000 1 h-m-p 0.0000 0.0003 330.7929 ++YCYCCC 2629.692443 5 0.0002 24 | 0/9 2 h-m-p 0.0000 0.0006 1504.4448 +CCCCC 2611.532296 4 0.0001 45 | 0/9 3 h-m-p 0.0001 0.0004 797.5667 +CYCYCYC 2555.072070 6 0.0004 68 | 0/9 4 h-m-p 0.0001 0.0007 149.9131 CYCCC 2553.062663 4 0.0002 87 | 0/9 5 h-m-p 0.0003 0.0021 112.0432 YCCCC 2550.029323 4 0.0007 106 | 0/9 6 h-m-p 0.0002 0.0028 386.7939 +YCYYYYYYYC 2485.353580 10 0.0023 131 | 0/9 7 h-m-p 0.0001 0.0005 392.1596 YYC 2484.335287 2 0.0001 145 | 0/9 8 h-m-p 0.0014 0.0092 22.9095 YC 2484.277892 1 0.0002 158 | 0/9 9 h-m-p 0.0039 0.1044 1.3384 +YYC 2483.945043 2 0.0127 173 | 0/9 10 h-m-p 0.0018 0.0367 9.2946 +CCCC 2478.069031 3 0.0093 192 | 0/9 11 h-m-p 0.3451 4.6987 0.2510 YCCCC 2467.452815 4 0.7759 211 | 0/9 12 h-m-p 0.4256 2.1279 0.1924 +YCYCCC 2462.395403 5 1.1501 241 | 0/9 13 h-m-p 0.4374 2.1871 0.3185 YCCCCC 2456.376174 5 0.9167 271 | 0/9 14 h-m-p 1.6000 8.0000 0.1747 YCCCC 2450.899546 4 3.4402 299 | 0/9 15 h-m-p 1.3497 6.7485 0.1785 YCCCC 2448.754376 4 2.5311 327 | 0/9 16 h-m-p 1.6000 8.0000 0.0614 CCC 2448.602976 2 1.4469 352 | 0/9 17 h-m-p 1.6000 8.0000 0.0362 CCC 2448.576820 2 1.4284 377 | 0/9 18 h-m-p 1.6000 8.0000 0.0224 YC 2448.572806 1 1.1903 399 | 0/9 19 h-m-p 1.6000 8.0000 0.0023 C 2448.572323 0 1.3907 420 | 0/9 20 h-m-p 1.6000 8.0000 0.0009 C 2448.572244 0 1.6304 441 | 0/9 21 h-m-p 1.6000 8.0000 0.0000 C 2448.572241 0 1.3170 462 | 0/9 22 h-m-p 1.6000 8.0000 0.0000 Y 2448.572241 0 0.9721 483 | 0/9 23 h-m-p 1.6000 8.0000 0.0000 C 2448.572241 0 1.6291 504 | 0/9 24 h-m-p 1.6000 8.0000 0.0000 C 2448.572241 0 1.7609 525 | 0/9 25 h-m-p 1.6000 8.0000 0.0000 Y 2448.572241 0 1.6000 546 | 0/9 26 h-m-p 1.6000 8.0000 0.0000 C 2448.572241 0 0.4000 567 | 0/9 27 h-m-p 0.8990 8.0000 0.0000 -C 2448.572241 0 0.0562 589 Out.. lnL = -2448.572241 590 lfun, 590 eigenQcodon, 4130 P(t) Time used: 0:02 Model 1: NearlyNeutral TREE # 1 (1, (2, 3), (4, 5)); MP score: 168 0.061755 0.054752 0.009125 0.017300 0.106336 0.161992 0.092012 2.833182 0.573207 0.492243 ntime & nrate & np: 7 2 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 4.896449 np = 10 lnL0 = -2475.361083 Iterating by ming2 Initial: fx= 2475.361083 x= 0.06175 0.05475 0.00912 0.01730 0.10634 0.16199 0.09201 2.83318 0.57321 0.49224 1 h-m-p 0.0000 0.0003 170.3528 +CC 2474.856999 1 0.0000 18 | 0/10 2 h-m-p 0.0001 0.0004 89.8285 CYCCC 2474.381576 4 0.0001 38 | 0/10 3 h-m-p 0.0000 0.0010 282.3128 +CCCC 2472.080286 3 0.0003 58 | 0/10 4 h-m-p 0.0002 0.0013 416.0993 +YYCYCYCCC 2453.038714 8 0.0009 84 | 0/10 5 h-m-p 0.0001 0.0005 368.0304 YYCCCC 2451.885182 5 0.0001 105 | 0/10 6 h-m-p 0.0021 0.0103 14.3482 YCCCC 2451.426197 4 0.0040 125 | 0/10 7 h-m-p 0.0007 0.0035 29.4634 YYC 2451.318938 2 0.0006 140 | 0/10 8 h-m-p 0.0044 0.0614 4.0471 YC 2451.278133 1 0.0023 154 | 0/10 9 h-m-p 0.0009 0.1772 10.0737 +++YYCCC 2448.756609 4 0.0486 176 | 0/10 10 h-m-p 0.0193 0.0966 3.5939 -YC 2448.748601 1 0.0008 191 | 0/10 11 h-m-p 0.0028 1.3933 1.3499 ++++YCCCC 2445.441651 4 0.4743 215 | 0/10 12 h-m-p 1.6000 8.0000 0.3948 YCCC 2445.066322 3 0.6024 233 | 0/10 13 h-m-p 1.2648 8.0000 0.1880 YC 2444.996558 1 0.6734 257 | 0/10 14 h-m-p 1.6000 8.0000 0.0242 YC 2444.989601 1 0.7201 281 | 0/10 15 h-m-p 1.6000 8.0000 0.0062 YC 2444.989278 1 0.8617 305 | 0/10 16 h-m-p 1.6000 8.0000 0.0007 Y 2444.989248 0 0.7162 328 | 0/10 17 h-m-p 1.6000 8.0000 0.0001 Y 2444.989248 0 1.1143 351 | 0/10 18 h-m-p 1.6000 8.0000 0.0000 Y 2444.989248 0 1.0951 374 | 0/10 19 h-m-p 1.6000 8.0000 0.0000 Y 2444.989248 0 1.0530 397 | 0/10 20 h-m-p 1.6000 8.0000 0.0000 C 2444.989248 0 1.6000 420 | 0/10 21 h-m-p 1.6000 8.0000 0.0000 -----------C 2444.989248 0 0.0000 454 Out.. lnL = -2444.989248 455 lfun, 1365 eigenQcodon, 6370 P(t) Time used: 0:05 Model 2: PositiveSelection TREE # 1 (1, (2, 3), (4, 5)); MP score: 168 initial w for M2:NSpselection reset. 0.061755 0.054752 0.009125 0.017300 0.106336 0.161992 0.092012 2.831375 0.986220 0.117156 0.463564 2.408838 ntime & nrate & np: 7 3 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 3.893899 np = 12 lnL0 = -2488.886995 Iterating by ming2 Initial: fx= 2488.886995 x= 0.06175 0.05475 0.00912 0.01730 0.10634 0.16199 0.09201 2.83137 0.98622 0.11716 0.46356 2.40884 1 h-m-p 0.0000 0.0005 182.5725 +CYCC 2488.289399 3 0.0000 23 | 0/12 2 h-m-p 0.0001 0.0006 95.6388 YCCC 2487.594490 3 0.0002 43 | 0/12 3 h-m-p 0.0001 0.0030 249.4048 YYCC 2486.807172 3 0.0001 62 | 0/12 4 h-m-p 0.0002 0.0046 112.3831 ++YCYCCC 2479.140762 5 0.0026 87 | 0/12 5 h-m-p 0.0000 0.0002 863.2299 ++ 2472.420762 m 0.0002 102 | 0/12 6 h-m-p -0.0000 -0.0000 58.8393 h-m-p: -1.68012496e-19 -8.40062481e-19 5.88393410e+01 2472.420762 .. | 0/12 7 h-m-p 0.0000 0.0017 219.3365 ++YYCCC 2468.202402 4 0.0002 137 | 0/12 8 h-m-p 0.0005 0.0028 98.4718 YYCC 2466.652485 3 0.0004 156 | 0/12 9 h-m-p 0.0001 0.0004 244.9939 CYCCC 2465.176863 4 0.0002 178 | 0/12 10 h-m-p 0.0006 0.0038 63.5687 CYC 2465.037256 2 0.0001 196 | 0/12 11 h-m-p 0.0001 0.0029 77.1436 +CYC 2464.611933 2 0.0003 215 | 0/12 12 h-m-p 0.0007 0.0058 36.4674 CCCC 2464.239589 3 0.0009 236 | 0/12 13 h-m-p 0.0004 0.0165 87.7855 ++YYCC 2460.260813 3 0.0047 257 | 0/12 14 h-m-p 0.0007 0.0036 623.8040 +YCCCC 2448.141761 4 0.0018 280 | 0/12 15 h-m-p 0.0016 0.0080 146.9788 YCCC 2447.190998 3 0.0008 300 | 0/12 16 h-m-p 0.0916 4.0736 1.2995 +CCC 2445.700908 2 0.5484 320 | 0/12 17 h-m-p 1.0839 5.8094 0.6575 YCCC 2445.033680 3 0.4999 340 | 0/12 18 h-m-p 0.7180 4.2053 0.4577 CYC 2444.580788 2 0.7053 370 | 0/12 19 h-m-p 0.4134 8.0000 0.7810 +CCC 2443.811073 2 1.5137 402 | 0/12 20 h-m-p 1.0967 5.4835 0.9083 CCCC 2442.988901 3 1.6030 435 | 0/12 21 h-m-p 1.6000 8.0000 0.6971 YCCC 2442.633364 3 0.8113 467 | 0/12 22 h-m-p 1.6000 8.0000 0.3128 YCC 2442.446784 2 1.0697 497 | 0/12 23 h-m-p 0.5212 8.0000 0.6420 +YCC 2442.286947 2 1.4625 528 | 0/12 24 h-m-p 1.6000 8.0000 0.3548 +CCC 2441.876212 2 5.4207 560 | 0/12 25 h-m-p 1.6000 8.0000 0.7959 CCCCC 2441.455011 4 1.9909 595 | 0/12 26 h-m-p 1.2662 8.0000 1.2514 CCC 2441.351582 2 1.1806 626 | 0/12 27 h-m-p 1.5146 8.0000 0.9754 CC 2441.292183 1 1.5292 643 | 0/12 28 h-m-p 1.6000 8.0000 0.5264 YC 2441.281549 1 1.2127 671 | 0/12 29 h-m-p 1.6000 8.0000 0.1415 YC 2441.280878 1 1.0926 699 | 0/12 30 h-m-p 1.6000 8.0000 0.0304 C 2441.280839 0 1.3368 726 | 0/12 31 h-m-p 1.6000 8.0000 0.0029 ++ 2441.280806 m 8.0000 753 | 0/12 32 h-m-p 1.4027 8.0000 0.0167 ++ 2441.280506 m 8.0000 780 | 0/12 33 h-m-p 0.5402 8.0000 0.2468 +YC 2441.279361 1 4.8303 809 | 0/12 34 h-m-p 1.6000 8.0000 0.2658 CC 2441.278336 1 2.2915 838 | 0/12 35 h-m-p 1.6000 8.0000 0.3315 YC 2441.278076 1 3.5536 866 | 0/12 36 h-m-p 1.6000 8.0000 0.3255 C 2441.277961 0 2.0182 893 | 0/12 37 h-m-p 1.6000 8.0000 0.3359 Y 2441.277916 0 3.2809 920 | 0/12 38 h-m-p 1.6000 8.0000 0.3578 C 2441.277898 0 1.9150 947 | 0/12 39 h-m-p 1.6000 8.0000 0.3456 Y 2441.277890 0 2.9622 974 | 0/12 40 h-m-p 1.6000 8.0000 0.3601 C 2441.277887 0 2.0017 1001 | 0/12 41 h-m-p 1.6000 8.0000 0.3479 Y 2441.277886 0 3.0775 1028 | 0/12 42 h-m-p 1.6000 8.0000 0.3450 C 2441.277885 0 2.0553 1055 | 0/12 43 h-m-p 1.6000 8.0000 0.3446 Y 2441.277885 0 3.3272 1082 | 0/12 44 h-m-p 1.6000 8.0000 0.3611 C 2441.277885 0 2.0379 1109 | 0/12 45 h-m-p 1.6000 8.0000 0.3151 Y 2441.277885 0 3.1513 1136 | 0/12 46 h-m-p 1.6000 8.0000 0.4460 Y 2441.277885 0 2.5999 1163 | 0/12 47 h-m-p 1.6000 8.0000 0.1617 C 2441.277885 0 1.6906 1190 | 0/12 48 h-m-p 0.5130 8.0000 0.5330 +C 2441.277885 0 2.0520 1218 | 0/12 49 h-m-p 1.5423 8.0000 0.7092 C 2441.277885 0 1.9850 1245 | 0/12 50 h-m-p 1.6000 8.0000 0.2550 Y 2441.277885 0 3.9710 1272 | 0/12 51 h-m-p 0.4914 8.0000 2.0605 C 2441.277885 0 0.6154 1299 | 0/12 52 h-m-p 1.0087 8.0000 1.2571 C 2441.277885 0 0.3190 1314 | 0/12 53 h-m-p 1.6000 8.0000 0.0008 -C 2441.277885 0 0.1597 1330 | 0/12 54 h-m-p 0.0341 8.0000 0.0036 Y 2441.277885 0 0.0341 1357 | 0/12 55 h-m-p 0.0160 8.0000 0.0591 Y 2441.277885 0 0.0160 1384 | 0/12 56 h-m-p 0.3789 8.0000 0.0025 C 2441.277885 0 0.3789 1411 | 0/12 57 h-m-p 0.7020 8.0000 0.0013 Y 2441.277885 0 0.3015 1438 | 0/12 58 h-m-p 0.1932 8.0000 0.0021 ---------------.. | 0/12 59 h-m-p 0.0160 8.0000 0.0016 ---------C 2441.277885 0 0.0000 1514 | 0/12 60 h-m-p 0.0160 8.0000 0.0006 ----------Y 2441.277885 0 0.0000 1551 Out.. lnL = -2441.277885 1552 lfun, 6208 eigenQcodon, 32592 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2452.986567 S = -2320.652896 -124.193448 Calculating f(w|X), posterior probabilities of site classes. did 10 / 194 patterns 0:19 did 20 / 194 patterns 0:19 did 30 / 194 patterns 0:19 did 40 / 194 patterns 0:19 did 50 / 194 patterns 0:19 did 60 / 194 patterns 0:19 did 70 / 194 patterns 0:19 did 80 / 194 patterns 0:19 did 90 / 194 patterns 0:19 did 100 / 194 patterns 0:19 did 110 / 194 patterns 0:19 did 120 / 194 patterns 0:19 did 130 / 194 patterns 0:20 did 140 / 194 patterns 0:20 did 150 / 194 patterns 0:20 did 160 / 194 patterns 0:20 did 170 / 194 patterns 0:20 did 180 / 194 patterns 0:20 did 190 / 194 patterns 0:20 did 194 / 194 patterns 0:20 Time used: 0:20 Model 3: discrete TREE # 1 (1, (2, 3), (4, 5)); MP score: 168 0.061755 0.054752 0.009125 0.017300 0.106336 0.161992 0.092012 2.917986 0.331355 0.382499 0.112564 0.281006 0.470513 ntime & nrate & np: 7 4 13 Bounds (np=13): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 7.977742 np = 13 lnL0 = -2448.346524 Iterating by ming2 Initial: fx= 2448.346524 x= 0.06175 0.05475 0.00912 0.01730 0.10634 0.16199 0.09201 2.91799 0.33136 0.38250 0.11256 0.28101 0.47051 1 h-m-p 0.0000 0.0003 162.9063 +CYC 2447.932436 2 0.0000 22 | 0/13 2 h-m-p 0.0001 0.0004 61.6732 YYYC 2447.790983 3 0.0001 41 | 0/13 3 h-m-p 0.0001 0.0028 72.0024 YCC 2447.605923 2 0.0001 60 | 0/13 4 h-m-p 0.0003 0.0053 30.5653 +YYC 2447.230964 2 0.0012 79 | 0/13 5 h-m-p 0.0003 0.0016 71.4955 YCCC 2446.820066 3 0.0006 100 | 0/13 6 h-m-p 0.0004 0.0019 43.5101 YCC 2446.725748 2 0.0003 119 | 0/13 7 h-m-p 0.0011 0.0129 11.5829 YC 2446.695411 1 0.0006 136 | 0/13 8 h-m-p 0.0011 0.0643 7.0958 +CC 2446.609271 1 0.0051 155 | 0/13 9 h-m-p 0.0006 0.0068 60.7531 +YCCC 2446.386723 3 0.0015 177 | 0/13 10 h-m-p 0.0209 0.1043 1.9283 CCC 2446.342455 2 0.0254 197 | 0/13 11 h-m-p 0.0725 2.6499 0.6764 +CCCC 2446.159803 3 0.4236 220 | 0/13 12 h-m-p 0.4271 8.0000 0.6709 +YYC 2445.850503 2 1.4749 252 | 0/13 13 h-m-p 0.4681 6.4407 2.1138 CCC 2445.513762 2 0.5817 285 | 0/13 14 h-m-p 1.2711 6.3553 0.9566 CCC 2445.061140 2 1.1967 305 | 0/13 15 h-m-p 1.0001 8.0000 1.1446 YYC 2444.680710 2 0.9156 336 | 0/13 16 h-m-p 1.1525 5.7627 0.2436 YCCC 2444.479633 3 0.7909 357 | 0/13 17 h-m-p 0.3807 3.1573 0.5061 +CCCC 2443.930738 3 1.8791 393 | 0/13 18 h-m-p 0.2214 1.1071 0.2973 +YCCC 2443.755950 3 0.6963 428 | 0/13 19 h-m-p 0.1231 0.6155 0.8568 ++ 2443.581668 m 0.6155 457 | 1/13 20 h-m-p 1.0508 8.0000 0.5009 YCCC 2443.302443 3 2.1713 491 | 1/13 21 h-m-p 1.6000 8.0000 0.5832 CCCC 2442.701352 3 2.2124 525 | 1/13 22 h-m-p 0.6857 3.4285 1.7027 YYC 2442.170106 2 0.5405 555 | 1/13 23 h-m-p 0.6110 8.0000 1.5064 YCCC 2441.865671 3 0.9639 576 | 1/13 24 h-m-p 1.6000 8.0000 0.8131 YCCC 2441.547162 3 2.4606 597 | 1/13 25 h-m-p 1.3189 8.0000 1.5171 CYC 2441.353751 2 1.2517 628 | 1/13 26 h-m-p 1.6000 8.0000 0.6887 CYC 2441.293489 2 1.7491 647 | 1/13 27 h-m-p 1.6000 8.0000 0.7039 CC 2441.276793 1 1.3803 677 | 1/13 28 h-m-p 1.6000 8.0000 0.3126 YC 2441.274723 1 0.7646 706 | 1/13 29 h-m-p 1.6000 8.0000 0.0829 YC 2441.274410 1 1.0047 735 | 1/13 30 h-m-p 1.6000 8.0000 0.0214 C 2441.274397 0 1.3263 763 | 1/13 31 h-m-p 1.6000 8.0000 0.0014 ++ 2441.274363 m 8.0000 791 | 1/13 32 h-m-p 0.1124 8.0000 0.0979 ++YC 2441.273957 1 2.9342 822 | 1/13 33 h-m-p 1.5328 8.0000 0.1874 +YYC 2441.270039 2 5.3566 853 | 1/13 34 h-m-p 0.5765 8.0000 1.7414 YC 2441.269703 1 0.0843 882 | 1/13 35 h-m-p 0.7698 8.0000 0.1908 YC 2441.265788 1 1.2489 899 | 1/13 36 h-m-p 1.6000 8.0000 0.0901 +YC 2441.261902 1 4.9783 929 | 1/13 37 h-m-p 1.6000 8.0000 0.1865 YC 2441.261420 1 0.7061 958 | 1/13 38 h-m-p 0.3313 8.0000 0.3974 C 2441.260907 0 0.3061 986 | 1/13 39 h-m-p 1.6000 8.0000 0.0444 C 2441.260834 0 1.3022 1014 | 1/13 40 h-m-p 1.6000 8.0000 0.0087 Y 2441.260829 0 1.0717 1042 | 1/13 41 h-m-p 1.6000 8.0000 0.0017 Y 2441.260829 0 1.0886 1070 | 1/13 42 h-m-p 1.6000 8.0000 0.0004 C 2441.260829 0 1.3253 1098 | 1/13 43 h-m-p 1.6000 8.0000 0.0001 C 2441.260829 0 1.3585 1126 | 1/13 44 h-m-p 1.6000 8.0000 0.0000 C 2441.260829 0 0.4000 1154 | 1/13 45 h-m-p 0.6217 8.0000 0.0000 -Y 2441.260829 0 0.0389 1183 | 1/13 46 h-m-p 0.0664 8.0000 0.0000 ---------C 2441.260829 0 0.0000 1220 Out.. lnL = -2441.260829 1221 lfun, 4884 eigenQcodon, 25641 P(t) Time used: 0:31 Model 7: beta TREE # 1 (1, (2, 3), (4, 5)); MP score: 168 0.061755 0.054752 0.009125 0.017300 0.106336 0.161992 0.092012 2.917795 0.665673 1.549129 ntime & nrate & np: 7 1 10 Bounds (np=10): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 7.640725 np = 10 lnL0 = -2448.246382 Iterating by ming2 Initial: fx= 2448.246382 x= 0.06175 0.05475 0.00912 0.01730 0.10634 0.16199 0.09201 2.91779 0.66567 1.54913 1 h-m-p 0.0000 0.0003 162.1246 +CYC 2447.832005 2 0.0000 19 | 0/10 2 h-m-p 0.0001 0.0005 61.5419 YYCC 2447.688155 3 0.0001 36 | 0/10 3 h-m-p 0.0001 0.0036 68.9176 YCCC 2447.537153 3 0.0001 54 | 0/10 4 h-m-p 0.0004 0.0113 20.3242 YC 2447.424291 1 0.0007 68 | 0/10 5 h-m-p 0.0004 0.0223 32.4374 +CC 2447.085617 1 0.0017 84 | 0/10 6 h-m-p 0.0004 0.0049 126.1190 CCCC 2446.582585 3 0.0006 103 | 0/10 7 h-m-p 0.0009 0.0069 85.6490 YCCC 2446.334999 3 0.0005 121 | 0/10 8 h-m-p 0.0069 0.0349 6.2782 -C 2446.328143 0 0.0004 135 | 0/10 9 h-m-p 0.0160 8.0000 0.4914 ++CCC 2446.261843 2 0.3944 154 | 0/10 10 h-m-p 1.6000 8.0000 0.1104 C 2446.257948 0 0.4215 177 | 0/10 11 h-m-p 0.9254 8.0000 0.0503 C 2446.253712 0 0.8652 200 | 0/10 12 h-m-p 1.1594 8.0000 0.0375 YC 2446.250479 1 2.6090 224 | 0/10 13 h-m-p 1.6000 8.0000 0.0198 C 2446.250060 0 1.3055 247 | 0/10 14 h-m-p 1.6000 8.0000 0.0022 Y 2446.250054 0 1.1171 270 | 0/10 15 h-m-p 1.6000 8.0000 0.0000 Y 2446.250054 0 1.0197 293 | 0/10 16 h-m-p 1.6000 8.0000 0.0000 Y 2446.250054 0 0.6551 316 | 0/10 17 h-m-p 1.3065 8.0000 0.0000 Y 2446.250054 0 0.6448 339 | 0/10 18 h-m-p 1.6000 8.0000 0.0000 -Y 2446.250054 0 0.1000 363 | 0/10 19 h-m-p 0.0184 8.0000 0.0000 C 2446.250054 0 0.0184 386 | 0/10 20 h-m-p 0.0746 8.0000 0.0000 --------------.. | 0/10 21 h-m-p 0.0160 8.0000 0.0001 -----------C 2446.250054 0 0.0000 455 Out.. lnL = -2446.250054 456 lfun, 5016 eigenQcodon, 31920 P(t) Time used: 0:44 Model 8: beta&w>1 TREE # 1 (1, (2, 3), (4, 5)); MP score: 168 initial w for M8:NSbetaw>1 reset. 0.061755 0.054752 0.009125 0.017300 0.106336 0.161992 0.092012 2.852096 0.900000 0.401601 1.403915 2.022819 ntime & nrate & np: 7 2 12 Bounds (np=12): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.765289 np = 12 lnL0 = -2452.495902 Iterating by ming2 Initial: fx= 2452.495902 x= 0.06175 0.05475 0.00912 0.01730 0.10634 0.16199 0.09201 2.85210 0.90000 0.40160 1.40392 2.02282 1 h-m-p 0.0000 0.0004 195.8737 +YYCCC 2451.506335 4 0.0001 24 | 0/12 2 h-m-p 0.0001 0.0005 169.2314 +YYCCC 2448.876078 4 0.0003 46 | 0/12 3 h-m-p 0.0000 0.0001 758.3977 YCCC 2447.266303 3 0.0000 66 | 0/12 4 h-m-p 0.0001 0.0003 110.4151 +YYCCC 2446.284423 4 0.0002 88 | 0/12 5 h-m-p 0.0008 0.0039 9.1649 CC 2446.271514 1 0.0003 105 | 0/12 6 h-m-p 0.0008 0.0335 3.3571 YC 2446.268525 1 0.0005 121 | 0/12 7 h-m-p 0.0007 0.3484 3.9528 ++CC 2446.195717 1 0.0129 140 | 0/12 8 h-m-p 0.0008 0.0196 66.7800 +YCCC 2445.668447 3 0.0055 161 | 0/12 9 h-m-p 0.0027 0.0134 63.7367 YC 2445.623774 1 0.0005 177 | 0/12 10 h-m-p 0.0087 0.1203 3.6131 CYC 2445.586922 2 0.0104 195 | 0/12 11 h-m-p 0.0252 4.4988 1.4870 +++YYC 2444.479849 2 1.2521 215 | 0/12 12 h-m-p 0.6099 3.0496 2.7750 CYC 2443.832985 2 0.5131 233 | 0/12 13 h-m-p 0.8762 8.0000 1.6250 CYC 2443.244125 2 0.9123 251 | 0/12 14 h-m-p 0.1763 0.8817 2.3250 YCYCCC 2442.801243 5 0.4903 274 | 0/12 15 h-m-p 0.5874 8.0000 1.9408 +YCCC 2442.288365 3 1.5313 295 | 0/12 16 h-m-p 1.3861 8.0000 2.1441 CCC 2441.770295 2 2.2148 314 | 0/12 17 h-m-p 1.6000 8.0000 2.7892 CYC 2441.693630 2 0.2909 332 | 0/12 18 h-m-p 0.2609 8.0000 3.1099 +YCC 2441.480454 2 1.6682 351 | 0/12 19 h-m-p 1.6000 8.0000 1.8013 CCC 2441.422397 2 1.8644 370 | 0/12 20 h-m-p 1.6000 8.0000 0.6970 CY 2441.414197 1 1.8527 387 | 0/12 21 h-m-p 1.6000 8.0000 0.3623 CC 2441.409555 1 2.4030 416 | 0/12 22 h-m-p 1.6000 8.0000 0.1823 +C 2441.386565 0 6.4000 444 | 0/12 23 h-m-p 1.6000 8.0000 0.2719 +YC 2441.295218 1 5.2875 473 | 0/12 24 h-m-p 1.6000 8.0000 0.5515 CC 2441.281513 1 1.4620 502 | 0/12 25 h-m-p 1.6000 8.0000 0.4508 C 2441.280157 0 1.4797 529 | 0/12 26 h-m-p 1.6000 8.0000 0.0188 Y 2441.280083 0 1.1653 556 | 0/12 27 h-m-p 1.3151 8.0000 0.0167 C 2441.280079 0 1.2994 583 | 0/12 28 h-m-p 1.6000 8.0000 0.0012 ++ 2441.280070 m 8.0000 610 | 0/12 29 h-m-p 0.1079 8.0000 0.0882 ++C 2441.279981 0 2.3496 639 | 0/12 30 h-m-p 1.6000 8.0000 0.1276 ++ 2441.279263 m 8.0000 666 | 0/12 31 h-m-p 0.1822 8.0000 5.6032 ++CYC 2441.276075 2 2.2915 698 | 0/12 32 h-m-p 1.6000 8.0000 1.8173 CC 2441.275151 1 1.9264 715 | 0/12 33 h-m-p 1.4781 8.0000 2.3685 YC 2441.274726 1 2.9203 731 | 0/12 34 h-m-p 1.6000 8.0000 2.1629 C 2441.274552 0 2.2675 746 | 0/12 35 h-m-p 1.6000 8.0000 1.8816 C 2441.274518 0 1.8087 761 | 0/12 36 h-m-p 1.6000 8.0000 0.6632 C 2441.274513 0 1.6483 776 | 0/12 37 h-m-p 1.6000 8.0000 0.3378 Y 2441.274511 0 2.9815 803 | 0/12 38 h-m-p 1.6000 8.0000 0.1098 C 2441.274511 0 1.9516 830 | 0/12 39 h-m-p 1.6000 8.0000 0.0529 Y 2441.274511 0 0.8297 857 | 0/12 40 h-m-p 1.6000 8.0000 0.0216 -Y 2441.274511 0 0.1744 885 | 0/12 41 h-m-p 0.8332 8.0000 0.0045 ---C 2441.274511 0 0.0033 915 | 0/12 42 h-m-p 0.0160 8.0000 0.0163 -------------.. | 0/12 43 h-m-p 0.0103 5.1260 0.0018 --Y 2441.274511 0 0.0003 982 | 0/12 44 h-m-p 0.0160 8.0000 0.0034 --------C 2441.274511 0 0.0000 1017 | 0/12 45 h-m-p 0.0160 8.0000 0.0018 -------------.. | 0/12 46 h-m-p 0.0028 1.3769 0.0352 -----------C 2441.274511 0 0.0000 1093 | 0/12 47 h-m-p 0.0036 1.8004 0.0077 --C 2441.274511 0 0.0001 1122 | 0/12 48 h-m-p 0.0160 8.0000 0.0015 -------Y 2441.274511 0 0.0000 1156 | 0/12 49 h-m-p 0.0160 8.0000 0.0023 ----------C 2441.274511 0 0.0000 1193 | 0/12 50 h-m-p 0.0160 8.0000 0.0088 --------Y 2441.274511 0 0.0000 1228 | 0/12 51 h-m-p 0.0160 8.0000 0.0034 --------C 2441.274511 0 0.0000 1263 | 0/12 52 h-m-p 0.0160 8.0000 0.0216 -------------.. | 0/12 53 h-m-p 0.0160 8.0000 0.0366 ------------- | 0/12 54 h-m-p 0.0160 8.0000 0.0366 ------------- Out.. lnL = -2441.274511 1378 lfun, 16536 eigenQcodon, 106106 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2453.510184 S = -2320.755954 -125.551136 Calculating f(w|X), posterior probabilities of site classes. did 10 / 194 patterns 1:30 did 20 / 194 patterns 1:30 did 30 / 194 patterns 1:30 did 40 / 194 patterns 1:31 did 50 / 194 patterns 1:31 did 60 / 194 patterns 1:31 did 70 / 194 patterns 1:31 did 80 / 194 patterns 1:31 did 90 / 194 patterns 1:32 did 100 / 194 patterns 1:32 did 110 / 194 patterns 1:32 did 120 / 194 patterns 1:32 did 130 / 194 patterns 1:32 did 140 / 194 patterns 1:33 did 150 / 194 patterns 1:33 did 160 / 194 patterns 1:33 did 170 / 194 patterns 1:33 did 180 / 194 patterns 1:33 did 190 / 194 patterns 1:34 did 194 / 194 patterns 1:34 Time used: 1:34 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=381 D_melanogaster_Gr39a-PC MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY D_sechellia_Gr39a-PC MNFQPCELCAYYRLCRYLGIFCIDYSPTKNKFRLRRSVLCYVVHFALQAY D_simulans_Gr39a-PC MNFQPCELCAYYRLCRYLGIFCIDYSPTKKKFRLRRSVFCYVVHFALQAY D_yakuba_Gr39a-PC MDFKPSELCAYYRLCRYLGIFCIDYNPAKKRIRLRRSVLCYVIHFALQAY D_erecta_Gr39a-PC MDFQPGELCAYYRLCRYLGIFCIDYNSTKKKFRLRRSVLCYVVHFALQAY *:*:* *******************..:*:::******:**::******* D_melanogaster_Gr39a-PC LVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ D_sechellia_Gr39a-PC LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ D_simulans_Gr39a-PC LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ D_yakuba_Gr39a-PC LVGCMSVMVTYWRRCFKKELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ D_erecta_Gr39a-PC LVGCMFVMFTYWRRCFKSELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ *** : **. *******.***************:**************** D_melanogaster_Gr39a-PC APHLRIVRQIEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIF D_sechellia_Gr39a-PC APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF D_simulans_Gr39a-PC APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF D_yakuba_Gr39a-PC APHLRIVRQIECYRRRHLANVRLLLPKRLLWLIIATNVLYMVNFIKTCVL D_erecta_Gr39a-PC APHLRIVRQIEFYRRRHLANVRLLLPKRLFWLIIATNLLYMANFIKTCVF *********** ***.:***.********:*:*****::**.******:: D_melanogaster_Gr39a-PC EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN D_sechellia_Gr39a-PC EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLGWNQSQIN D_simulans_Gr39a-PC EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN D_yakuba_Gr39a-PC EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCIVHIVRLVLIWNQSQIN D_erecta_Gr39a-PC EWLTDAPRFFVITSLGFPLRYLVTSFTMGTYFCMVHIIRLVLRWNQLEIN ******.*:************************:***:**** *** :** D_melanogaster_Gr39a-PC AIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM D_sechellia_Gr39a-PC AIIDKSADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM D_simulans_Gr39a-PC AIIDKSADLKMTSPNRLRLRVCLEMHDRLILLCNDEISLVYGFIAWLSWM D_yakuba_Gr39a-PC AVIDESADLKKTGANRMRLRACLEVHDRLIMLCNDEISLVYGFIAWLSWM D_erecta_Gr39a-PC AVIEELADLKKTGPNRLRLRACLEMHDRLMLLCNDEISLVYGFIAWLSWM *:*:: **** *..**:***.***:****::******************* D_melanogaster_Gr39a-PC FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT D_sechellia_Gr39a-PC FASLDVTGVIYLTMVIQTNKSIIVKLITNVVWLSPTFMTCAASFMSNRVT D_simulans_Gr39a-PC FASLDVTGVIYLTMVIQTNKSIILKLITNVVWLSPTFMTFAASFMSNRVT D_yakuba_Gr39a-PC FASLDVTGVIYLTMVIQTNKSIVIKLITNVVWLSPTFMTCAASFMSNRLI D_erecta_Gr39a-PC FASLDVTGVIYLTMVIQTNKSIVLKLITNVVWLSPTFMTCAASFMSNRVT ******************:***::*************** ********: D_melanogaster_Gr39a-PC IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKST D_sechellia_Gr39a-PC IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST D_simulans_Gr39a-PC IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST D_yakuba_Gr39a-PC IQANKTAKILAKVPRTGTGLDRMIEKFLLKNIRQQPILTAYGFFTLDKST D_erecta_Gr39a-PC IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRRQPILTAYGFFALDKST ********:*:********************:*::*********:***** D_melanogaster_Gr39a-PC LFKLFTAIFTYMVILVQFKEMENSTKSINKF D_sechellia_Gr39a-PC LFKLFTAIFTYMVILVQFKEMENSTKSINKF D_simulans_Gr39a-PC LFKLFTAIFTYMVILVQFKEMENSTKSINKF D_yakuba_Gr39a-PC LFKLFTAIFTYMVILVQFKEMENSTKSINKF D_erecta_Gr39a-PC LFKLFTAIFTYMVILVQFKEMENSTKSINKF *******************************
>D_melanogaster_Gr39a-PC ATGGACTTCCAACCAGGTGAACTCTGTGCTTACTACCGCCTTTGCCGATA TCTAGGGATATTCTGTATTGATTATAATCCCACTAAAAAGAAATTCCGAC TGCGGCGCAGTGTTCTCTGTTACATAGTTCATTTTGCCTTGCAAGCCTAC TTAGTTGGTTGCATCTCCGTCATGGTCACATATTGGCGTAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTCATCTGGCTGCAA GCCCCACACCTACGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA CTTGGCTAATGTTCGACTGCTCCTCCCCAAACGTCTGCTTTGGCTAATTA TTGCAACCAATGTTGTCTACATGGCTAACTTCATTAAGACGTGCATATTC GAATGGCTGACGGATGCTTCTCGACTTTTTGTCATTACCTCCTTGGGATT TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA TGGTGCATATTGTACGCCTGGTGCTCGACTGGAATCAGTCGCAGATTAAC GCGATAATAGATGAATCGGCAGACCTCAAAATGACTAGCCCCAATCGTCT GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATGCTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG TTTGCCTCGCTTGATGTAACTGGCGTAATTTATCTGACTATGGTTATTCA AACTAAAAAATCAATCGTTCTAAAATTGATAACAAACGTAGTGTGGCTTT CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACT ATTCAGGCAAATAAAACAGCAAAGATGCTGACAAAAGTACCCCGAACCGG GACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC AGAAGCCCATTTTAACCGCTTATGGATTTTTCGCTCTGGATAAAAGTACT TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTCTGGTCCA ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT >D_sechellia_Gr39a-PC ATGAACTTCCAACCGTGTGAACTCTGTGCTTATTACCGCCTTTGCCGATA TCTAGGGATATTCTGCATTGATTATAGTCCCACTAAAAATAAGTTCCGGC TGCGGCGCAGCGTTCTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC TTAGTTGGTGGTATGTCCGTCATGGTCATATATTGGCGTAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA GCCCCACACCTGCGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA ATTGGCAAATTTTCGGCTGCTCCTCCCCAAACGTCTGCTTTGGGTAATTA TTGCAACCAATGTTCTCTACATGGCTAACTTTATTAAGACGTGTATATTC GAATGGCTGACGGATGCTTCTCGACTCTTTGTCATTACCTCTTTGGGATT TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA TGGTGCATATTGTACGCCTGGTGCTTGGCTGGAATCAGTCGCAGATTAAC GCGATAATAGATAAATCGGCAGACCTCAAAATGACTAGCCCTAATCGTCT GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATGCTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG TTTGCCTCGCTTGATGTAACTGGAGTAATTTATTTGACTATGGTTATTCA GACTAACAAATCAATCATTGTAAAATTGATAACAAACGTAGTGTGGCTTT CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACA ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTCGAACCGG AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC AGCAGCCCATTTTAACCGCTTATGGATTTTTCGCGTTGGATAAAAGCACT TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTTTGGTCCA ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT >D_simulans_Gr39a-PC ATGAACTTCCAACCGTGTGAACTCTGTGCTTATTACCGCCTTTGCCGATA TCTAGGGATATTCTGCATTGATTATAGTCCCACTAAAAAGAAGTTCCGGC TGCGGCGCAGCGTTTTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC TTAGTTGGTGGTATGTCCGTCATGGTCATATATTGGCGTAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGACCGTCTTGTAATGGTAA TTGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA GCCCCACACCTGCGAATTGTCAGGCAAATAGAGTTTTATCGAAGGAATCA ATTGGCAAATTTTCGGCTGCTCCTCCCCAAACGTCTGCTTTGGGTAATTA TTGCAACCAATGTTCTCTACATGGCTAACTTCATTAAGACGTGTATATTC GAATGGCTGACGGATGCTTCTCGACTCTTTGTCATAACCTCCTTGGGATT TCCTTTACGATATCTGGTTACTAGCTTTACAATGGGCACATATTTTTGCA TGGTGCACATTGTACGCCTGGTGCTTGACTGGAATCAGTCGCAGATTAAC GCGATAATAGATAAATCGGCAGACCTCAAAATGACTAGCCCTAATCGTCT GCGTTTACGTGTATGCCTGGAGATGCACGATCGCCTGATACTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTTATAGCCTGGCTGTCTTGGATG TTTGCCTCGCTTGATGTAACTGGAGTAATTTATTTGACTATGGTTATTCA GACTAACAAATCAATCATTCTAAAATTGATAACAAACGTAGTGTGGCTTT CGCCAACTTTTATGACGTTCGCCGCTAGCTTCATGAGTAACCGTGTTACA ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTCGAACCGG AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC AGCAGCCCATTTTAACCGCTTATGGATTTTTCGCGTTGGATAAAAGCACT TTGTTTAAGCTATTTACTGCAATCTTCACGTATATGGTTATTTTGGTCCA ATTCAAGGAGATGGAAAATTCCACAAAGTCTATTAATAAATTT >D_yakuba_Gr39a-PC ATGGACTTCAAACCGAGTGAACTCTGCGCTTACTACCGCCTTTGTCGATA TCTGGGGATATTCTGCATTGACTATAATCCCGCTAAAAAAAGAATCCGGT TGCGTCGCAGCGTTCTCTGTTACGTAATTCACTTTGCCTTGCAAGCCTAC TTGGTTGGTTGCATGTCCGTCATGGTCACATATTGGCGTAGGTGCTTCAA AAAAGAGCTTACCACGACTGGAAACCACTTCGACCGACTTGTTATGGTAA TGGCCCTTGGTATTCTGGTTGTCCAGAATGCGTGGCTCATCTGGCTGCAA GCCCCACATCTGCGAATTGTTAGGCAAATAGAGTGTTACCGACGGAGGCA CTTGGCTAATGTTCGTCTGCTCCTCCCCAAACGTCTGCTTTGGCTAATTA TTGCAACCAATGTTCTCTACATGGTGAACTTTATCAAGACGTGTGTACTC GAATGGTTGACGGATGCTTCTCGACTTTTTGTCATTACCTCCTTGGGATT TCCTTTACGATATCTGGTAACTAGTTTTACAATGGGCACATACTTTTGCA TAGTACATATTGTACGTCTCGTGCTCATCTGGAATCAGTCGCAGATTAAC GCGGTTATAGATGAATCGGCAGACCTCAAAAAAACTGGCGCAAACCGTAT GCGTTTACGCGCGTGCTTGGAGGTGCACGATCGCCTGATAATGCTTTGCA ATGATGAGATCAGTCTTGTCTACGGGTTCATCGCTTGGCTGTCGTGGATG TTTGCCTCGCTTGATGTAACTGGAGTTATTTATCTGACTATGGTTATTCA GACTAACAAATCAATCGTTATAAAATTGATAACCAACGTTGTATGGCTTT CGCCAACTTTTATGACCTGCGCCGCTAGCTTCATGAGTAATCGTCTTATT ATTCAAGCAAATAAAACAGCAAAGATTTTGGCAAAAGTACCTAGAACCGG AACTGGGTTGGATAGAATGATTGAAAAATTCTTACTTAAGAACATTCGAC AGCAGCCCATTTTAACCGCTTATGGATTTTTCACTCTGGATAAAAGTACA TTGTTTAAGCTATTTACGGCCATTTTTACGTATATGGTTATTTTGGTCCA ATTTAAAGAGATGGAGAATTCTACAAAGTCTATTAATAAATTT >D_erecta_Gr39a-PC ATGGACTTCCAACCGGGTGAACTCTGTGCTTACTACCGGCTTTGCCGATA TCTGGGGATATTCTGCATTGATTATAATTCCACTAAAAAAAAGTTCCGGT TGCGTCGCAGCGTACTCTGTTACGTAGTTCACTTTGCCTTGCAAGCCTAC TTAGTTGGTTGCATGTTCGTCATGTTTACATATTGGCGCAGGTGCTTCAA AAGCGAGCTTACCACGACTGGAAACCACTTCGATCGGCTTGTTATGGTGA TGGCCCTTGGTATACTGGTTGTCCAGAATGCGTGGCTTATCTGGCTGCAA GCCCCACATCTGCGAATTGTCAGGCAAATAGAGTTTTACCGACGGAGGCA CTTGGCTAATGTTCGCCTACTTCTCCCCAAACGTCTGTTTTGGTTAATTA TTGCAACCAATCTTCTCTACATGGCTAACTTCATCAAGACGTGTGTATTC GAATGGCTGACGGATGCTCCTCGATTTTTTGTCATTACCTCCTTGGGATT TCCTTTACGATATCTGGTTACTAGTTTTACAATGGGCACATACTTTTGCA TGGTGCATATTATACGCCTGGTGCTCAGATGGAATCAGTTGGAGATTAAC GCAGTTATAGAGGAATTGGCCGACCTCAAAAAGACTGGCCCCAACCGTCT GCGTTTACGCGCGTGCTTGGAGATGCATGATCGCCTGATGCTGCTCTGCA ATGATGAGATCAGTCTTGTCTACGGGTTCATCGCTTGGCTGTCGTGGATG TTTGCCTCGCTTGATGTAACTGGAGTAATTTATCTGACTATGGTTATTCA GACTAACAAATCAATCGTTTTAAAATTGATAACAAACGTTGTGTGGCTTT CGCCAACTTTTATGACGTGCGCCGCTAGCTTCATGAGTAACCGTGTTACC ATTCAGGCAAATAAAACAGCAAAGATCCTGACAAAAGTACCTAGAACCGG AACTGGTTTGGATAGAATGATTGAAAAATTCTTACTCAAGAACCTTCGAC GGCAGCCCATTCTAACCGCTTATGGATTTTTCGCTCTGGATAAAAGCACT TTGTTTAAGCTATTTACGGCAATCTTCACGTATATGGTTATTTTGGTCCA ATTTAAGGAGATGGAGAATTCTACAAAGTCTATTAATAAATTT
>D_melanogaster_Gr39a-PC MDFQPGELCAYYRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAY LVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >D_sechellia_Gr39a-PC MNFQPCELCAYYRLCRYLGIFCIDYSPTKNKFRLRRSVLCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLGWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIIVKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >D_simulans_Gr39a-PC MNFQPCELCAYYRLCRYLGIFCIDYSPTKKKFRLRRSVFCYVVHFALQAY LVGGMSVMVIYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQ APHLRIVRQIEFYRRNQLANFRLLLPKRLLWVIIATNVLYMANFIKTCIF EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQIN AIIDKSADLKMTSPNRLRLRVCLEMHDRLILLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIILKLITNVVWLSPTFMTFAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRQQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >D_yakuba_Gr39a-PC MDFKPSELCAYYRLCRYLGIFCIDYNPAKKRIRLRRSVLCYVIHFALQAY LVGCMSVMVTYWRRCFKKELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIECYRRRHLANVRLLLPKRLLWLIIATNVLYMVNFIKTCVL EWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCIVHIVRLVLIWNQSQIN AVIDESADLKKTGANRMRLRACLEVHDRLIMLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVIKLITNVVWLSPTFMTCAASFMSNRLI IQANKTAKILAKVPRTGTGLDRMIEKFLLKNIRQQPILTAYGFFTLDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF >D_erecta_Gr39a-PC MDFQPGELCAYYRLCRYLGIFCIDYNSTKKKFRLRRSVLCYVVHFALQAY LVGCMFVMFTYWRRCFKSELTTTGNHFDRLVMVMALGILVVQNAWLIWLQ APHLRIVRQIEFYRRRHLANVRLLLPKRLFWLIIATNLLYMANFIKTCVF EWLTDAPRFFVITSLGFPLRYLVTSFTMGTYFCMVHIIRLVLRWNQLEIN AVIEELADLKKTGPNRLRLRACLEMHDRLMLLCNDEISLVYGFIAWLSWM FASLDVTGVIYLTMVIQTNKSIVLKLITNVVWLSPTFMTCAASFMSNRVT IQANKTAKILTKVPRTGTGLDRMIEKFLLKNLRRQPILTAYGFFALDKST LFKLFTAIFTYMVILVQFKEMENSTKSINKF
#NEXUS [ID: 4037796492] begin taxa; dimensions ntax=5; taxlabels D_melanogaster_Gr39a-PC D_sechellia_Gr39a-PC D_simulans_Gr39a-PC D_yakuba_Gr39a-PC D_erecta_Gr39a-PC ; end; begin trees; translate 1 D_melanogaster_Gr39a-PC, 2 D_sechellia_Gr39a-PC, 3 D_simulans_Gr39a-PC, 4 D_yakuba_Gr39a-PC, 5 D_erecta_Gr39a-PC ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.02345386,(2:0.005296595,3:0.005891481)1.000:0.02317517,(4:0.07292209,5:0.035531)1.000:0.04795285); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.02345386,(2:0.005296595,3:0.005891481):0.02317517,(4:0.07292209,5:0.035531):0.04795285); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2518.25 -2528.29 2 -2518.22 -2527.58 -------------------------------------- TOTAL -2518.23 -2528.00 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/262/Gr39a-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.218506 0.000593 0.172458 0.265924 0.216958 1455.13 1478.07 1.000 r(A<->C){all} 0.100739 0.000683 0.049751 0.151187 0.099331 913.64 1010.75 1.000 r(A<->G){all} 0.302085 0.001883 0.213195 0.384055 0.300900 874.77 886.74 1.000 r(A<->T){all} 0.062740 0.000362 0.028757 0.100305 0.060704 1063.91 1145.90 1.000 r(C<->G){all} 0.072377 0.000600 0.026632 0.120398 0.069959 905.27 1007.86 1.000 r(C<->T){all} 0.375596 0.002012 0.290225 0.461423 0.374746 939.97 978.77 1.000 r(G<->T){all} 0.086462 0.000510 0.043410 0.130271 0.084398 733.86 953.37 1.000 pi(A){all} 0.257812 0.000160 0.233417 0.282055 0.257504 1117.25 1264.97 1.000 pi(C){all} 0.213849 0.000133 0.191266 0.235865 0.213778 1137.88 1230.65 1.000 pi(G){all} 0.214174 0.000136 0.192680 0.238042 0.214037 1297.37 1307.16 1.000 pi(T){all} 0.314165 0.000174 0.286122 0.338098 0.313842 1262.36 1311.10 1.000 alpha{1,2} 0.117795 0.010068 0.000122 0.296380 0.096622 1198.34 1249.40 1.000 alpha{3} 1.551467 0.476559 0.424633 2.891054 1.439127 1296.66 1383.40 1.000 pinvar{all} 0.196005 0.013584 0.000126 0.397898 0.191459 1184.61 1194.21 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/262/Gr39a-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 5 ls = 381 Codon usage in sequences ---------------------------------------------------------------------------------------------------------------------- Phe TTT 13 15 14 14 16 | Ser TCT 3 4 3 3 2 | Tyr TAT 9 10 10 7 7 | Cys TGT 3 4 4 4 3 TTC 12 11 14 8 13 | TCC 3 2 3 2 2 | TAC 6 5 5 8 8 | TGC 8 7 6 8 8 Leu TTA 5 5 5 4 6 | TCA 1 1 1 1 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 6 9 9 12 11 | TCG 4 4 4 5 3 | TAG 0 0 0 0 0 | Trp TGG 9 9 9 9 9 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 10 11 11 12 11 | Pro CCT 1 3 3 2 3 | His CAT 2 1 0 2 3 | Arg CGT 7 7 7 8 5 CTC 9 9 8 10 8 | CCC 5 3 3 3 3 | CAC 4 4 5 4 3 | CGC 4 4 4 4 6 CTA 5 2 3 2 3 | CCA 3 2 2 2 2 | Gln CAA 6 6 6 5 5 | CGA 9 7 7 7 6 CTG 17 15 15 11 15 | CCG 0 1 1 1 1 | CAG 5 7 7 6 5 | CGG 1 3 3 2 5 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 17 18 17 20 14 | Thr ACT 12 11 11 9 10 | Asn AAT 11 11 10 10 9 | Ser AGT 4 3 3 5 3 ATC 5 5 5 7 7 | ACC 5 5 5 7 6 | AAC 6 8 8 7 8 | AGC 4 6 6 2 4 ATA 8 8 10 7 6 | ACA 7 7 7 6 7 | Lys AAA 13 12 12 16 12 | Arg AGA 1 1 1 3 3 Met ATG 17 17 16 16 17 | ACG 5 5 5 5 6 | AAG 8 7 8 5 8 | AGG 3 3 3 3 3 ---------------------------------------------------------------------------------------------------------------------- Val GTT 11 9 9 13 12 | Ala GCT 7 5 5 7 8 | Asp GAT 8 8 8 7 8 | Gly GGT 3 3 3 2 4 GTC 8 7 7 6 6 | GCC 7 7 7 7 7 | GAC 4 2 3 4 2 | GGC 2 2 1 2 2 GTA 8 11 10 9 6 | GCA 5 6 6 6 5 | Glu GAA 5 4 4 4 4 | GGA 3 5 5 5 5 GTG 3 3 3 3 4 | GCG 2 3 3 3 2 | GAG 5 5 5 6 8 | GGG 4 3 3 3 2 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_Gr39a-PC position 1: T:0.21522 C:0.23097 A:0.33071 G:0.22310 position 2: T:0.40420 C:0.18373 A:0.24147 G:0.17060 position 3: T:0.31759 C:0.24147 A:0.20735 G:0.23360 Average T:0.31234 C:0.21872 A:0.25984 G:0.20910 #2: D_sechellia_Gr39a-PC position 1: T:0.22572 C:0.22310 A:0.33333 G:0.21785 position 2: T:0.40682 C:0.18110 A:0.23622 G:0.17585 position 3: T:0.32283 C:0.22835 A:0.20210 G:0.24672 Average T:0.31846 C:0.21085 A:0.25722 G:0.21347 #3: D_simulans_Gr39a-PC position 1: T:0.22835 C:0.22310 A:0.33333 G:0.21522 position 2: T:0.40945 C:0.18110 A:0.23885 G:0.17060 position 3: T:0.30971 C:0.23622 A:0.20735 G:0.24672 Average T:0.31584 C:0.21347 A:0.25984 G:0.21085 #4: D_yakuba_Gr39a-PC position 1: T:0.22310 C:0.21260 A:0.33596 G:0.22835 position 2: T:0.40420 C:0.18110 A:0.23885 G:0.17585 position 3: T:0.32808 C:0.23360 A:0.20210 G:0.23622 Average T:0.31846 C:0.20910 A:0.25897 G:0.21347 #5: D_erecta_Gr39a-PC position 1: T:0.23360 C:0.22047 A:0.32283 G:0.22310 position 2: T:0.40682 C:0.17848 A:0.23622 G:0.17848 position 3: T:0.30971 C:0.24409 A:0.18635 G:0.25984 Average T:0.31671 C:0.21435 A:0.24847 G:0.22047 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 72 | Ser S TCT 15 | Tyr Y TAT 43 | Cys C TGT 18 TTC 58 | TCC 12 | TAC 32 | TGC 37 Leu L TTA 25 | TCA 5 | *** * TAA 0 | *** * TGA 0 TTG 47 | TCG 20 | TAG 0 | Trp W TGG 45 ------------------------------------------------------------------------------ Leu L CTT 55 | Pro P CCT 12 | His H CAT 8 | Arg R CGT 34 CTC 44 | CCC 17 | CAC 20 | CGC 22 CTA 15 | CCA 11 | Gln Q CAA 28 | CGA 36 CTG 73 | CCG 4 | CAG 30 | CGG 14 ------------------------------------------------------------------------------ Ile I ATT 86 | Thr T ACT 53 | Asn N AAT 51 | Ser S AGT 18 ATC 29 | ACC 28 | AAC 37 | AGC 22 ATA 39 | ACA 34 | Lys K AAA 65 | Arg R AGA 9 Met M ATG 83 | ACG 26 | AAG 36 | AGG 15 ------------------------------------------------------------------------------ Val V GTT 54 | Ala A GCT 32 | Asp D GAT 39 | Gly G GGT 15 GTC 34 | GCC 35 | GAC 15 | GGC 9 GTA 44 | GCA 28 | Glu E GAA 21 | GGA 23 GTG 16 | GCG 13 | GAG 29 | GGG 15 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.22520 C:0.22205 A:0.33123 G:0.22152 position 2: T:0.40630 C:0.18110 A:0.23832 G:0.17428 position 3: T:0.31759 C:0.23675 A:0.20105 G:0.24462 Average T:0.31636 C:0.21330 A:0.25687 G:0.21347 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_Gr39a-PC D_sechellia_Gr39a-PC 0.1971 (0.0221 0.1119) D_simulans_Gr39a-PC 0.1970 (0.0221 0.1120) 0.4560 (0.0069 0.0151) D_yakuba_Gr39a-PC 0.1529 (0.0466 0.3050) 0.1675 (0.0514 0.3071) 0.1585 (0.0514 0.3244) D_erecta_Gr39a-PC 0.1317 (0.0349 0.2653) 0.1743 (0.0405 0.2323) 0.1797 (0.0433 0.2410) 0.2032 (0.0441 0.2171) Model 0: one-ratio TREE # 1: (1, (2, 3), (4, 5)); MP score: 168 lnL(ntime: 7 np: 9): -2448.572241 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.057984 0.061622 0.013282 0.013990 0.111727 0.168187 0.096317 2.833182 0.225127 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.52311 (1: 0.057984, (2: 0.013282, 3: 0.013990): 0.061622, (4: 0.168187, 5: 0.096317): 0.111727); (D_melanogaster_Gr39a-PC: 0.057984, (D_sechellia_Gr39a-PC: 0.013282, D_simulans_Gr39a-PC: 0.013990): 0.061622, (D_yakuba_Gr39a-PC: 0.168187, D_erecta_Gr39a-PC: 0.096317): 0.111727); Detailed output identifying parameters kappa (ts/tv) = 2.83318 omega (dN/dS) = 0.22513 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.058 818.9 324.1 0.2251 0.0098 0.0435 8.0 14.1 6..7 0.062 818.9 324.1 0.2251 0.0104 0.0462 8.5 15.0 7..2 0.013 818.9 324.1 0.2251 0.0022 0.0100 1.8 3.2 7..3 0.014 818.9 324.1 0.2251 0.0024 0.0105 1.9 3.4 6..8 0.112 818.9 324.1 0.2251 0.0188 0.0837 15.4 27.1 8..4 0.168 818.9 324.1 0.2251 0.0284 0.1260 23.2 40.8 8..5 0.096 818.9 324.1 0.2251 0.0162 0.0722 13.3 23.4 tree length for dN: 0.0883 tree length for dS: 0.3920 Time used: 0:02 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 168 lnL(ntime: 7 np: 10): -2444.989248 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.058627 0.062064 0.013212 0.014145 0.112534 0.170719 0.097113 2.831375 0.938552 0.169294 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.52841 (1: 0.058627, (2: 0.013212, 3: 0.014145): 0.062064, (4: 0.170719, 5: 0.097113): 0.112534); (D_melanogaster_Gr39a-PC: 0.058627, (D_sechellia_Gr39a-PC: 0.013212, D_simulans_Gr39a-PC: 0.014145): 0.062064, (D_yakuba_Gr39a-PC: 0.170719, D_erecta_Gr39a-PC: 0.097113): 0.112534); Detailed output identifying parameters kappa (ts/tv) = 2.83137 dN/dS (w) for site classes (K=2) p: 0.93855 0.06145 w: 0.16929 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.059 819.0 324.0 0.2203 0.0098 0.0443 8.0 14.3 6..7 0.062 819.0 324.0 0.2203 0.0103 0.0469 8.5 15.2 7..2 0.013 819.0 324.0 0.2203 0.0022 0.0100 1.8 3.2 7..3 0.014 819.0 324.0 0.2203 0.0024 0.0107 1.9 3.5 6..8 0.113 819.0 324.0 0.2203 0.0187 0.0850 15.3 27.5 8..4 0.171 819.0 324.0 0.2203 0.0284 0.1289 23.3 41.8 8..5 0.097 819.0 324.0 0.2203 0.0162 0.0733 13.2 23.8 Time used: 0:05 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 168 lnL(ntime: 7 np: 12): -2441.277885 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.060438 0.064258 0.012419 0.015395 0.114252 0.177700 0.099450 2.917986 0.996304 0.000000 0.209878 12.031037 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54391 (1: 0.060438, (2: 0.012419, 3: 0.015395): 0.064258, (4: 0.177700, 5: 0.099450): 0.114252); (D_melanogaster_Gr39a-PC: 0.060438, (D_sechellia_Gr39a-PC: 0.012419, D_simulans_Gr39a-PC: 0.015395): 0.064258, (D_yakuba_Gr39a-PC: 0.177700, D_erecta_Gr39a-PC: 0.099450): 0.114252); Detailed output identifying parameters kappa (ts/tv) = 2.91799 dN/dS (w) for site classes (K=3) p: 0.99630 0.00000 0.00370 w: 0.20988 1.00000 12.03104 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.060 817.5 325.5 0.2536 0.0110 0.0432 9.0 14.1 6..7 0.064 817.5 325.5 0.2536 0.0117 0.0460 9.5 15.0 7..2 0.012 817.5 325.5 0.2536 0.0023 0.0089 1.8 2.9 7..3 0.015 817.5 325.5 0.2536 0.0028 0.0110 2.3 3.6 6..8 0.114 817.5 325.5 0.2536 0.0207 0.0817 16.9 26.6 8..4 0.178 817.5 325.5 0.2536 0.0322 0.1271 26.3 41.4 8..5 0.099 817.5 325.5 0.2536 0.0180 0.0711 14.7 23.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 1.000** 12.029 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 0.917 2.526 +- 1.482 274 L 0.607 1.939 +- 1.620 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.005 0.962 0.033 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.429 0.321 0.135 0.054 0.025 0.013 0.008 0.006 0.004 0.004 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.046 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.050 0.899 sum of density on p0-p1 = 1.000000 Time used: 0:20 Model 3: discrete (3 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 168 lnL(ntime: 7 np: 13): -2441.260829 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.060429 0.064243 0.012433 0.015374 0.114327 0.177836 0.099437 2.917795 0.077885 0.918490 0.000001 0.228411 12.106347 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54408 (1: 0.060429, (2: 0.012433, 3: 0.015374): 0.064243, (4: 0.177836, 5: 0.099437): 0.114327); (D_melanogaster_Gr39a-PC: 0.060429, (D_sechellia_Gr39a-PC: 0.012433, D_simulans_Gr39a-PC: 0.015374): 0.064243, (D_yakuba_Gr39a-PC: 0.177836, D_erecta_Gr39a-PC: 0.099437): 0.114327); Detailed output identifying parameters kappa (ts/tv) = 2.91779 dN/dS (w) for site classes (K=3) p: 0.07788 0.91849 0.00363 w: 0.00000 0.22841 12.10635 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.060 817.5 325.5 0.2537 0.0110 0.0432 9.0 14.1 6..7 0.064 817.5 325.5 0.2537 0.0117 0.0459 9.5 14.9 7..2 0.012 817.5 325.5 0.2537 0.0023 0.0089 1.8 2.9 7..3 0.015 817.5 325.5 0.2537 0.0028 0.0110 2.3 3.6 6..8 0.114 817.5 325.5 0.2537 0.0207 0.0817 17.0 26.6 8..4 0.178 817.5 325.5 0.2537 0.0323 0.1272 26.4 41.4 8..5 0.099 817.5 325.5 0.2537 0.0180 0.0711 14.7 23.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 1.000** 12.103 Time used: 0:31 Model 7: beta (10 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 168 lnL(ntime: 7 np: 10): -2446.250054 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.058551 0.061984 0.013262 0.014085 0.112986 0.170806 0.097006 2.852096 0.601202 1.971282 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.52868 (1: 0.058551, (2: 0.013262, 3: 0.014085): 0.061984, (4: 0.170806, 5: 0.097006): 0.112986); (D_melanogaster_Gr39a-PC: 0.058551, (D_sechellia_Gr39a-PC: 0.013262, D_simulans_Gr39a-PC: 0.014085): 0.061984, (D_yakuba_Gr39a-PC: 0.170806, D_erecta_Gr39a-PC: 0.097006): 0.112986); Detailed output identifying parameters kappa (ts/tv) = 2.85210 Parameters in M7 (beta): p = 0.60120 q = 1.97128 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00319 0.02003 0.04765 0.08537 0.13370 0.19413 0.26950 0.36533 0.49396 0.69808 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.059 818.6 324.4 0.2311 0.0100 0.0434 8.2 14.1 6..7 0.062 818.6 324.4 0.2311 0.0106 0.0460 8.7 14.9 7..2 0.013 818.6 324.4 0.2311 0.0023 0.0098 1.9 3.2 7..3 0.014 818.6 324.4 0.2311 0.0024 0.0104 2.0 3.4 6..8 0.113 818.6 324.4 0.2311 0.0194 0.0838 15.9 27.2 8..4 0.171 818.6 324.4 0.2311 0.0293 0.1267 24.0 41.1 8..5 0.097 818.6 324.4 0.2311 0.0166 0.0720 13.6 23.3 Time used: 0:44 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (2, 3), (4, 5)); MP score: 168 check convergence.. lnL(ntime: 7 np: 12): -2441.274511 +0.000000 6..1 6..7 7..2 7..3 6..8 8..4 8..5 0.060436 0.064253 0.012427 0.015384 0.114286 0.177759 0.099452 2.918022 0.996338 15.592169 58.471807 12.066687 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.54400 (1: 0.060436, (2: 0.012427, 3: 0.015384): 0.064253, (4: 0.177759, 5: 0.099452): 0.114286); (D_melanogaster_Gr39a-PC: 0.060436, (D_sechellia_Gr39a-PC: 0.012427, D_simulans_Gr39a-PC: 0.015384): 0.064253, (D_yakuba_Gr39a-PC: 0.177759, D_erecta_Gr39a-PC: 0.099452): 0.114286); Detailed output identifying parameters kappa (ts/tv) = 2.91802 Parameters in M8 (beta&w>1): p0 = 0.99634 p = 15.59217 q = 58.47181 (p1 = 0.00366) w = 12.06669 dN/dS (w) for site classes (K=11) p: 0.09963 0.09963 0.09963 0.09963 0.09963 0.09963 0.09963 0.09963 0.09963 0.09963 0.00366 w: 0.13777 0.16188 0.17726 0.19009 0.20201 0.21389 0.22651 0.24096 0.25960 0.29221 12.06669 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 6..1 0.060 817.5 325.5 0.2536 0.0110 0.0432 9.0 14.1 6..7 0.064 817.5 325.5 0.2536 0.0117 0.0459 9.5 15.0 7..2 0.012 817.5 325.5 0.2536 0.0023 0.0089 1.8 2.9 7..3 0.015 817.5 325.5 0.2536 0.0028 0.0110 2.3 3.6 6..8 0.114 817.5 325.5 0.2536 0.0207 0.0817 16.9 26.6 8..4 0.178 817.5 325.5 0.2536 0.0322 0.1271 26.4 41.4 8..5 0.099 817.5 325.5 0.2536 0.0180 0.0711 14.7 23.1 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 1.000** 12.063 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 0.915 1.676 +- 0.612 274 L 0.536 1.243 +- 0.774 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.992 p : 0.088 0.647 0.254 0.010 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.004 0.041 0.025 0.022 0.071 0.144 0.193 0.226 0.274 ws: 0.801 0.168 0.024 0.004 0.001 0.000 0.000 0.000 0.000 0.000 Time used: 1:34
Model 1: NearlyNeutral -2444.989248 Model 2: PositiveSelection -2441.277885 Model 0: one-ratio -2448.572241 Model 3: discrete -2441.260829 Model 7: beta -2446.250054 Model 8: beta&w>1 -2441.274511 Model 0 vs 1 7.165985999999975 Model 2 vs 1 7.422725999999784 Additional information for M1 vs M2: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 1.000** 12.029 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 0.917 2.526 +- 1.482 274 L 0.607 1.939 +- 1.620 Model 8 vs 7 9.951086000000032 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 1.000** 12.063 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_Gr39a-PC) Pr(w>1) post mean +- SE for w 193 D 0.915 1.676 +- 0.612 274 L 0.536 1.243 +- 0.774